FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 5402

FusionGeneSummary for CAMTA1_DHRS3

check button Fusion gene summary
Fusion gene informationFusion gene name: CAMTA1_DHRS3
Fusion gene ID: 5402
HgeneTgene
Gene symbol

CAMTA1

DHRS3

Gene ID

23261

9249

Gene namecalmodulin binding transcription activator 1dehydrogenase/reductase 3
SynonymsCANPMRDD83.1|RDH17|Rsdr1|SDR1|SDR16C1|retSDR1
Cytomap

1p36.31-p36.23

1p36.21

Type of geneprotein-codingprotein-coding
Descriptioncalmodulin-binding transcription activator 1short-chain dehydrogenase/reductase 3dehydrogenase/reductase (SDR family) member 3dehydrogenase/reductase member 3retinal short-chain dehydrogenase/reductase 1retinol dehydrogenase 17short chain dehydrogenase/reductase family 16C member 1short-chain
Modification date2018052320180523
UniProtAcc

Q9Y6Y1

O75911

Ensembl transtripts involved in fusion geneENST00000303635, ENST00000439411, 
ENST00000476163, ENST00000557126, 
ENST00000473578, ENST00000467404, 
ENST00000476864, 
ENST00000376223, 
ENST00000482265, 
Fusion gene scores* DoF score7 X 6 X 3=1263 X 1 X 3=9
# samples 73
** MAII scorelog2(7/126*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/9*10)=1.73696559416621
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: CAMTA1 [Title/Abstract] AND DHRS3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-46-3769-01ACAMTA1chr1

6845635

+DHRS3chr1

12640694

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000303635ENST00000376223CAMTA1chr1

6845635

+DHRS3chr1

12640694

-
5CDS-5UTRENST00000303635ENST00000482265CAMTA1chr1

6845635

+DHRS3chr1

12640694

-
In-frameENST00000439411ENST00000376223CAMTA1chr1

6845635

+DHRS3chr1

12640694

-
5CDS-5UTRENST00000439411ENST00000482265CAMTA1chr1

6845635

+DHRS3chr1

12640694

-
3UTR-3CDSENST00000476163ENST00000376223CAMTA1chr1

6845635

+DHRS3chr1

12640694

-
3UTR-5UTRENST00000476163ENST00000482265CAMTA1chr1

6845635

+DHRS3chr1

12640694

-
In-frameENST00000557126ENST00000376223CAMTA1chr1

6845635

+DHRS3chr1

12640694

-
5CDS-5UTRENST00000557126ENST00000482265CAMTA1chr1

6845635

+DHRS3chr1

12640694

-
In-frameENST00000473578ENST00000376223CAMTA1chr1

6845635

+DHRS3chr1

12640694

-
5CDS-5UTRENST00000473578ENST00000482265CAMTA1chr1

6845635

+DHRS3chr1

12640694

-
In-frameENST00000467404ENST00000376223CAMTA1chr1

6845635

+DHRS3chr1

12640694

-
5CDS-5UTRENST00000467404ENST00000482265CAMTA1chr1

6845635

+DHRS3chr1

12640694

-
intron-3CDSENST00000476864ENST00000376223CAMTA1chr1

6845635

+DHRS3chr1

12640694

-
intron-5UTRENST00000476864ENST00000482265CAMTA1chr1

6845635

+DHRS3chr1

12640694

-

Top

FusionProtFeatures for CAMTA1_DHRS3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CAMTA1

