FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 5352

FusionGeneSummary for CAMK2D_ANK2

check button Fusion gene summary
Fusion gene informationFusion gene name: CAMK2D_ANK2
Fusion gene ID: 5352
HgeneTgene
Gene symbol

CAMK2D

ANK2

Gene ID

817

287

Gene namecalcium/calmodulin dependent protein kinase II deltaankyrin 2
SynonymsCAMKDANK-2|LQT4|brank-2
Cytomap

4q26

4q25-q26

Type of geneprotein-codingprotein-coding
Descriptioncalcium/calmodulin-dependent protein kinase type II subunit deltaCaM kinase II delta subunitCaM-kinase II delta chainCaMK-II delta subunitcalcium/calmodulin-dependent protein kinase (CaM kinase) II deltacalcium/calmodulin-dependent protein kinase typankyrin-2ankyrin 2, neuronalankyrin Bankyrin, brainankyrin-2, nonerythrocyticnon-erythroid ankyrin
Modification date2018052320180523
UniProtAcc

Q13557

Q01484

Ensembl transtripts involved in fusion geneENST00000394524, ENST00000454265, 
ENST00000394526, ENST00000429180, 
ENST00000296402, ENST00000418639, 
ENST00000511664, ENST00000342666, 
ENST00000515496, ENST00000514328, 
ENST00000394522, ENST00000505990, 
ENST00000379773, ENST00000508738, 
ENST00000509907, 
ENST00000506722, 
ENST00000394537, ENST00000357077, 
ENST00000264366, ENST00000509550, 
ENST00000510275, ENST00000504887, 
Fusion gene scores* DoF score7 X 8 X 6=3366 X 8 X 3=144
# samples 89
** MAII scorelog2(8/336*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/144*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CAMK2D [Title/Abstract] AND ANK2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCAMK2D

GO:0003254

regulation of membrane depolarization

22514276

HgeneCAMK2D

GO:0006468

protein phosphorylation

17179159|23283722

HgeneCAMK2D

GO:0018105

peptidyl-serine phosphorylation

22514276|23283722

HgeneCAMK2D

GO:0018107

peptidyl-threonine phosphorylation

22514276|23283722

HgeneCAMK2D

GO:0046777

protein autophosphorylation

22514276

HgeneCAMK2D

GO:0051259

protein complex oligomerization

20668654

HgeneCAMK2D

GO:1901897

regulation of relaxation of cardiac muscle

23283722

HgeneCAMK2D

GO:1902306

negative regulation of sodium ion transmembrane transport

22514276

HgeneCAMK2D

GO:2000650

negative regulation of sodium ion transmembrane transporter activity

22514276


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-DU-5855-01ACAMK2Dchr4

114436225

-ANK2chr4

114179206

+
TCGARVLUSCTCGA-98-A53A-01ACAMK2Dchr4

114430794

-ANK2chr4

114302613

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000394524ENST00000506722CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000394524ENST00000394537CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000394524ENST00000357077CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000394524ENST00000264366CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000394524ENST00000509550CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000394524ENST00000510275CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000394524ENST00000504887CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000454265ENST00000506722CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000454265ENST00000394537CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000454265ENST00000357077CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000454265ENST00000264366CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000454265ENST00000509550CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000454265ENST00000510275CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000454265ENST00000504887CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000394526ENST00000506722CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000394526ENST00000394537CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000394526ENST00000357077CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000394526ENST00000264366CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000394526ENST00000509550CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000394526ENST00000510275CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000394526ENST00000504887CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000429180ENST00000506722CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000429180ENST00000394537CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000429180ENST00000357077CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000429180ENST00000264366CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000429180ENST00000509550CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000429180ENST00000510275CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000429180ENST00000504887CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000296402ENST00000506722CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000296402ENST00000394537CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000296402ENST00000357077CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000296402ENST00000264366CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000296402ENST00000509550CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000296402ENST00000510275CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000296402ENST00000504887CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000418639ENST00000506722CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000418639ENST00000394537CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000418639ENST00000357077CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000418639ENST00000264366CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000418639ENST00000509550CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000418639ENST00000510275CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000418639ENST00000504887CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000511664ENST00000506722CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000511664ENST00000394537CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000511664ENST00000357077CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000511664ENST00000264366CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000511664ENST00000509550CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000511664ENST00000510275CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000511664ENST00000504887CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000342666ENST00000506722CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000342666ENST00000394537CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000342666ENST00000357077CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000342666ENST00000264366CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000342666ENST00000509550CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000342666ENST00000510275CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000342666ENST00000504887CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000515496ENST00000506722CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000515496ENST00000394537CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000515496ENST00000357077CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000515496ENST00000264366CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000515496ENST00000509550CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000515496ENST00000510275CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000515496ENST00000504887CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000514328ENST00000506722CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000514328ENST00000394537CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000514328ENST00000357077CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000514328ENST00000264366CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000514328ENST00000509550CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000514328ENST00000510275CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000514328ENST00000504887CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000394522ENST00000506722CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000394522ENST00000394537CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000394522ENST00000357077CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000394522ENST00000264366CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000394522ENST00000509550CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000394522ENST00000510275CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000394522ENST00000504887CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000505990ENST00000506722CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000505990ENST00000394537CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000505990ENST00000357077CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000505990ENST00000264366CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000505990ENST00000509550CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000505990ENST00000510275CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000505990ENST00000504887CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000379773ENST00000506722CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000379773ENST00000394537CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000379773ENST00000357077CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000379773ENST00000264366CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000379773ENST00000509550CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000379773ENST00000510275CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000379773ENST00000504887CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000508738ENST00000506722CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000508738ENST00000394537CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000508738ENST00000357077CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
In-frameENST00000508738ENST00000264366CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000508738ENST00000509550CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000508738ENST00000510275CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
5CDS-intronENST00000508738ENST00000504887CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
intron-3CDSENST00000509907ENST00000506722CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
intron-3CDSENST00000509907ENST00000394537CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
intron-3CDSENST00000509907ENST00000357077CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
intron-3CDSENST00000509907ENST00000264366CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
intron-intronENST00000509907ENST00000509550CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
intron-intronENST00000509907ENST00000510275CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
intron-intronENST00000509907ENST00000504887CAMK2Dchr4

114436225

-ANK2chr4

114179206

+
Frame-shiftENST00000394524ENST00000506722CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000394524ENST00000394537CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000394524ENST00000357077CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000394524ENST00000264366CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000394524ENST00000509550CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000394524ENST00000510275CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
5CDS-intronENST00000394524ENST00000504887CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000454265ENST00000506722CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000454265ENST00000394537CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000454265ENST00000357077CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000454265ENST00000264366CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000454265ENST00000509550CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000454265ENST00000510275CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
5CDS-intronENST00000454265ENST00000504887CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000394526ENST00000506722CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000394526ENST00000394537CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000394526ENST00000357077CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000394526ENST00000264366CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000394526ENST00000509550CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000394526ENST00000510275CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
5CDS-intronENST00000394526ENST00000504887CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000429180ENST00000506722CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000429180ENST00000394537CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000429180ENST00000357077CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000429180ENST00000264366CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000429180ENST00000509550CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000429180ENST00000510275CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
5CDS-intronENST00000429180ENST00000504887CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000296402ENST00000506722CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000296402ENST00000394537CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000296402ENST00000357077CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000296402ENST00000264366CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000296402ENST00000509550CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000296402ENST00000510275CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
5CDS-intronENST00000296402ENST00000504887CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000418639ENST00000506722CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000418639ENST00000394537CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000418639ENST00000357077CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000418639ENST00000264366CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000418639ENST00000509550CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000418639ENST00000510275CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
5CDS-intronENST00000418639ENST00000504887CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000511664ENST00000506722CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000511664ENST00000394537CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000511664ENST00000357077CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000511664ENST00000264366CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000511664ENST00000509550CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000511664ENST00000510275CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
5CDS-intronENST00000511664ENST00000504887CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000342666ENST00000506722CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000342666ENST00000394537CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000342666ENST00000357077CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000342666ENST00000264366CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000342666ENST00000509550CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000342666ENST00000510275CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
5CDS-intronENST00000342666ENST00000504887CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000515496ENST00000506722CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000515496ENST00000394537CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000515496ENST00000357077CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000515496ENST00000264366CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000515496ENST00000509550CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000515496ENST00000510275CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
5CDS-intronENST00000515496ENST00000504887CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000514328ENST00000506722CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000514328ENST00000394537CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000514328ENST00000357077CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000514328ENST00000264366CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000514328ENST00000509550CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000514328ENST00000510275CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
5CDS-intronENST00000514328ENST00000504887CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000394522ENST00000506722CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000394522ENST00000394537CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000394522ENST00000357077CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000394522ENST00000264366CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000394522ENST00000509550CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000394522ENST00000510275CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
5CDS-intronENST00000394522ENST00000504887CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000505990ENST00000506722CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000505990ENST00000394537CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000505990ENST00000357077CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000505990ENST00000264366CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000505990ENST00000509550CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000505990ENST00000510275CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
5CDS-intronENST00000505990ENST00000504887CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000379773ENST00000506722CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000379773ENST00000394537CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000379773ENST00000357077CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000379773ENST00000264366CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000379773ENST00000509550CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000379773ENST00000510275CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
5CDS-intronENST00000379773ENST00000504887CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000508738ENST00000506722CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000508738ENST00000394537CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000508738ENST00000357077CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000508738ENST00000264366CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
Frame-shiftENST00000508738ENST00000509550CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
In-frameENST00000508738ENST00000510275CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
5CDS-intronENST00000508738ENST00000504887CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
intron-3CDSENST00000509907ENST00000506722CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
intron-3CDSENST00000509907ENST00000394537CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
intron-3CDSENST00000509907ENST00000357077CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
intron-3CDSENST00000509907ENST00000264366CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
intron-3CDSENST00000509907ENST00000509550CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
intron-3CDSENST00000509907ENST00000510275CAMK2Dchr4