Q9Y6Y1

DHRS3

O75911

Transcriptional activator. May act as a tumorsuppressor. {ECO:0000269|PubMed:11925432,ECO:0000269|PubMed:15709179}. Catalyzes the reduction of all-trans-retinal to all-trans-retinol in the presence of NADPH.{ECO:0000269|PubMed:9705317}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneDHRS3chr1:6845635chr1:12640694ENST00000376223-06170_19065303TransmembraneHelical
TgeneDHRS3chr1:6845635chr1:12640694ENST00000376223-06195_21565303TransmembraneHelical
TgeneDHRS3chr1:6845635chr1:12640694ENST00000376223-06253_27365303TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000303635+1231038_1041151674Compositional biasNote=Poly-Val
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000303635+123499_502151674Compositional biasNote=Poly-Gly
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000439411+1221038_1041151660Compositional biasNote=Poly-Val
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000439411+122499_502151660Compositional biasNote=Poly-Gly
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000473578+141038_10411581Compositional biasNote=Poly-Val
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000473578+14499_5021581Compositional biasNote=Poly-Gly
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000476864+161038_10410238Compositional biasNote=Poly-Val
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000476864+16499_5020238Compositional biasNote=Poly-Gly
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000557126+141038_104115102Compositional biasNote=Poly-Val
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000557126+14499_50215102Compositional biasNote=Poly-Gly
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000303635+12363_188151674DNA bindingCG-1
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000439411+12263_188151660DNA bindingCG-1
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000473578+1463_1881581DNA bindingCG-1
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000476864+1663_1880238DNA bindingCG-1
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000557126+1463_18815102DNA bindingCG-1
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000303635+1231547_1576151674DomainIQ 1
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000303635+1231577_1599151674DomainIQ 2
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000303635+1231600_1622151674DomainIQ 3
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000303635+123873_953151674DomainNote=IPT/TIG
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000439411+1221547_1576151660DomainIQ 1
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000439411+1221577_1599151660DomainIQ 2
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000439411+1221600_1622151660DomainIQ 3
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000439411+122873_953151660DomainNote=IPT/TIG
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000473578+141547_15761581DomainIQ 1
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000473578+141577_15991581DomainIQ 2
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000473578+141600_16221581DomainIQ 3
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000473578+14873_9531581DomainNote=IPT/TIG
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000476864+161547_15760238DomainIQ 1
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000476864+161577_15990238DomainIQ 2
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000476864+161600_16220238DomainIQ 3
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000476864+16873_9530238DomainNote=IPT/TIG
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000557126+141547_157615102DomainIQ 1
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000557126+141577_159915102DomainIQ 2
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000557126+141600_162215102DomainIQ 3
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000557126+14873_95315102DomainNote=IPT/TIG
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000303635+123112_119151674MotifNuclear localization signal
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000439411+122112_119151660MotifNuclear localization signal
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000473578+14112_1191581MotifNuclear localization signal
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000476864+16112_1190238MotifNuclear localization signal
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000557126+14112_11915102MotifNuclear localization signal
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000303635+1231064_1093151674RepeatNote=ANK 1
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000303635+1231109_1129151674RepeatNote=ANK 2
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000303635+1231143_1172151674RepeatNote=ANK 3
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000439411+1221064_1093151660RepeatNote=ANK 1
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000439411+1221109_1129151660RepeatNote=ANK 2
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000439411+1221143_1172151660RepeatNote=ANK 3
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000473578+141064_10931581RepeatNote=ANK 1
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000473578+141109_11291581RepeatNote=ANK 2
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000473578+141143_11721581RepeatNote=ANK 3
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000476864+161064_10930238RepeatNote=ANK 1
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000476864+161109_11290238RepeatNote=ANK 2
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000476864+161143_11720238RepeatNote=ANK 3
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000557126+141064_109315102RepeatNote=ANK 1
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000557126+141109_112915102RepeatNote=ANK 2
HgeneCAMTA1chr1:6845635chr1:12640694ENST00000557126+141143_117215102RepeatNote=ANK 3
TgeneDHRS3chr1:6845635chr1:12640694ENST00000376223-069_2965303TransmembraneHelical


Top

FusionGeneSequence for CAMTA1_DHRS3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CAMTA1_ENST00000303635_chr1_6845635_+_DHRS3_ENST00000376223_chr1_12640694_-_253aa
MWRAEGKWLPKTSRKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDAL
LKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGM

>In-frame_CAMTA1_ENST00000439411_chr1_6845635_+_DHRS3_ENST00000376223_chr1_12640694_-_253aa
MWRAEGKWLPKTSRKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDAL
LKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGM

>In-frame_CAMTA1_ENST00000557126_chr1_6845635_+_DHRS3_ENST00000376223_chr1_12640694_-_253aa
MWRAEGKWLPKTSRKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDAL
LKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGM

>In-frame_CAMTA1_ENST00000473578_chr1_6845635_+_DHRS3_ENST00000376223_chr1_12640694_-_253aa
MWRAEGKWLPKTSRKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDAL
LKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGM

>In-frame_CAMTA1_ENST00000467404_chr1_6845635_+_DHRS3_ENST00000376223_chr1_12640694_-_253aa
MWRAEGKWLPKTSRKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDAL
LKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGM


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CAMTA1_ENST00000303635_chr1_6845635_+_DHRS3_ENST00000376223_chr1_12640694_-_759nt
ATGTGGCGCGCGGAGGGGAAATGGCTGCCGAAAACAAGCCGGAAGATTGTTCTCTGGGGCCGGACTGAGAAATGCCTGAAGGAGACGACG
GAGGAGATCCGGCAGATGGGCACTGAGTGCCATTACTTCATCTGTGATGTGGGCAACCGGGAGGAGGTGTACCAGACGGCCAAGGCCGTC
CGGGAGAAGGTGGGTGACATCACCATCCTGGTGAACAATGCCGCCGTGGTCCATGGGAAGAGCCTAATGGACAGTGATGATGATGCCCTC
CTCAAGTCCCAACACATCAACACCCTGGGCCAGTTCTGGACCACCAAGGCCTTCCTGCCACGTATGCTGGAGCTGCAGAATGGCCACATC
GTGTGCCTCAACTCCGTGCTGGCACTGTCTGCCATCCCCGGTGCCATCGACTACTGCACATCCAAAGCGTCAGCCTTCGCCTTCATGGAG
AGCCTGACCCTGGGGCTGCTGGACTGTCCGGGAGTCAGCGCCACCACAGTGCTGCCCTTCCACACCAGCACCGAGATGTTCCAGGGCATG
AGAGTCAGGTTTCCCAACCTCTTTCCCCCACTGAAGCCGGAGACGGTGGCCCGGAGGACAGTGGAAGCTGTGCAGCTCAACCAGGCCCTC
CTCCTCCTCCCATGGACAATGCATGCCCTCGTTATCTTGAAAAGCATACTTCCACAGGCTGCACTCGAGGAGATCCACAAATTCTCAGGA

>In-frame_CAMTA1_ENST00000439411_chr1_6845635_+_DHRS3_ENST00000376223_chr1_12640694_-_759nt
ATGTGGCGCGCGGAGGGGAAATGGCTGCCGAAAACAAGCCGGAAGATTGTTCTCTGGGGCCGGACTGAGAAATGCCTGAAGGAGACGACG
GAGGAGATCCGGCAGATGGGCACTGAGTGCCATTACTTCATCTGTGATGTGGGCAACCGGGAGGAGGTGTACCAGACGGCCAAGGCCGTC
CGGGAGAAGGTGGGTGACATCACCATCCTGGTGAACAATGCCGCCGTGGTCCATGGGAAGAGCCTAATGGACAGTGATGATGATGCCCTC
CTCAAGTCCCAACACATCAACACCCTGGGCCAGTTCTGGACCACCAAGGCCTTCCTGCCACGTATGCTGGAGCTGCAGAATGGCCACATC
GTGTGCCTCAACTCCGTGCTGGCACTGTCTGCCATCCCCGGTGCCATCGACTACTGCACATCCAAAGCGTCAGCCTTCGCCTTCATGGAG
AGCCTGACCCTGGGGCTGCTGGACTGTCCGGGAGTCAGCGCCACCACAGTGCTGCCCTTCCACACCAGCACCGAGATGTTCCAGGGCATG
AGAGTCAGGTTTCCCAACCTCTTTCCCCCACTGAAGCCGGAGACGGTGGCCCGGAGGACAGTGGAAGCTGTGCAGCTCAACCAGGCCCTC
CTCCTCCTCCCATGGACAATGCATGCCCTCGTTATCTTGAAAAGCATACTTCCACAGGCTGCACTCGAGGAGATCCACAAATTCTCAGGA