114430794

-ANK2chr4

114302613

+
intron-intronENST00000509907ENST00000504887CAMK2Dchr4

114430794

-ANK2chr4

114302613

+

Top

FusionProtFeatures for CAMK2D_ANK2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CAMK2D

Q13557

ANK2

Q01484

Calcium/calmodulin-dependent protein kinase involved inthe regulation of Ca(2+) homeostatis and excitation-contractioncoupling (ECC) in heart by targeting ion channels, transportersand accessory proteins involved in Ca(2+) influx into the myocyte,Ca(2+) release from the sarcoplasmic reticulum (SR), SR Ca(2+)uptake and Na(+) and K(+) channel transport. Targets alsotranscription factors and signaling molecules to regulate heartfunction. In its activated form, is involved in the pathogenesisof dilated cardiomyopathy and heart failure. Contributes tocardiac decompensation and heart failure by regulating SR Ca(2+)release via direct phosphorylation of RYR2 Ca(2+) channel on 'Ser-2808'. In the nucleus, phosphorylates the MEF2 repressor HDAC4,promoting its nuclear export and binding to 14-3-3 protein, andexpression of MEF2 and genes involved in the hypertrophic program.Is essential for left ventricular remodeling responses tomyocardial infarction. In pathological myocardial remodeling actsdownstream of the beta adrenergic receptor signaling cascade toregulate key proteins involved in ECC. Regulates Ca(2+) influx tomyocytes by binding and phosphorylating the L-type Ca(2+) channelsubunit beta-2 CACNB2. In addition to Ca(2+) channels, can targetand regulate the cardiac sarcolemmal Na(+) channel Nav1.5/SCN5Aand the K+ channel Kv4.3/KCND3, which contribute toarrhythmogenesis in heart failure. Phosphorylates phospholamban(PLN/PLB), an endogenous inhibitor of SERCA2A/ATP2A2, contributingto the enhancement of SR Ca(2+) uptake that may be important infrequency-dependent acceleration of relaxation (FDAR) andmaintenance of contractile function during acidosis. Mayparticipate in the modulation of skeletal muscle function inresponse to exercise, by regulating SR Ca(2+) transport throughphosphorylation of PLN/PLB and triadin, a ryanodine receptor-coupling factor. {ECO:0000269|PubMed:16690701,ECO:0000269|PubMed:17179159}. In skeletal muscle, required for proper localization ofDMD and DCTN4 and for the formation and/or stability of a specialsubset of microtubules associated with costameres andneuromuscular junctions. Attaches integral membrane proteins tocytoskeletal elements. Also binds to cytoskeletal proteins.Required for coordinate assembly of Na/Ca exchanger, Na/K ATPaseand InsP3 receptor at sarcoplasmic reticulum sites incardiomyocytes. Required for the coordinated expression of theNa/K ATPase, Na/Ca exchanger and beta-2-spectrin (SPTBN1) in theinner segment of rod photoreceptors (By similarity). Required forexpression and targeting of SPTBN1 in neonatal cardiomyocytes andfor the regulation of neonatal cardiomyocyte contraction rate(PubMed:12571597). Plays a role in endocytosis and intracellularprotein transport. Associates with phosphatidylinositol 3-phosphate (PI3P)-positive organelles and binds dynactin to promotelong-range motility of cells. Recruits RABGAP1L to (PI3P)-positiveearly endosomes, where RABGAP1L inactivates RAB22A, and promotespolarized trafficking to the leading edge of the migrating cells.Part of the ANK2/RABGAP1L complex which is required for thepolarized recycling of fibronectin receptor ITGA5 ITGB1 to theplasma membrane that enables continuous directional cell migration(By similarity). {ECO:0000250|UniProtKB:Q8C8R3,ECO:0000269|PubMed:12571597}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000296402-101814_2722731391DomainProtein kinase
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000342666-101914_272273615DomainProtein kinase
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000379773-101714_272273479DomainProtein kinase
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000394522-101814_272273493DomainProtein kinase
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000394524-101814_272273479DomainProtein kinase
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000394526-102014_2722731364DomainProtein kinase
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000418639-102014_2722731367DomainProtein kinase
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000429180-102014_2722731373DomainProtein kinase
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000454265-102114_2722731378DomainProtein kinase
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000508738-101814_272273490DomainProtein kinase
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000515496-101914_272273511DomainProtein kinase
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000296402-101820_282731391Nucleotide bindingATP
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000342666-101920_28273615Nucleotide bindingATP
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000379773-101720_28273479Nucleotide bindingATP
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000394522-101820_28273493Nucleotide bindingATP
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000394524-101820_28273479Nucleotide bindingATP
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000394526-102020_282731364Nucleotide bindingATP
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000418639-102020_282731367Nucleotide bindingATP
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000429180-102020_282731373Nucleotide bindingATP
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000454265-102120_282731378Nucleotide bindingATP
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000508738-101820_28273490Nucleotide bindingATP
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000515496-101920_28273511Nucleotide bindingATP
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461158_13043963958DomainZU5 2
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461450_15353963958DomainDeath 1
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10463569_36533963958DomainDeath 2
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046968_11563963958DomainZU5 1
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451158_13043961873DomainZU5 2
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451450_15353961873DomainDeath 1
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10453569_36533961873DomainDeath 2
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045968_11563961873DomainZU5 1
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471158_13043751864DomainZU5 2
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471450_15353751864DomainDeath 1
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11473569_36533751864DomainDeath 2
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147968_11563751864DomainZU5 1
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141158_1304-2556DomainZU5 2
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141450_1535-2556DomainDeath 1
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0143569_3653-2556DomainDeath 2
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014968_1156-2556DomainZU5 1
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461289_14233963958RegionNote=UPA domain
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461806_19833963958RegionNote=Repeat-rich region
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451289_14233961873RegionNote=UPA domain
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451806_19833961873RegionNote=Repeat-rich region
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471289_14233751864RegionNote=UPA domain
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471806_19833751864RegionNote=Repeat-rich region
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141289_1423-2556RegionNote=UPA domain
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141806_1983-2556RegionNote=Repeat-rich region
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461806_18173963958RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461818_18293963958RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461830_18413963958RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461842_18533963958RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461854_18653963958RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461866_18773963958RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461878_18893963958RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461890_19003963958RepeatNote=Repeat A%3B approximate
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461901_19123963958RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461913_19243963958RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461925_19353963958RepeatNote=Repeat A%3B approximate
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461936_19473963958RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461948_19593963958RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461960_19713963958RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+10461972_19833963958RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046397_4263963958RepeatNote=ANK 12
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046430_4593963958RepeatNote=ANK 13
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046463_4923963958RepeatNote=ANK 14
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046496_5253963958RepeatNote=ANK 15
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046529_5583963958RepeatNote=ANK 16
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046562_5913963958RepeatNote=ANK 17
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046595_6243963958RepeatNote=ANK 18
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046628_6573963958RepeatNote=ANK 19
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046661_6903963958RepeatNote=ANK 20
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046694_7233963958RepeatNote=ANK 21
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046727_7563963958RepeatNote=ANK 22
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046760_7893963958RepeatNote=ANK 23
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046793_8223963958RepeatNote=ANK 24
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451806_18173961873RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451818_18293961873RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451830_18413961873RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451842_18533961873RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451854_18653961873RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451866_18773961873RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451878_18893961873RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451890_19003961873RepeatNote=Repeat A%3B approximate
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451901_19123961873RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451913_19243961873RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451925_19353961873RepeatNote=Repeat A%3B approximate
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451936_19473961873RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451948_19593961873RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451960_19713961873RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+10451972_19833961873RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045397_4263961873RepeatNote=ANK 12
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045430_4593961873RepeatNote=ANK 13
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045463_4923961873RepeatNote=ANK 14
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045496_5253961873RepeatNote=ANK 15
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045529_5583961873RepeatNote=ANK 16
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045562_5913961873RepeatNote=ANK 17
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045595_6243961873RepeatNote=ANK 18
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045628_6573961873RepeatNote=ANK 19
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045661_6903961873RepeatNote=ANK 20
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045694_7233961873RepeatNote=ANK 21
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045727_7563961873RepeatNote=ANK 22
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045760_7893961873RepeatNote=ANK 23
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045793_8223961873RepeatNote=ANK 24
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471806_18173751864RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471818_18293751864RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471830_18413751864RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471842_18533751864RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471854_18653751864RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471866_18773751864RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471878_18893751864RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471890_19003751864RepeatNote=Repeat A%3B approximate
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471901_19123751864RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471913_19243751864RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471925_19353751864RepeatNote=Repeat A%3B approximate
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471936_19473751864RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471948_19593751864RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471960_19713751864RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+11471972_19833751864RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147397_4263751864RepeatNote=ANK 12
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147430_4593751864RepeatNote=ANK 13
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147463_4923751864RepeatNote=ANK 14
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147496_5253751864RepeatNote=ANK 15
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147529_5583751864RepeatNote=ANK 16
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147562_5913751864RepeatNote=ANK 17
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147595_6243751864RepeatNote=ANK 18
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147628_6573751864RepeatNote=ANK 19
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147661_6903751864RepeatNote=ANK 20
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147694_7233751864RepeatNote=ANK 21
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147727_7563751864RepeatNote=ANK 22
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147760_7893751864RepeatNote=ANK 23
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147793_8223751864RepeatNote=ANK 24
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014129_158-2556RepeatNote=ANK 4
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014162_191-2556RepeatNote=ANK 5
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141806_1817-2556RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141818_1829-2556RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141830_1841-2556RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141842_1853-2556RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141854_1865-2556RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141866_1877-2556RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141878_1889-2556RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141890_1900-2556RepeatNote=Repeat A%3B approximate
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141901_1912-2556RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141913_1924-2556RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141925_1935-2556RepeatNote=Repeat A%3B approximate
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141936_1947-2556RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014193_220-2556RepeatNote=ANK 6
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141948_1959-2556RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141960_1971-2556RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+0141972_1983-2556RepeatNote=Repeat A
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014232_261-2556RepeatNote=ANK 7
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014265_294-2556RepeatNote=ANK 8
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014298_327-2556RepeatNote=ANK 9
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+01430_62-2556RepeatNote=ANK 1
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014331_360-2556RepeatNote=ANK 10
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014364_393-2556RepeatNote=ANK 11
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014397_426-2556RepeatNote=ANK 12
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014430_459-2556RepeatNote=ANK 13
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014463_492-2556RepeatNote=ANK 14
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014496_525-2556RepeatNote=ANK 15
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014529_558-2556RepeatNote=ANK 16
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014562_591-2556RepeatNote=ANK 17
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014595_624-2556RepeatNote=ANK 18
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014628_657-2556RepeatNote=ANK 19
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+01463_92-2556RepeatNote=ANK 2
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014661_690-2556RepeatNote=ANK 20
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014694_723-2556RepeatNote=ANK 21
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014727_756-2556RepeatNote=ANK 22
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014760_789-2556RepeatNote=ANK 23
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+014793_822-2556RepeatNote=ANK 24
TgeneANK2chr4:114436225chr4:114179206ENST00000510275+01496_125-2556RepeatNote=ANK 3