>In-frame_CAMTA1_ENST00000557126_chr1_6845635_+_DHRS3_ENST00000376223_chr1_12640694_-_759nt
ATGTGGCGCGCGGAGGGGAAATGGCTGCCGAAAACAAGCCGGAAGATTGTTCTCTGGGGCCGGACTGAGAAATGCCTGAAGGAGACGACG
GAGGAGATCCGGCAGATGGGCACTGAGTGCCATTACTTCATCTGTGATGTGGGCAACCGGGAGGAGGTGTACCAGACGGCCAAGGCCGTC
CGGGAGAAGGTGGGTGACATCACCATCCTGGTGAACAATGCCGCCGTGGTCCATGGGAAGAGCCTAATGGACAGTGATGATGATGCCCTC
CTCAAGTCCCAACACATCAACACCCTGGGCCAGTTCTGGACCACCAAGGCCTTCCTGCCACGTATGCTGGAGCTGCAGAATGGCCACATC
GTGTGCCTCAACTCCGTGCTGGCACTGTCTGCCATCCCCGGTGCCATCGACTACTGCACATCCAAAGCGTCAGCCTTCGCCTTCATGGAG
AGCCTGACCCTGGGGCTGCTGGACTGTCCGGGAGTCAGCGCCACCACAGTGCTGCCCTTCCACACCAGCACCGAGATGTTCCAGGGCATG
AGAGTCAGGTTTCCCAACCTCTTTCCCCCACTGAAGCCGGAGACGGTGGCCCGGAGGACAGTGGAAGCTGTGCAGCTCAACCAGGCCCTC
CTCCTCCTCCCATGGACAATGCATGCCCTCGTTATCTTGAAAAGCATACTTCCACAGGCTGCACTCGAGGAGATCCACAAATTCTCAGGA

>In-frame_CAMTA1_ENST00000473578_chr1_6845635_+_DHRS3_ENST00000376223_chr1_12640694_-_759nt
ATGTGGCGCGCGGAGGGGAAATGGCTGCCGAAAACAAGCCGGAAGATTGTTCTCTGGGGCCGGACTGAGAAATGCCTGAAGGAGACGACG
GAGGAGATCCGGCAGATGGGCACTGAGTGCCATTACTTCATCTGTGATGTGGGCAACCGGGAGGAGGTGTACCAGACGGCCAAGGCCGTC
CGGGAGAAGGTGGGTGACATCACCATCCTGGTGAACAATGCCGCCGTGGTCCATGGGAAGAGCCTAATGGACAGTGATGATGATGCCCTC
CTCAAGTCCCAACACATCAACACCCTGGGCCAGTTCTGGACCACCAAGGCCTTCCTGCCACGTATGCTGGAGCTGCAGAATGGCCACATC
GTGTGCCTCAACTCCGTGCTGGCACTGTCTGCCATCCCCGGTGCCATCGACTACTGCACATCCAAAGCGTCAGCCTTCGCCTTCATGGAG
AGCCTGACCCTGGGGCTGCTGGACTGTCCGGGAGTCAGCGCCACCACAGTGCTGCCCTTCCACACCAGCACCGAGATGTTCCAGGGCATG
AGAGTCAGGTTTCCCAACCTCTTTCCCCCACTGAAGCCGGAGACGGTGGCCCGGAGGACAGTGGAAGCTGTGCAGCTCAACCAGGCCCTC
CTCCTCCTCCCATGGACAATGCATGCCCTCGTTATCTTGAAAAGCATACTTCCACAGGCTGCACTCGAGGAGATCCACAAATTCTCAGGA

>In-frame_CAMTA1_ENST00000467404_chr1_6845635_+_DHRS3_ENST00000376223_chr1_12640694_-_759nt
ATGTGGCGCGCGGAGGGGAAATGGCTGCCGAAAACAAGCCGGAAGATTGTTCTCTGGGGCCGGACTGAGAAATGCCTGAAGGAGACGACG
GAGGAGATCCGGCAGATGGGCACTGAGTGCCATTACTTCATCTGTGATGTGGGCAACCGGGAGGAGGTGTACCAGACGGCCAAGGCCGTC
CGGGAGAAGGTGGGTGACATCACCATCCTGGTGAACAATGCCGCCGTGGTCCATGGGAAGAGCCTAATGGACAGTGATGATGATGCCCTC
CTCAAGTCCCAACACATCAACACCCTGGGCCAGTTCTGGACCACCAAGGCCTTCCTGCCACGTATGCTGGAGCTGCAGAATGGCCACATC
GTGTGCCTCAACTCCGTGCTGGCACTGTCTGCCATCCCCGGTGCCATCGACTACTGCACATCCAAAGCGTCAGCCTTCGCCTTCATGGAG
AGCCTGACCCTGGGGCTGCTGGACTGTCCGGGAGTCAGCGCCACCACAGTGCTGCCCTTCCACACCAGCACCGAGATGTTCCAGGGCATG
AGAGTCAGGTTTCCCAACCTCTTTCCCCCACTGAAGCCGGAGACGGTGGCCCGGAGGACAGTGGAAGCTGTGCAGCTCAACCAGGCCCTC
CTCCTCCTCCCATGGACAATGCATGCCCTCGTTATCTTGAAAAGCATACTTCCACAGGCTGCACTCGAGGAGATCCACAAATTCTCAGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_CAMTA1_ENST00000303635_chr1_6845635_+_DHRS3_ENST00000376223_chr1_12640694_-_1396nt
GACGCTCCTCCCGGAGAGTAGTGAGACCCCTGGTGCGGGGCGATTGGCGGCGGGAGCGATGAGTGGCAGCCGCACGGCCCAACGGGAGCT
GTGCGTGGGCCGCGGGGCGGGGCCAGGGCGGGTGCGCGGCGGCGGCGGGGTGGCTGGGCCGGCGGCGGCGGCGGTACGAGGCGCGCGCTC
GGGGTCCCGGTCGCGAGGAGGAGGAGGATGTGGCGCGCGGAGGGGAAATGGCTGCCGAAAACAAGCCGGAAGATTGTTCTCTGGGGCCGG
ACTGAGAAATGCCTGAAGGAGACGACGGAGGAGATCCGGCAGATGGGCACTGAGTGCCATTACTTCATCTGTGATGTGGGCAACCGGGAG
GAGGTGTACCAGACGGCCAAGGCCGTCCGGGAGAAGGTGGGTGACATCACCATCCTGGTGAACAATGCCGCCGTGGTCCATGGGAAGAGC
CTAATGGACAGTGATGATGATGCCCTCCTCAAGTCCCAACACATCAACACCCTGGGCCAGTTCTGGACCACCAAGGCCTTCCTGCCACGT
ATGCTGGAGCTGCAGAATGGCCACATCGTGTGCCTCAACTCCGTGCTGGCACTGTCTGCCATCCCCGGTGCCATCGACTACTGCACATCC
AAAGCGTCAGCCTTCGCCTTCATGGAGAGCCTGACCCTGGGGCTGCTGGACTGTCCGGGAGTCAGCGCCACCACAGTGCTGCCCTTCCAC
ACCAGCACCGAGATGTTCCAGGGCATGAGAGTCAGGTTTCCCAACCTCTTTCCCCCACTGAAGCCGGAGACGGTGGCCCGGAGGACAGTG
GAAGCTGTGCAGCTCAACCAGGCCCTCCTCCTCCTCCCATGGACAATGCATGCCCTCGTTATCTTGAAAAGCATACTTCCACAGGCTGCA
CTCGAGGAGATCCACAAATTCTCAGGAACCTACACCTGCATGAACACTTTCAAAGGGCGGACATAGAGACAGGATGAAGACATGCTTGAG
GAGCCACGGAGTTTGGGGGCCACAGCACCTGGGCACACACCCGAGCACCTGTCCATTGGCATGCTTCTGCTGGGTGAGCAGGACAGCTCC
TGTCCCCAGCGAAGAATCCGGCTGCCCCTGGGCCAGTCCCAGGACCTTTGCACAGGACTGATGGGTATAACTGACCCCCACAGGGAGGCA
GGAAAACAGCCAGAAGCCACCTTGACACTTTTGAACATTTCCAGTTCTGTAGAGTTTATTGTCAATTGCTTCTCAAGTCTAACCAGCCTC
AGCAGTGTGCATAGACCATTTCCAGGAGGGTCTGTCCCCAGATGCTCTGCCTCCCGTTCCAAAACCCACTCATCCTCAGCTTGCACAAAC

>In-frame_CAMTA1_ENST00000439411_chr1_6845635_+_DHRS3_ENST00000376223_chr1_12640694_-_1189nt
ATGTGGCGCGCGGAGGGGAAATGGCTGCCGAAAACAAGCCGGAAGATTGTTCTCTGGGGCCGGACTGAGAAATGCCTGAAGGAGACGACG
GAGGAGATCCGGCAGATGGGCACTGAGTGCCATTACTTCATCTGTGATGTGGGCAACCGGGAGGAGGTGTACCAGACGGCCAAGGCCGTC
CGGGAGAAGGTGGGTGACATCACCATCCTGGTGAACAATGCCGCCGTGGTCCATGGGAAGAGCCTAATGGACAGTGATGATGATGCCCTC
CTCAAGTCCCAACACATCAACACCCTGGGCCAGTTCTGGACCACCAAGGCCTTCCTGCCACGTATGCTGGAGCTGCAGAATGGCCACATC
GTGTGCCTCAACTCCGTGCTGGCACTGTCTGCCATCCCCGGTGCCATCGACTACTGCACATCCAAAGCGTCAGCCTTCGCCTTCATGGAG
AGCCTGACCCTGGGGCTGCTGGACTGTCCGGGAGTCAGCGCCACCACAGTGCTGCCCTTCCACACCAGCACCGAGATGTTCCAGGGCATG
AGAGTCAGGTTTCCCAACCTCTTTCCCCCACTGAAGCCGGAGACGGTGGCCCGGAGGACAGTGGAAGCTGTGCAGCTCAACCAGGCCCTC
CTCCTCCTCCCATGGACAATGCATGCCCTCGTTATCTTGAAAAGCATACTTCCACAGGCTGCACTCGAGGAGATCCACAAATTCTCAGGA
ACCTACACCTGCATGAACACTTTCAAAGGGCGGACATAGAGACAGGATGAAGACATGCTTGAGGAGCCACGGAGTTTGGGGGCCACAGCA
CCTGGGCACACACCCGAGCACCTGTCCATTGGCATGCTTCTGCTGGGTGAGCAGGACAGCTCCTGTCCCCAGCGAAGAATCCGGCTGCCC
CTGGGCCAGTCCCAGGACCTTTGCACAGGACTGATGGGTATAACTGACCCCCACAGGGAGGCAGGAAAACAGCCAGAAGCCACCTTGACA
CTTTTGAACATTTCCAGTTCTGTAGAGTTTATTGTCAATTGCTTCTCAAGTCTAACCAGCCTCAGCAGTGTGCATAGACCATTTCCAGGA
GGGTCTGTCCCCAGATGCTCTGCCTCCCGTTCCAAAACCCACTCATCCTCAGCTTGCACAAACTGGTTGAACGGCAGGAATGAAAAATAA

>In-frame_CAMTA1_ENST00000557126_chr1_6845635_+_DHRS3_ENST00000376223_chr1_12640694_-_1229nt
GAGGCGCGCGCTCGGGGTCCCGGTCGCGAGGAGGAGGAGGATGTGGCGCGCGGAGGGGAAATGGCTGCCGAAAACAAGCCGGAAGATTGT
TCTCTGGGGCCGGACTGAGAAATGCCTGAAGGAGACGACGGAGGAGATCCGGCAGATGGGCACTGAGTGCCATTACTTCATCTGTGATGT
GGGCAACCGGGAGGAGGTGTACCAGACGGCCAAGGCCGTCCGGGAGAAGGTGGGTGACATCACCATCCTGGTGAACAATGCCGCCGTGGT
CCATGGGAAGAGCCTAATGGACAGTGATGATGATGCCCTCCTCAAGTCCCAACACATCAACACCCTGGGCCAGTTCTGGACCACCAAGGC
CTTCCTGCCACGTATGCTGGAGCTGCAGAATGGCCACATCGTGTGCCTCAACTCCGTGCTGGCACTGTCTGCCATCCCCGGTGCCATCGA
CTACTGCACATCCAAAGCGTCAGCCTTCGCCTTCATGGAGAGCCTGACCCTGGGGCTGCTGGACTGTCCGGGAGTCAGCGCCACCACAGT
GCTGCCCTTCCACACCAGCACCGAGATGTTCCAGGGCATGAGAGTCAGGTTTCCCAACCTCTTTCCCCCACTGAAGCCGGAGACGGTGGC
CCGGAGGACAGTGGAAGCTGTGCAGCTCAACCAGGCCCTCCTCCTCCTCCCATGGACAATGCATGCCCTCGTTATCTTGAAAAGCATACT
TCCACAGGCTGCACTCGAGGAGATCCACAAATTCTCAGGAACCTACACCTGCATGAACACTTTCAAAGGGCGGACATAGAGACAGGATGA
AGACATGCTTGAGGAGCCACGGAGTTTGGGGGCCACAGCACCTGGGCACACACCCGAGCACCTGTCCATTGGCATGCTTCTGCTGGGTGA
GCAGGACAGCTCCTGTCCCCAGCGAAGAATCCGGCTGCCCCTGGGCCAGTCCCAGGACCTTTGCACAGGACTGATGGGTATAACTGACCC
CCACAGGGAGGCAGGAAAACAGCCAGAAGCCACCTTGACACTTTTGAACATTTCCAGTTCTGTAGAGTTTATTGTCAATTGCTTCTCAAG
TCTAACCAGCCTCAGCAGTGTGCATAGACCATTTCCAGGAGGGTCTGTCCCCAGATGCTCTGCCTCCCGTTCCAAAACCCACTCATCCTC

>In-frame_CAMTA1_ENST00000473578_chr1_6845635_+_DHRS3_ENST00000376223_chr1_12640694_-_1240nt
GGCGGCGGTACGAGGCGCGCGCTCGGGGTCCCGGTCGCGAGGAGGAGGAGGATGTGGCGCGCGGAGGGGAAATGGCTGCCGAAAACAAGC
CGGAAGATTGTTCTCTGGGGCCGGACTGAGAAATGCCTGAAGGAGACGACGGAGGAGATCCGGCAGATGGGCACTGAGTGCCATTACTTC
ATCTGTGATGTGGGCAACCGGGAGGAGGTGTACCAGACGGCCAAGGCCGTCCGGGAGAAGGTGGGTGACATCACCATCCTGGTGAACAAT
GCCGCCGTGGTCCATGGGAAGAGCCTAATGGACAGTGATGATGATGCCCTCCTCAAGTCCCAACACATCAACACCCTGGGCCAGTTCTGG
ACCACCAAGGCCTTCCTGCCACGTATGCTGGAGCTGCAGAATGGCCACATCGTGTGCCTCAACTCCGTGCTGGCACTGTCTGCCATCCCC
GGTGCCATCGACTACTGCACATCCAAAGCGTCAGCCTTCGCCTTCATGGAGAGCCTGACCCTGGGGCTGCTGGACTGTCCGGGAGTCAGC
GCCACCACAGTGCTGCCCTTCCACACCAGCACCGAGATGTTCCAGGGCATGAGAGTCAGGTTTCCCAACCTCTTTCCCCCACTGAAGCCG
GAGACGGTGGCCCGGAGGACAGTGGAAGCTGTGCAGCTCAACCAGGCCCTCCTCCTCCTCCCATGGACAATGCATGCCCTCGTTATCTTG
AAAAGCATACTTCCACAGGCTGCACTCGAGGAGATCCACAAATTCTCAGGAACCTACACCTGCATGAACACTTTCAAAGGGCGGACATAG
AGACAGGATGAAGACATGCTTGAGGAGCCACGGAGTTTGGGGGCCACAGCACCTGGGCACACACCCGAGCACCTGTCCATTGGCATGCTT
CTGCTGGGTGAGCAGGACAGCTCCTGTCCCCAGCGAAGAATCCGGCTGCCCCTGGGCCAGTCCCAGGACCTTTGCACAGGACTGATGGGT
ATAACTGACCCCCACAGGGAGGCAGGAAAACAGCCAGAAGCCACCTTGACACTTTTGAACATTTCCAGTTCTGTAGAGTTTATTGTCAAT
TGCTTCTCAAGTCTAACCAGCCTCAGCAGTGTGCATAGACCATTTCCAGGAGGGTCTGTCCCCAGATGCTCTGCCTCCCGTTCCAAAACC

>In-frame_CAMTA1_ENST00000467404_chr1_6845635_+_DHRS3_ENST00000376223_chr1_12640694_-_1202nt
GAGGAGGAGGAGGATGTGGCGCGCGGAGGGGAAATGGCTGCCGAAAACAAGCCGGAAGATTGTTCTCTGGGGCCGGACTGAGAAATGCCT
GAAGGAGACGACGGAGGAGATCCGGCAGATGGGCACTGAGTGCCATTACTTCATCTGTGATGTGGGCAACCGGGAGGAGGTGTACCAGAC
GGCCAAGGCCGTCCGGGAGAAGGTGGGTGACATCACCATCCTGGTGAACAATGCCGCCGTGGTCCATGGGAAGAGCCTAATGGACAGTGA
TGATGATGCCCTCCTCAAGTCCCAACACATCAACACCCTGGGCCAGTTCTGGACCACCAAGGCCTTCCTGCCACGTATGCTGGAGCTGCA
GAATGGCCACATCGTGTGCCTCAACTCCGTGCTGGCACTGTCTGCCATCCCCGGTGCCATCGACTACTGCACATCCAAAGCGTCAGCCTT
CGCCTTCATGGAGAGCCTGACCCTGGGGCTGCTGGACTGTCCGGGAGTCAGCGCCACCACAGTGCTGCCCTTCCACACCAGCACCGAGAT
GTTCCAGGGCATGAGAGTCAGGTTTCCCAACCTCTTTCCCCCACTGAAGCCGGAGACGGTGGCCCGGAGGACAGTGGAAGCTGTGCAGCT
CAACCAGGCCCTCCTCCTCCTCCCATGGACAATGCATGCCCTCGTTATCTTGAAAAGCATACTTCCACAGGCTGCACTCGAGGAGATCCA
CAAATTCTCAGGAACCTACACCTGCATGAACACTTTCAAAGGGCGGACATAGAGACAGGATGAAGACATGCTTGAGGAGCCACGGAGTTT
GGGGGCCACAGCACCTGGGCACACACCCGAGCACCTGTCCATTGGCATGCTTCTGCTGGGTGAGCAGGACAGCTCCTGTCCCCAGCGAAG
AATCCGGCTGCCCCTGGGCCAGTCCCAGGACCTTTGCACAGGACTGATGGGTATAACTGACCCCCACAGGGAGGCAGGAAAACAGCCAGA
AGCCACCTTGACACTTTTGAACATTTCCAGTTCTGTAGAGTTTATTGTCAATTGCTTCTCAAGTCTAACCAGCCTCAGCAGTGTGCATAG
ACCATTTCCAGGAGGGTCTGTCCCCAGATGCTCTGCCTCCCGTTCCAAAACCCACTCATCCTCAGCTTGCACAAACTGGTTGAACGGCAG


Top

FusionGenePPI for CAMTA1_DHRS3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CAMTA1ALB, TRIM25DHRS3ELAVL1, MED21, TLR5, C5AR2, IL17RC, IL4R


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CAMTA1_DHRS3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneDHRS3O75911DB00162Vitamin AShort-chain dehydrogenase/reductase 3small moleculeapproved|nutraceutical|vet_approved

Top

RelatedDiseases for CAMTA1_DHRS3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneDHRS3C0023893Liver Cirrhosis, Experimental1CTD_human