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000296402-1018283_2922731391RegionAutoinhibitory domain
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000296402-1018291_3012731391RegionCalmodulin-binding
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000342666-1019283_292273615RegionAutoinhibitory domain
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000342666-1019291_301273615RegionCalmodulin-binding
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000379773-1017283_292273479RegionAutoinhibitory domain
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000379773-1017291_301273479RegionCalmodulin-binding
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000394522-1018283_292273493RegionAutoinhibitory domain
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000394522-1018291_301273493RegionCalmodulin-binding
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000394524-1018283_292273479RegionAutoinhibitory domain
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000394524-1018291_301273479RegionCalmodulin-binding
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000394526-1020283_2922731364RegionAutoinhibitory domain
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000394526-1020291_3012731364RegionCalmodulin-binding
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000418639-1020283_2922731367RegionAutoinhibitory domain
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000418639-1020291_3012731367RegionCalmodulin-binding
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000429180-1020283_2922731373RegionAutoinhibitory domain
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000429180-1020291_3012731373RegionCalmodulin-binding
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000454265-1021283_2922731378RegionAutoinhibitory domain
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000454265-1021291_3012731378RegionCalmodulin-binding
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000508738-1018283_292273490RegionAutoinhibitory domain
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000508738-1018291_301273490RegionCalmodulin-binding
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000515496-1019283_292273511RegionAutoinhibitory domain
HgeneCAMK2Dchr4:114436225chr4:114179206ENST00000515496-1019291_301273511RegionCalmodulin-binding
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046129_1583963958RepeatNote=ANK 4
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046162_1913963958RepeatNote=ANK 5
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046193_2203963958RepeatNote=ANK 6
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046232_2613963958RepeatNote=ANK 7
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046265_2943963958RepeatNote=ANK 8
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046298_3273963958RepeatNote=ANK 9
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+104630_623963958RepeatNote=ANK 1
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046331_3603963958RepeatNote=ANK 10
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+1046364_3933963958RepeatNote=ANK 11
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+104663_923963958RepeatNote=ANK 2
TgeneANK2chr4:114436225chr4:114179206ENST00000357077+104696_1253963958RepeatNote=ANK 3
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045129_1583961873RepeatNote=ANK 4
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045162_1913961873RepeatNote=ANK 5
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045193_2203961873RepeatNote=ANK 6
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045232_2613961873RepeatNote=ANK 7
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045265_2943961873RepeatNote=ANK 8
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045298_3273961873RepeatNote=ANK 9
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+104530_623961873RepeatNote=ANK 1
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045331_3603961873RepeatNote=ANK 10
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+1045364_3933961873RepeatNote=ANK 11
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+104563_923961873RepeatNote=ANK 2
TgeneANK2chr4:114436225chr4:114179206ENST00000394537+104596_1253961873RepeatNote=ANK 3
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147129_1583751864RepeatNote=ANK 4
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147162_1913751864RepeatNote=ANK 5
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147193_2203751864RepeatNote=ANK 6
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147232_2613751864RepeatNote=ANK 7
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147265_2943751864RepeatNote=ANK 8
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147298_3273751864RepeatNote=ANK 9
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+114730_623751864RepeatNote=ANK 1
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147331_3603751864RepeatNote=ANK 10
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+1147364_3933751864RepeatNote=ANK 11
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+114763_923751864RepeatNote=ANK 2
TgeneANK2chr4:114436225chr4:114179206ENST00000506722+114796_1253751864RepeatNote=ANK 3


Top

FusionGeneSequence for CAMK2D_ANK2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CAMK2D_ENST00000394524_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_1762aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGRASPCLERDNSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKR
HRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSEN
GDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKR
IRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTP
LTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSR
DVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESES
DQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVEC
LTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQD
GVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPT
SSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRR

>In-frame_CAMK2D_ENST00000394524_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_1750aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHL
METNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSAT
ALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQE
PEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEI

>In-frame_CAMK2D_ENST00000394524_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_3835aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVN
EILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKE
QLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGL
APEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTL
SSSAKTERHPPVSPSSKTEKHSPVSPSAKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTE
KHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEH
KSAKQKQPQEKGKVRVEKEKGPILTQREAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEE
SHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSL
QSGALDGSSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTK
DITGGSEERGATVTEDSETSTESFQKEATLGSPKDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQEST
ATSDETKALPLPEASVKTDTGTESKPQGVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKES
PCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPK
TTDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSG
EDESGVPVLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKS
EEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTE
GEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDL
AENDEIYDPQITSPYENVPSQSFFSSEESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTL
WEMQSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGT
PTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLP
DDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDS
PDSSPEEQKSVIEIPTAPMENVPFTESKSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSD
LDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSC
RGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESI
ETLIERIPDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNL
VECLTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYST
FQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQ
TPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKI

>In-frame_CAMK2D_ENST00000394524_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_3802aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRD
FPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMT
IPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPY
MAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVK
VRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSE
VSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVS
DEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDE
TQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKR
VEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPSAKTERH
SPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGK
TEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQREAQKTE
NQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDF
SEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLMEGTPQIS
SEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTKDITGGSEERGATVTEDSETSTESFQKEATLGSP
KDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETKALPLPEASVKTDTGTESKPQGVIRSP
QGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKT
ELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKKRFTPEE
EMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSGEDESGVPVLVTSESRKVSSSSESEPELAQLKKG
ADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDT
DQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVS
EGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSEESKTQT
DANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTLWEMQSDSVSSSFEPTMSATTTVVGEQISKVIIT
KTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYAD
ESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKE
AVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPFTESKSKIPV
RTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASS
LDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEAS
KLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDPQDEQERIEERLAYI
ADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERISHSYAE
IEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGK
MQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSL
VIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGY

>In-frame_CAMK2D_ENST00000454265_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_1762aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGRASPCLERDNSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKR
HRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSEN
GDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKR
IRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTP
LTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSR
DVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESES
DQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVEC
LTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQD
GVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPT
SSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRR

>In-frame_CAMK2D_ENST00000454265_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_1750aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHL
METNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSAT
ALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQE
PEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEI

>In-frame_CAMK2D_ENST00000454265_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_3835aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVN
EILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKE
QLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGL
APEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTL
SSSAKTERHPPVSPSSKTEKHSPVSPSAKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTE
KHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEH
KSAKQKQPQEKGKVRVEKEKGPILTQREAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEE
SHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSL
QSGALDGSSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTK
DITGGSEERGATVTEDSETSTESFQKEATLGSPKDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQEST
ATSDETKALPLPEASVKTDTGTESKPQGVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKES
PCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPK
TTDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSG
EDESGVPVLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKS
EEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTE
GEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDL
AENDEIYDPQITSPYENVPSQSFFSSEESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTL
WEMQSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGT
PTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLP
DDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDS
PDSSPEEQKSVIEIPTAPMENVPFTESKSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSD
LDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSC
RGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESI
ETLIERIPDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNL
VECLTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYST
FQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQ
TPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKI

>In-frame_CAMK2D_ENST00000454265_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_3802aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRD
FPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMT
IPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPY
MAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVK
VRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSE
VSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVS
DEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDE
TQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKR
VEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPSAKTERH
SPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGK
TEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQREAQKTE
NQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDF
SEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLMEGTPQIS
SEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTKDITGGSEERGATVTEDSETSTESFQKEATLGSP
KDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETKALPLPEASVKTDTGTESKPQGVIRSP
QGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKT
ELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKKRFTPEE
EMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSGEDESGVPVLVTSESRKVSSSSESEPELAQLKKG
ADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDT
DQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVS
EGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSEESKTQT
DANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTLWEMQSDSVSSSFEPTMSATTTVVGEQISKVIIT
KTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYAD
ESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKE
AVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPFTESKSKIPV
RTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASS
LDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEAS
KLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDPQDEQERIEERLAYI
ADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERISHSYAE
IEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGK
MQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSL
VIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGY

>In-frame_CAMK2D_ENST00000394526_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_1762aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGRASPCLERDNSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKR
HRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSEN
GDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKR
IRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTP
LTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSR
DVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESES
DQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVEC
LTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQD
GVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPT
SSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRR

>In-frame_CAMK2D_ENST00000394526_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_1750aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHL
METNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSAT
ALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQE
PEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEI

>In-frame_CAMK2D_ENST00000394526_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_3835aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVN
EILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKE
QLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGL
APEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTL
SSSAKTERHPPVSPSSKTEKHSPVSPSAKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTE
KHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEH
KSAKQKQPQEKGKVRVEKEKGPILTQREAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEE
SHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSL
QSGALDGSSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTK
DITGGSEERGATVTEDSETSTESFQKEATLGSPKDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQEST
ATSDETKALPLPEASVKTDTGTESKPQGVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKES
PCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPK
TTDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSG
EDESGVPVLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKS
EEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTE
GEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDL
AENDEIYDPQITSPYENVPSQSFFSSEESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTL
WEMQSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGT
PTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLP
DDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDS
PDSSPEEQKSVIEIPTAPMENVPFTESKSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSD
LDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSC
RGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESI
ETLIERIPDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNL
VECLTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYST
FQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQ
TPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKI

>In-frame_CAMK2D_ENST00000394526_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_3802aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRD
FPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMT
IPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPY
MAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVK
VRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSE
VSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVS
DEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDE
TQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKR
VEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPSAKTERH
SPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGK
TEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQREAQKTE
NQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDF
SEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLMEGTPQIS
SEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTKDITGGSEERGATVTEDSETSTESFQKEATLGSP
KDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETKALPLPEASVKTDTGTESKPQGVIRSP
QGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKT
ELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKKRFTPEE
EMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSGEDESGVPVLVTSESRKVSSSSESEPELAQLKKG
ADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDT
DQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVS
EGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSEESKTQT
DANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTLWEMQSDSVSSSFEPTMSATTTVVGEQISKVIIT
KTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYAD
ESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKE
AVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPFTESKSKIPV
RTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASS
LDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEAS
KLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDPQDEQERIEERLAYI
ADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERISHSYAE
IEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGK
MQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSL
VIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGY

>In-frame_CAMK2D_ENST00000429180_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_1762aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGRASPCLERDNSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKR
HRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSEN
GDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKR
IRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTP
LTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSR
DVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESES
DQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVEC
LTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQD
GVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPT
SSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRR

>In-frame_CAMK2D_ENST00000429180_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_1750aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHL
METNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSAT
ALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQE
PEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEI

>In-frame_CAMK2D_ENST00000429180_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_3835aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVN
EILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKE
QLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGL
APEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTL
SSSAKTERHPPVSPSSKTEKHSPVSPSAKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTE
KHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEH
KSAKQKQPQEKGKVRVEKEKGPILTQREAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEE
SHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSL
QSGALDGSSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTK
DITGGSEERGATVTEDSETSTESFQKEATLGSPKDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQEST
ATSDETKALPLPEASVKTDTGTESKPQGVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKES
PCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPK
TTDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSG
EDESGVPVLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKS
EEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTE
GEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDL
AENDEIYDPQITSPYENVPSQSFFSSEESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTL
WEMQSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGT
PTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLP
DDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDS
PDSSPEEQKSVIEIPTAPMENVPFTESKSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSD
LDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSC
RGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESI
ETLIERIPDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNL
VECLTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYST
FQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQ
TPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKI

>In-frame_CAMK2D_ENST00000429180_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_3802aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRD
FPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMT
IPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPY
MAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVK
VRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSE
VSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVS
DEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDE
TQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKR
VEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPSAKTERH
SPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGK
TEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQREAQKTE
NQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDF
SEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLMEGTPQIS
SEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTKDITGGSEERGATVTEDSETSTESFQKEATLGSP
KDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETKALPLPEASVKTDTGTESKPQGVIRSP
QGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKT
ELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKKRFTPEE
EMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSGEDESGVPVLVTSESRKVSSSSESEPELAQLKKG
ADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDT
DQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVS
EGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSEESKTQT
DANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTLWEMQSDSVSSSFEPTMSATTTVVGEQISKVIIT
KTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYAD
ESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKE
AVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPFTESKSKIPV
RTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASS
LDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEAS
KLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDPQDEQERIEERLAYI
ADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERISHSYAE
IEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGK
MQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSL
VIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGY

>In-frame_CAMK2D_ENST00000296402_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_1762aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGRASPCLERDNSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKR
HRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSEN
GDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKR
IRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTP
LTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSR
DVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESES
DQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVEC
LTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQD
GVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPT
SSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRR

>In-frame_CAMK2D_ENST00000296402_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_1750aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHL
METNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSAT
ALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQE
PEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEI

>In-frame_CAMK2D_ENST00000296402_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_3835aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVN
EILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKE
QLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGL
APEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTL
SSSAKTERHPPVSPSSKTEKHSPVSPSAKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTE
KHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEH
KSAKQKQPQEKGKVRVEKEKGPILTQREAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEE
SHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSL
QSGALDGSSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTK
DITGGSEERGATVTEDSETSTESFQKEATLGSPKDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQEST
ATSDETKALPLPEASVKTDTGTESKPQGVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKES
PCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPK
TTDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSG
EDESGVPVLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKS
EEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTE
GEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDL
AENDEIYDPQITSPYENVPSQSFFSSEESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTL
WEMQSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGT
PTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLP
DDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDS
PDSSPEEQKSVIEIPTAPMENVPFTESKSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSD
LDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSC
RGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESI
ETLIERIPDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNL
VECLTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYST
FQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQ
TPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKI

>In-frame_CAMK2D_ENST00000296402_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_3802aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRD
FPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMT
IPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPY
MAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVK
VRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSE
VSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVS
DEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDE
TQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKR
VEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPSAKTERH
SPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGK
TEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQREAQKTE
NQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDF
SEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLMEGTPQIS
SEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTKDITGGSEERGATVTEDSETSTESFQKEATLGSP
KDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETKALPLPEASVKTDTGTESKPQGVIRSP
QGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKT
ELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKKRFTPEE
EMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSGEDESGVPVLVTSESRKVSSSSESEPELAQLKKG
ADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDT
DQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVS
EGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSEESKTQT
DANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTLWEMQSDSVSSSFEPTMSATTTVVGEQISKVIIT
KTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYAD
ESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKE
AVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPFTESKSKIPV
RTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASS
LDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEAS
KLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDPQDEQERIEERLAYI
ADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERISHSYAE
IEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGK
MQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSL
VIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGY

>In-frame_CAMK2D_ENST00000418639_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_1762aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGRASPCLERDNSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKR
HRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSEN
GDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKR
IRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTP
LTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSR
DVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESES
DQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVEC
LTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQD
GVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPT
SSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRR

>In-frame_CAMK2D_ENST00000418639_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_1750aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHL
METNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSAT
ALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQE
PEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEI

>In-frame_CAMK2D_ENST00000418639_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_3835aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVN
EILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKE
QLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGL
APEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTL
SSSAKTERHPPVSPSSKTEKHSPVSPSAKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTE
KHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEH
KSAKQKQPQEKGKVRVEKEKGPILTQREAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEE
SHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSL
QSGALDGSSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTK
DITGGSEERGATVTEDSETSTESFQKEATLGSPKDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQEST
ATSDETKALPLPEASVKTDTGTESKPQGVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKES
PCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPK
TTDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSG
EDESGVPVLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKS
EEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTE
GEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDL
AENDEIYDPQITSPYENVPSQSFFSSEESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTL
WEMQSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGT
PTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLP
DDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDS
PDSSPEEQKSVIEIPTAPMENVPFTESKSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSD
LDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSC
RGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESI
ETLIERIPDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNL
VECLTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYST
FQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQ
TPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKI

>In-frame_CAMK2D_ENST00000418639_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_3802aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRD
FPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMT
IPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPY
MAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVK
VRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSE
VSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVS
DEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDE
TQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKR
VEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPSAKTERH
SPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGK
TEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQREAQKTE
NQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDF
SEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLMEGTPQIS
SEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTKDITGGSEERGATVTEDSETSTESFQKEATLGSP
KDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETKALPLPEASVKTDTGTESKPQGVIRSP
QGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKT
ELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKKRFTPEE
EMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSGEDESGVPVLVTSESRKVSSSSESEPELAQLKKG
ADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDT
DQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVS
EGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSEESKTQT
DANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTLWEMQSDSVSSSFEPTMSATTTVVGEQISKVIIT
KTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYAD
ESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKE
AVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPFTESKSKIPV
RTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASS
LDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEAS
KLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDPQDEQERIEERLAYI
ADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERISHSYAE
IEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGK
MQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSL
VIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGY

>In-frame_CAMK2D_ENST00000511664_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_1762aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGRASPCLERDNSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKR
HRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSEN
GDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKR
IRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTP
LTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSR
DVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESES
DQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVEC
LTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQD
GVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPT
SSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRR

>In-frame_CAMK2D_ENST00000511664_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_1750aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHL
METNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSAT
ALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQE
PEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEI

>In-frame_CAMK2D_ENST00000511664_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_3835aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVN
EILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKE
QLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGL
APEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTL
SSSAKTERHPPVSPSSKTEKHSPVSPSAKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTE
KHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEH
KSAKQKQPQEKGKVRVEKEKGPILTQREAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEE
SHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSL
QSGALDGSSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTK
DITGGSEERGATVTEDSETSTESFQKEATLGSPKDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQEST
ATSDETKALPLPEASVKTDTGTESKPQGVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKES
PCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPK
TTDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSG
EDESGVPVLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKS
EEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTE
GEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDL
AENDEIYDPQITSPYENVPSQSFFSSEESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTL
WEMQSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGT
PTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLP
DDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDS
PDSSPEEQKSVIEIPTAPMENVPFTESKSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSD
LDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSC
RGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESI
ETLIERIPDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNL
VECLTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYST
FQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQ
TPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKI

>In-frame_CAMK2D_ENST00000511664_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_3802aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRD
FPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMT
IPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPY
MAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVK
VRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSE
VSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVS
DEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDE
TQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKR
VEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPSAKTERH
SPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGK
TEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQREAQKTE
NQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDF
SEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLMEGTPQIS
SEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTKDITGGSEERGATVTEDSETSTESFQKEATLGSP
KDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETKALPLPEASVKTDTGTESKPQGVIRSP
QGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKT
ELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKKRFTPEE
EMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSGEDESGVPVLVTSESRKVSSSSESEPELAQLKKG
ADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDT
DQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVS
EGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSEESKTQT
DANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTLWEMQSDSVSSSFEPTMSATTTVVGEQISKVIIT
KTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYAD
ESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKE
AVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPFTESKSKIPV
RTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASS
LDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEAS
KLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDPQDEQERIEERLAYI
ADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERISHSYAE
IEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGK
MQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSL
VIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGY

>In-frame_CAMK2D_ENST00000342666_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_1762aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGRASPCLERDNSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKR
HRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSEN
GDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKR
IRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTP
LTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSR
DVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESES
DQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVEC
LTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQD
GVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPT
SSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRR

>In-frame_CAMK2D_ENST00000342666_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_1750aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHL
METNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSAT
ALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQE
PEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEI

>In-frame_CAMK2D_ENST00000342666_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_3835aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVN
EILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKE
QLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGL
APEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTL
SSSAKTERHPPVSPSSKTEKHSPVSPSAKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTE
KHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEH
KSAKQKQPQEKGKVRVEKEKGPILTQREAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEE
SHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSL
QSGALDGSSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTK
DITGGSEERGATVTEDSETSTESFQKEATLGSPKDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQEST
ATSDETKALPLPEASVKTDTGTESKPQGVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKES
PCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPK
TTDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSG
EDESGVPVLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKS
EEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTE
GEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDL
AENDEIYDPQITSPYENVPSQSFFSSEESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTL
WEMQSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGT
PTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLP
DDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDS
PDSSPEEQKSVIEIPTAPMENVPFTESKSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSD
LDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSC
RGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESI
ETLIERIPDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNL
VECLTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYST
FQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQ
TPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKI

>In-frame_CAMK2D_ENST00000342666_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_3802aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRD
FPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMT
IPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPY
MAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVK
VRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSE
VSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVS
DEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDE
TQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKR
VEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPSAKTERH
SPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGK
TEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQREAQKTE
NQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDF
SEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLMEGTPQIS
SEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTKDITGGSEERGATVTEDSETSTESFQKEATLGSP
KDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETKALPLPEASVKTDTGTESKPQGVIRSP
QGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKT
ELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKKRFTPEE
EMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSGEDESGVPVLVTSESRKVSSSSESEPELAQLKKG
ADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDT
DQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVS
EGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSEESKTQT
DANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTLWEMQSDSVSSSFEPTMSATTTVVGEQISKVIIT
KTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYAD
ESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKE
AVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPFTESKSKIPV
RTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASS
LDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEAS
KLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDPQDEQERIEERLAYI
ADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERISHSYAE
IEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGK
MQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSL
VIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGY

>In-frame_CAMK2D_ENST00000515496_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_1762aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGRASPCLERDNSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKR
HRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSEN
GDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKR
IRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTP
LTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSR
DVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESES
DQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVEC
LTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQD
GVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPT
SSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRR

>In-frame_CAMK2D_ENST00000515496_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_1750aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHL
METNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSAT
ALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQE
PEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEI

>In-frame_CAMK2D_ENST00000515496_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_3835aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVN
EILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKE
QLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGL
APEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTL
SSSAKTERHPPVSPSSKTEKHSPVSPSAKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTE
KHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEH
KSAKQKQPQEKGKVRVEKEKGPILTQREAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEE
SHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSL
QSGALDGSSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTK
DITGGSEERGATVTEDSETSTESFQKEATLGSPKDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQEST
ATSDETKALPLPEASVKTDTGTESKPQGVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKES
PCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPK
TTDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSG
EDESGVPVLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKS
EEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTE
GEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDL
AENDEIYDPQITSPYENVPSQSFFSSEESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTL
WEMQSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGT
PTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLP
DDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDS
PDSSPEEQKSVIEIPTAPMENVPFTESKSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSD
LDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSC
RGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESI
ETLIERIPDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNL
VECLTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYST
FQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQ
TPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKI

>In-frame_CAMK2D_ENST00000515496_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_3802aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRD
FPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMT
IPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPY
MAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVK
VRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSE
VSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVS
DEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDE
TQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKR
VEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPSAKTERH
SPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGK
TEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQREAQKTE
NQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDF
SEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLMEGTPQIS
SEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTKDITGGSEERGATVTEDSETSTESFQKEATLGSP
KDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETKALPLPEASVKTDTGTESKPQGVIRSP
QGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKT
ELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKKRFTPEE
EMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSGEDESGVPVLVTSESRKVSSSSESEPELAQLKKG
ADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDT
DQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVS
EGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSEESKTQT
DANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTLWEMQSDSVSSSFEPTMSATTTVVGEQISKVIIT
KTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYAD
ESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKE
AVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPFTESKSKIPV
RTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASS
LDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEAS
KLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDPQDEQERIEERLAYI
ADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERISHSYAE
IEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGK
MQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSL
VIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGY

>In-frame_CAMK2D_ENST00000514328_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_1762aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGRASPCLERDNSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKR
HRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSEN
GDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKR
IRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTP
LTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSR
DVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESES
DQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVEC
LTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQD
GVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPT
SSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRR

>In-frame_CAMK2D_ENST00000514328_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_1750aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHL
METNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSAT
ALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQE
PEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEI

>In-frame_CAMK2D_ENST00000514328_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_3835aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVN
EILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKE
QLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGL
APEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTL
SSSAKTERHPPVSPSSKTEKHSPVSPSAKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTE
KHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEH
KSAKQKQPQEKGKVRVEKEKGPILTQREAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEE
SHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSL
QSGALDGSSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTK
DITGGSEERGATVTEDSETSTESFQKEATLGSPKDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQEST
ATSDETKALPLPEASVKTDTGTESKPQGVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKES
PCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPK
TTDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSG
EDESGVPVLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKS
EEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTE
GEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDL
AENDEIYDPQITSPYENVPSQSFFSSEESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTL
WEMQSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGT
PTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLP
DDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDS
PDSSPEEQKSVIEIPTAPMENVPFTESKSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSD
LDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSC
RGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESI
ETLIERIPDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNL
VECLTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYST
FQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQ
TPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKI

>In-frame_CAMK2D_ENST00000514328_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_3802aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRD
FPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMT
IPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPY
MAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVK
VRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSE
VSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVS
DEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDE
TQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKR
VEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPSAKTERH
SPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGK
TEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQREAQKTE
NQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDF
SEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLMEGTPQIS
SEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTKDITGGSEERGATVTEDSETSTESFQKEATLGSP
KDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETKALPLPEASVKTDTGTESKPQGVIRSP
QGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKT
ELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKKRFTPEE
EMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSGEDESGVPVLVTSESRKVSSSSESEPELAQLKKG
ADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDT
DQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVS
EGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSEESKTQT
DANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTLWEMQSDSVSSSFEPTMSATTTVVGEQISKVIIT
KTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYAD
ESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKE
AVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPFTESKSKIPV
RTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASS
LDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEAS
KLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDPQDEQERIEERLAYI
ADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERISHSYAE
IEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGK
MQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSL
VIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGY

>In-frame_CAMK2D_ENST00000394522_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_1762aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGRASPCLERDNSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKR
HRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSEN
GDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKR
IRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTP
LTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSR
DVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESES
DQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVEC
LTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQD
GVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPT
SSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRR

>In-frame_CAMK2D_ENST00000394522_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_1750aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHL
METNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSAT
ALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQE
PEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEI

>In-frame_CAMK2D_ENST00000394522_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_3835aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVN
EILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKE
QLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGL
APEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTL
SSSAKTERHPPVSPSSKTEKHSPVSPSAKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTE
KHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEH
KSAKQKQPQEKGKVRVEKEKGPILTQREAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEE
SHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSL
QSGALDGSSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTK
DITGGSEERGATVTEDSETSTESFQKEATLGSPKDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQEST
ATSDETKALPLPEASVKTDTGTESKPQGVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKES
PCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPK
TTDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSG
EDESGVPVLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKS
EEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTE
GEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDL
AENDEIYDPQITSPYENVPSQSFFSSEESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTL
WEMQSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGT
PTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLP
DDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDS
PDSSPEEQKSVIEIPTAPMENVPFTESKSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSD
LDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSC
RGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESI
ETLIERIPDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNL
VECLTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYST
FQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQ
TPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKI

>In-frame_CAMK2D_ENST00000394522_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_3802aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRD
FPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMT
IPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPY
MAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVK
VRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSE
VSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVS
DEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDE
TQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKR
VEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPSAKTERH
SPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGK
TEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQREAQKTE
NQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDF
SEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLMEGTPQIS
SEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTKDITGGSEERGATVTEDSETSTESFQKEATLGSP
KDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETKALPLPEASVKTDTGTESKPQGVIRSP
QGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKT
ELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKKRFTPEE
EMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSGEDESGVPVLVTSESRKVSSSSESEPELAQLKKG
ADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDT
DQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVS
EGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSEESKTQT
DANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTLWEMQSDSVSSSFEPTMSATTTVVGEQISKVIIT
KTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYAD
ESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKE
AVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPFTESKSKIPV
RTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASS
LDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEAS
KLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDPQDEQERIEERLAYI
ADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERISHSYAE
IEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGK
MQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSL
VIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGY

>In-frame_CAMK2D_ENST00000505990_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_1762aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGRASPCLERDNSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKR
HRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSEN
GDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKR
IRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTP
LTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSR
DVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESES
DQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVEC
LTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQD
GVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPT
SSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRR

>In-frame_CAMK2D_ENST00000505990_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_1750aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHL
METNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSAT
ALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQE
PEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEI

>In-frame_CAMK2D_ENST00000505990_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_3835aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVN
EILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKE
QLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGL
APEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTL
SSSAKTERHPPVSPSSKTEKHSPVSPSAKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTE
KHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEH
KSAKQKQPQEKGKVRVEKEKGPILTQREAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEE
SHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSL
QSGALDGSSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTK
DITGGSEERGATVTEDSETSTESFQKEATLGSPKDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQEST
ATSDETKALPLPEASVKTDTGTESKPQGVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKES
PCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPK
TTDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSG
EDESGVPVLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKS
EEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTE
GEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDL
AENDEIYDPQITSPYENVPSQSFFSSEESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTL
WEMQSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGT
PTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLP
DDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDS
PDSSPEEQKSVIEIPTAPMENVPFTESKSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSD
LDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSC
RGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESI
ETLIERIPDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNL
VECLTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYST
FQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQ
TPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKI

>In-frame_CAMK2D_ENST00000505990_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_3802aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRD
FPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMT
IPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPY
MAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVK
VRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSE
VSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVS
DEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDE
TQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKR
VEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPSAKTERH
SPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGK
TEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQREAQKTE
NQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDF
SEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLMEGTPQIS
SEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTKDITGGSEERGATVTEDSETSTESFQKEATLGSP
KDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETKALPLPEASVKTDTGTESKPQGVIRSP
QGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKT
ELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKKRFTPEE
EMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSGEDESGVPVLVTSESRKVSSSSESEPELAQLKKG
ADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDT
DQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVS
EGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSEESKTQT
DANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTLWEMQSDSVSSSFEPTMSATTTVVGEQISKVIIT
KTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYAD
ESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKE
AVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPFTESKSKIPV
RTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASS
LDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEAS
KLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDPQDEQERIEERLAYI
ADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERISHSYAE
IEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGK
MQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSL
VIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGY

>In-frame_CAMK2D_ENST00000379773_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_1762aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGRASPCLERDNSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKR
HRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSEN
GDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKR
IRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTP
LTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSR
DVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESES
DQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVEC
LTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQD
GVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPT
SSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRR

>In-frame_CAMK2D_ENST00000379773_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_1750aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHL
METNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSAT
ALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQE
PEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEI

>In-frame_CAMK2D_ENST00000379773_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_3835aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVN
EILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKE
QLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGL
APEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTL
SSSAKTERHPPVSPSSKTEKHSPVSPSAKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTE
KHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEH
KSAKQKQPQEKGKVRVEKEKGPILTQREAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEE
SHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSL
QSGALDGSSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTK
DITGGSEERGATVTEDSETSTESFQKEATLGSPKDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQEST
ATSDETKALPLPEASVKTDTGTESKPQGVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKES
PCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPK
TTDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSG
EDESGVPVLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKS
EEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTE
GEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDL
AENDEIYDPQITSPYENVPSQSFFSSEESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTL
WEMQSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGT
PTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLP
DDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDS
PDSSPEEQKSVIEIPTAPMENVPFTESKSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSD
LDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSC
RGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESI
ETLIERIPDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNL
VECLTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYST
FQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQ
TPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKI

>In-frame_CAMK2D_ENST00000379773_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_3802aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRD
FPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMT
IPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPY
MAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVK
VRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSE
VSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVS
DEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDE
TQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKR
VEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPSAKTERH
SPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGK
TEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQREAQKTE
NQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDF
SEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLMEGTPQIS
SEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTKDITGGSEERGATVTEDSETSTESFQKEATLGSP
KDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETKALPLPEASVKTDTGTESKPQGVIRSP
QGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKT
ELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKKRFTPEE
EMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSGEDESGVPVLVTSESRKVSSSSESEPELAQLKKG
ADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDT
DQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVS
EGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSEESKTQT
DANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTLWEMQSDSVSSSFEPTMSATTTVVGEQISKVIIT
KTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYAD
ESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKE
AVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPFTESKSKIPV
RTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASS
LDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEAS
KLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDPQDEQERIEERLAYI
ADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERISHSYAE
IEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGK
MQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSL
VIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGY

>In-frame_CAMK2D_ENST00000508738_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_1762aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGRASPCLERDNSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKR
HRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSEN
GDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKR
IRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTP
LTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSR
DVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESES
DQEQEEEIDMTSEKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVEC
LTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQD
GVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPT
SSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRR

>In-frame_CAMK2D_ENST00000508738_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_1750aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHL
METNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSAT
ALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQE
PEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEI

>In-frame_CAMK2D_ENST00000508738_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_3835aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYT
EDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHS
ELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTT
NVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYV
DCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTS
EKNDETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVN
EILRSGTCTRDESSVQSSRSERGLVEEEWVIVSDEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKE
QLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDETQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGL
APEPLPTVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTL
SSSAKTERHPPVSPSSKTEKHSPVSPSAKTERHSPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTE
KHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEH
KSAKQKQPQEKGKVRVEKEKGPILTQREAQKTENQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEE
SHRESEVPKEKMADEQGDMDLQISPDRKTSTDFSEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSL
QSGALDGSSESLKNEGVAGSPCGSLMEGTPQISSEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTK
DITGGSEERGATVTEDSETSTESFQKEATLGSPKDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQEST
ATSDETKALPLPEASVKTDTGTESKPQGVIRSPQGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKES
PCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKTELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPK
TTDVSTPKPAVIHECAEEDDSENGEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSG
EDESGVPVLVTSESRKVSSSSESEPELAQLKKGADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKS
EEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDTDQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTE
GEELDVSRAESPQADCPSESFSSSSSLPHCLVSEGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDL
AENDEIYDPQITSPYENVPSQSFFSSEESKTQTDANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTL
WEMQSDSVSSSFEPTMSATTTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGT
PTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYADESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLP
DDVSEEVEEIPASDAQLNSQMGISASTETPTKEAVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDS
PDSSPEEQKSVIEIPTAPMENVPFTESKSKIPVRTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSD
LDTSVQKTVAPQGQDMASIAPDNRSKSESDASSLDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSC
RGGTSPTKESKEHFFDLYRNSIEFFEEISDEASKLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESI
ETLIERIPDENGHDHAEDPQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNL
VECLTKINRMDIVHLMETNTEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYST
FQDGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQ
TPTSSERGGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKI

>In-frame_CAMK2D_ENST00000508738_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_3802aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP
WICNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKY
GSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGV
TPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGAN
VNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQV
STLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRD
FPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMT
IPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPY
MAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVK
VRDTTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEVPVLASPDLLSE
VSEMKQDLIKMTAILTTDVSDKAGSIKVKELVKAAEEEPGEPFEIVERVKEDLEKVNEILRSGTCTRDESSVQSSRSERGLVEEEWVIVS
DEEIEEARQKAPLEITEYPCVEVRIDKEIKGKVEKDSTGLVNYLTDDLNTCVPLPKEQLQTVQDKAGKKCEALAVGRSSEKEGKDIPPDE
TQSTQKQHKPSLGIKKPVRRKLKEKQKQKEEGLQASAEKAELKKGSSEESLGEDPGLAPEPLPTVKATSPLIEETPIGSIKDKVKALQKR
VEDEQKGRSKLPIRVKGKEDVPKKTTHRPHPAASPSLKSERHAPGSPSPKTERHSTLSSSAKTERHPPVSPSSKTEKHSPVSPSAKTERH
SPASSSSKTEKHSPVSPSTKTERHSPVSSTKTERHPPVSPSGKTDKRPPVSPSGRTEKHPPVSPGRTEKRLPVSPSGRTDKHQPVSTAGK
TEKHLPVSPSGKTEKQPPVSPTSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRVEKEKGPILTQREAQKTE
NQTIKRGQRLPVTGTAESKRGVRVSSIGVKKEDAAGGKEKVLSHKIPEPVQSVPEEESHRESEVPKEKMADEQGDMDLQISPDRKTSTDF
SEVIKQELEDNDKYQQFRLSEETEKAQLHLDQVLTSPFNTTFPLDYMKDEFLPALSLQSGALDGSSESLKNEGVAGSPCGSLMEGTPQIS
SEESYKHEGLAETPETSPESLSFSPKKSEEQTGETKESTKTETTTEIRSEKEHPTTKDITGGSEERGATVTEDSETSTESFQKEATLGSP
KDTSPKRQDDCTGSCSVALAKETPTGLTEEAACDEGQRTFGSSAHKTQTDSEVQESTATSDETKALPLPEASVKTDTGTESKPQGVIRSP
QGLELALPSRDSEVLSAVADDSLAVSHKDSLEASPVLEDNSSHKTPDSLEPSPLKESPCRDSLESSPVEPKMKAGIFPSHFPLPAAVAKT
ELLTEVASVRSRLLRDPDGSAEDDSLEQTSLMESSGKSPLSPDTPSSEEVSYEVTPKTTDVSTPKPAVIHECAEEDDSENGEKKRFTPEE
EMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEESSSSSDPDADCSVDVDEPKHTGSGEDESGVPVLVTSESRKVSSSSESEPELAQLKKG
ADSGLLPEPVIRVQPPSPLPSSMDSNSSPEEVQFQPVVSKQYTFKMNEDTQEEPGKSEEEKDSESHLAEDRHAVSTEAEDRSYDKLNRDT
DQPKICDGHGCEAMSPSSSAAPVSSGLQSPTGDDVDEQPVIYKESLALQGTHEKDTEGEELDVSRAESPQADCPSESFSSSSSLPHCLVS
EGKELDEDISATSSIQKTEVTKTDETFENLPKDCPSQDSSITTQTDRFSMDVPVSDLAENDEIYDPQITSPYENVPSQSFFSSEESKTQT
DANHTTSFHSSEVYSVTITSPVEDVVVASSSSGTVLSKESNFEGQDIKMESQQESTLWEMQSDSVSSSFEPTMSATTTVVGEQISKVIIT
KTDVDSDSWSEIREDDEAFEARVKEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDMTKRSYAD
ESFHFFQIGQESREETLSEDVKEGATGADPLPLETSAESLALSESKETVDDEADLLPDDVSEEVEEIPASDAQLNSQMGISASTETPTKE
AVSVGTKDLPTVQTGDIPPLSGVKQISCPDSSEPAVQVQLDFSTLTRSVYSDRGDDSPDSSPEEQKSVIEIPTAPMENVPFTESKSKIPV
RTMPTSTPAPPSAEYESSVSEDFLSSVDEENKADEAKPKSKLPVKVPLQRVEQQLSDLDTSVQKTVAPQGQDMASIAPDNRSKSESDASS
LDSKTKCPVKTRSYTETETESRERAEELELESEEGATRPKILTSRLPVKSRSTTSSCRGGTSPTKESKEHFFDLYRNSIEFFEEISDEAS
KLVDRLTQSEREQEIVSDDESSSALEVSVIENLPPVETEHSVPEDIFDTRPIWDESIETLIERIPDENGHDHAEDPQDEQERIEERLAYI
ADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERISHSYAE
IEQTITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETCDHPPIVSEEDISVGYSTFQDGVPKTEGDSSATALFPQTHKEQVQQDFSGK
MQDLPEESSLEYQQEYFVTTPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPIIQEPEEPSEHREESSPRKTSL
VIVESADNQPETCERLDEDAAFEKGDDMPEIPPETVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEIMVQGMPQEPVNIEEGDGY

>In-frame_CAMK2D_ENST00000394524_chr4_114430794_-_ANK2_ENST00000264366_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000394524_chr4_114430794_-_ANK2_ENST00000510275_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000454265_chr4_114430794_-_ANK2_ENST00000506722_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000454265_chr4_114430794_-_ANK2_ENST00000394537_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000454265_chr4_114430794_-_ANK2_ENST00000509550_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000394526_chr4_114430794_-_ANK2_ENST00000506722_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000394526_chr4_114430794_-_ANK2_ENST00000394537_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000394526_chr4_114430794_-_ANK2_ENST00000509550_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000429180_chr4_114430794_-_ANK2_ENST00000506722_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000429180_chr4_114430794_-_ANK2_ENST00000394537_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000429180_chr4_114430794_-_ANK2_ENST00000509550_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000296402_chr4_114430794_-_ANK2_ENST00000506722_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000296402_chr4_114430794_-_ANK2_ENST00000394537_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000296402_chr4_114430794_-_ANK2_ENST00000509550_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000418639_chr4_114430794_-_ANK2_ENST00000506722_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000418639_chr4_114430794_-_ANK2_ENST00000394537_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000418639_chr4_114430794_-_ANK2_ENST00000509550_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000511664_chr4_114430794_-_ANK2_ENST00000506722_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000511664_chr4_114430794_-_ANK2_ENST00000394537_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000511664_chr4_114430794_-_ANK2_ENST00000509550_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000342666_chr4_114430794_-_ANK2_ENST00000506722_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000342666_chr4_114430794_-_ANK2_ENST00000394537_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000342666_chr4_114430794_-_ANK2_ENST00000509550_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000515496_chr4_114430794_-_ANK2_ENST00000264366_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000515496_chr4_114430794_-_ANK2_ENST00000510275_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000514328_chr4_114430794_-_ANK2_ENST00000264366_chr4_114302613_+_332aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000514328_chr4_114430794_-_ANK2_ENST00000510275_chr4_114302613_+_332aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000394522_chr4_114430794_-_ANK2_ENST00000264366_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000394522_chr4_114430794_-_ANK2_ENST00000510275_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000505990_chr4_114430794_-_ANK2_ENST00000264366_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000505990_chr4_114430794_-_ANK2_ENST00000510275_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000379773_chr4_114430794_-_ANK2_ENST00000264366_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000379773_chr4_114430794_-_ANK2_ENST00000510275_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000508738_chr4_114430794_-_ANK2_ENST00000264366_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP

>In-frame_CAMK2D_ENST00000508738_chr4_114430794_-_ANK2_ENST00000510275_chr4_114302613_+_333aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVF
DLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CAMK2D_ENST00000394524_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_5286nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGCCGCGCCTCTCCATGTCTTGAACGTGACAACAGCAGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATG
CGAGGATGCAGACACAATGGGCTCCGAATCATTATTCCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGC
CACAGACTGGCAACAATGCCTCCAATGGTGGAAGGAGAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTT
GGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTTAATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACC
AAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAAT
GGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCA
GAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGC
AATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGG
ATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACT
TTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTT
GGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCA
TTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTT
ACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAA
GCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGG
GATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTC
AGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATG
AAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCA
GATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000394524_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_5250nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCA
AGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAG
TACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTC
ATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGG
TTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCAC
CCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACA
GCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATAT
CAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCT
GAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAA
CCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACC
TGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATT
GATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATT
ATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTATTCCAAAGTTATAAAGCGTGTTGTATTGAAGAGTGAC

>In-frame_CAMK2D_ENST00000394524_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_11505nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATGATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTG
CTCTCTGAAGTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAA
GTGAAGGAGCTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAAT
GAAATCCTGAGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTT
ATTGTCAGTGATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAA
GAGATCAAAGGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAG
CAGCTGCAGACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCC
CCAGATGAGACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAA
CAAAAAGAGGAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTA
GCCCCTGAACCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTT
CAGAAGCGAGTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCAC
AGGCCACATCCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTT
TCCTCTTCCGCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACG
GAAAGACATTCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTG
TCATCTACAAAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAA
AAACACCCGCCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACA
GCTGGGAAAACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGG
ATTGAGGAAACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCAC
AAATCAGCAAAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAG
AAAACAGAGAATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATA
GGAGTTAAGAAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAA
AGCCACAGAGAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCC
ACTGACTTCTCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAG
CTTCACTTAGACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTA
CAAAGCGGTGCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCT
CAGATTAGTTCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAA
AGTGAGGAGCAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAA
GACATTACTGGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTA
GGCTCTCCCAAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTG
ACTGAGGAGGCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACA
GCCACCTCAGACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATT
AGAAGTCCCCAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCAC
AAAGACTCTCTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCC
CCTTGCCGTGACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTT
GCCAAAACAGAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAG
CAGACATCGCTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAA
ACCACAGATGTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACA
CCTGAAGAGGAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAA
GAACCCAAACAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGG
GAGGATGAAAGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTT
AAAAAAGGTGCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCC
AGTCCAGAAGAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCA
GAAGAAGAAAAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAAC
AGAGACACTGATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTA
CAGAGTCCGACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAG
GGAGAAGAGCTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGT
TTGGTATCTGAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTT
GAGAACTTACCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTA
GCTGAGAATGATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAA
ACCCAAACAGATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTG
GCAAGCTCCTCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTG
TGGGAAATGCAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTC
ATCATCACAAAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAA
CAAAAGATATTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACC
CCAACAAGTGAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCC
TATGCAGATGAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGG
GCTGATCCCCTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCA
GATGACGTGAGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCT
ACAAAAGAAGCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCC
TGCCCCGACTCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCT
CCCGATTCTTCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAA
ATTCCTGTAAGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTA
GATGAGGAAAATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGAT
CTAGACACCTCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGAT
GCTAGTTCTTTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAA
CTTGAGTTAGAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGC
AGGGGGGGCACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGAT
GAGGCTTCCAAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTA
TCAGTAATTGAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATT
GAGACTCTGATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTG
GCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATT
GAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTC
GTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGT
TATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAG
AAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACT
TTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTC
TCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAG
ACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAG
ACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAA
ACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGAT
ATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATC
ATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGG

>In-frame_CAMK2D_ENST00000394524_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_11406nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCC
CTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAA
TTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGAC
TTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTG
CCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTT
AAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACC
ATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGT
GGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCT
GCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTAT
ATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAG
ACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTC
GGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAG
GTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGC
AACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAAT
GATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTGCTCTCTGAA
GTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAAGTGAAGGAG
CTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAATGAAATCCTG
AGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTTATTGTCAGT
GATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAAGAGATCAAA
GGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAGCAGCTGCAG
ACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCCCCAGATGAG
ACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAACAAAAAGAG
GAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTAGCCCCTGAA
CCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTTCAGAAGCGA
GTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCACAGGCCACAT
CCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTTTCCTCTTCC
GCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACGGAAAGACAT
TCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTGTCATCTACA
AAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAAAAACACCCG
CCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACAGCTGGGAAA
ACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGGATTGAGGAA
ACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCACAAATCAGCA
AAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAGAAAACAGAG
AATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATAGGAGTTAAG
AAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAAAGCCACAGA
GAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCCACTGACTTC
TCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAGCTTCACTTA
GACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTACAAAGCGGT
GCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCTCAGATTAGT
TCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAAAGTGAGGAG
CAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAAGACATTACT
GGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTAGGCTCTCCC
AAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTGACTGAGGAG
GCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACAGCCACCTCA
GACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATTAGAAGTCCC
CAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCACAAAGACTCT
CTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCCCCTTGCCGT
GACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTTGCCAAAACA
GAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAGCAGACATCG
CTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAAACCACAGAT
GTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACACCTGAAGAG
GAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAAGAACCCAAA
CAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGGGAGGATGAA
AGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTTAAAAAAGGT
GCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCCAGTCCAGAA
GAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCAGAAGAAGAA
AAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAACAGAGACACT
GATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTACAGAGTCCG
ACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAGGGAGAAGAG
CTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGTTTGGTATCT
GAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTTGAGAACTTA
CCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTAGCTGAGAAT
GATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAAACCCAAACA
GATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTGGCAAGCTCC
TCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTGTGGGAAATG
CAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTCATCATCACA
AAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAACAAAAGATA
TTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACCCCAACAAGT
GAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCCTATGCAGAT
GAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGGGCTGATCCC
CTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCAGATGACGTG
AGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCTACAAAAGAA
GCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCCTGCCCCGAC
TCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCTCCCGATTCT
TCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAAATTCCTGTA
AGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTAGATGAGGAA
AATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGATCTAGACACC
TCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGATGCTAGTTCT
TTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAACTTGAGTTA
GAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGCAGGGGGGGC
ACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGATGAGGCTTCC
AAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTATCAGTAATT
GAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATTGAGACTCTG
ATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000454265_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_5286nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGCCGCGCCTCTCCATGTCTTGAACGTGACAACAGCAGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATG
CGAGGATGCAGACACAATGGGCTCCGAATCATTATTCCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGC
CACAGACTGGCAACAATGCCTCCAATGGTGGAAGGAGAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTT
GGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTTAATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACC
AAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAAT
GGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCA
GAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGC
AATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGG
ATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACT
TTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTT
GGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCA
TTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTT
ACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAA
GCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGG
GATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTC
AGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATG
AAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCA
GATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000454265_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_5250nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCA
AGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAG
TACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTC
ATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGG
TTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCAC
CCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACA
GCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATAT
CAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCT
GAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAA
CCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACC
TGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATT
GATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATT
ATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTATTCCAAAGTTATAAAGCGTGTTGTATTGAAGAGTGAC

>In-frame_CAMK2D_ENST00000454265_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_11505nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATGATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTG
CTCTCTGAAGTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAA
GTGAAGGAGCTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAAT
GAAATCCTGAGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTT
ATTGTCAGTGATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAA
GAGATCAAAGGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAG
CAGCTGCAGACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCC
CCAGATGAGACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAA
CAAAAAGAGGAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTA
GCCCCTGAACCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTT
CAGAAGCGAGTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCAC
AGGCCACATCCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTT
TCCTCTTCCGCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACG
GAAAGACATTCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTG
TCATCTACAAAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAA
AAACACCCGCCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACA
GCTGGGAAAACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGG
ATTGAGGAAACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCAC
AAATCAGCAAAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAG
AAAACAGAGAATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATA
GGAGTTAAGAAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAA
AGCCACAGAGAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCC
ACTGACTTCTCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAG
CTTCACTTAGACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTA
CAAAGCGGTGCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCT
CAGATTAGTTCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAA
AGTGAGGAGCAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAA
GACATTACTGGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTA
GGCTCTCCCAAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTG
ACTGAGGAGGCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACA
GCCACCTCAGACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATT
AGAAGTCCCCAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCAC
AAAGACTCTCTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCC
CCTTGCCGTGACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTT
GCCAAAACAGAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAG
CAGACATCGCTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAA
ACCACAGATGTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACA
CCTGAAGAGGAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAA
GAACCCAAACAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGG
GAGGATGAAAGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTT
AAAAAAGGTGCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCC
AGTCCAGAAGAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCA
GAAGAAGAAAAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAAC
AGAGACACTGATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTA
CAGAGTCCGACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAG
GGAGAAGAGCTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGT
TTGGTATCTGAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTT
GAGAACTTACCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTA
GCTGAGAATGATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAA
ACCCAAACAGATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTG
GCAAGCTCCTCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTG
TGGGAAATGCAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTC
ATCATCACAAAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAA
CAAAAGATATTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACC
CCAACAAGTGAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCC
TATGCAGATGAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGG
GCTGATCCCCTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCA
GATGACGTGAGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCT
ACAAAAGAAGCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCC
TGCCCCGACTCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCT
CCCGATTCTTCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAA
ATTCCTGTAAGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTA
GATGAGGAAAATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGAT
CTAGACACCTCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGAT
GCTAGTTCTTTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAA
CTTGAGTTAGAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGC
AGGGGGGGCACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGAT
GAGGCTTCCAAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTA
TCAGTAATTGAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATT
GAGACTCTGATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTG
GCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATT
GAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTC
GTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGT
TATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAG
AAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACT
TTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTC
TCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAG
ACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAG
ACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAA
ACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGAT
ATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATC
ATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGG

>In-frame_CAMK2D_ENST00000454265_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_11406nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCC
CTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAA
TTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGAC
TTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTG
CCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTT
AAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACC
ATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGT
GGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCT
GCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTAT
ATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAG
ACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTC
GGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAG
GTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGC
AACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAAT
GATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTGCTCTCTGAA
GTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAAGTGAAGGAG
CTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAATGAAATCCTG
AGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTTATTGTCAGT
GATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAAGAGATCAAA
GGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAGCAGCTGCAG
ACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCCCCAGATGAG
ACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAACAAAAAGAG
GAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTAGCCCCTGAA
CCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTTCAGAAGCGA
GTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCACAGGCCACAT
CCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTTTCCTCTTCC
GCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACGGAAAGACAT
TCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTGTCATCTACA
AAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAAAAACACCCG
CCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACAGCTGGGAAA
ACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGGATTGAGGAA
ACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCACAAATCAGCA
AAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAGAAAACAGAG
AATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATAGGAGTTAAG
AAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAAAGCCACAGA
GAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCCACTGACTTC
TCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAGCTTCACTTA
GACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTACAAAGCGGT
GCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCTCAGATTAGT
TCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAAAGTGAGGAG
CAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAAGACATTACT
GGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTAGGCTCTCCC
AAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTGACTGAGGAG
GCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACAGCCACCTCA
GACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATTAGAAGTCCC
CAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCACAAAGACTCT
CTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCCCCTTGCCGT
GACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTTGCCAAAACA
GAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAGCAGACATCG
CTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAAACCACAGAT
GTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACACCTGAAGAG
GAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAAGAACCCAAA
CAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGGGAGGATGAA
AGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTTAAAAAAGGT
GCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCCAGTCCAGAA
GAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCAGAAGAAGAA
AAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAACAGAGACACT
GATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTACAGAGTCCG
ACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAGGGAGAAGAG
CTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGTTTGGTATCT
GAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTTGAGAACTTA
CCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTAGCTGAGAAT
GATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAAACCCAAACA
GATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTGGCAAGCTCC
TCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTGTGGGAAATG
CAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTCATCATCACA
AAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAACAAAAGATA
TTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACCCCAACAAGT
GAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCCTATGCAGAT
GAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGGGCTGATCCC
CTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCAGATGACGTG
AGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCTACAAAAGAA
GCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCCTGCCCCGAC
TCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCTCCCGATTCT
TCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAAATTCCTGTA
AGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTAGATGAGGAA
AATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGATCTAGACACC
TCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGATGCTAGTTCT
TTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAACTTGAGTTA
GAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGCAGGGGGGGC
ACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGATGAGGCTTCC
AAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTATCAGTAATT
GAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATTGAGACTCTG
ATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000394526_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_5286nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGCCGCGCCTCTCCATGTCTTGAACGTGACAACAGCAGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATG
CGAGGATGCAGACACAATGGGCTCCGAATCATTATTCCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGC
CACAGACTGGCAACAATGCCTCCAATGGTGGAAGGAGAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTT
GGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTTAATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACC
AAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAAT
GGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCA
GAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGC
AATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGG
ATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACT
TTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTT
GGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCA
TTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTT
ACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAA
GCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGG
GATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTC
AGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATG
AAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCA
GATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000394526_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_5250nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCA
AGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAG
TACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTC
ATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGG
TTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCAC
CCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACA
GCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATAT
CAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCT
GAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAA
CCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACC
TGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATT
GATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATT
ATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTATTCCAAAGTTATAAAGCGTGTTGTATTGAAGAGTGAC

>In-frame_CAMK2D_ENST00000394526_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_11505nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATGATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTG
CTCTCTGAAGTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAA
GTGAAGGAGCTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAAT
GAAATCCTGAGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTT
ATTGTCAGTGATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAA
GAGATCAAAGGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAG
CAGCTGCAGACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCC
CCAGATGAGACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAA
CAAAAAGAGGAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTA
GCCCCTGAACCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTT
CAGAAGCGAGTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCAC
AGGCCACATCCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTT
TCCTCTTCCGCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACG
GAAAGACATTCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTG
TCATCTACAAAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAA
AAACACCCGCCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACA
GCTGGGAAAACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGG
ATTGAGGAAACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCAC
AAATCAGCAAAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAG
AAAACAGAGAATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATA
GGAGTTAAGAAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAA
AGCCACAGAGAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCC
ACTGACTTCTCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAG
CTTCACTTAGACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTA
CAAAGCGGTGCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCT
CAGATTAGTTCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAA
AGTGAGGAGCAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAA
GACATTACTGGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTA
GGCTCTCCCAAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTG
ACTGAGGAGGCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACA
GCCACCTCAGACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATT
AGAAGTCCCCAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCAC
AAAGACTCTCTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCC
CCTTGCCGTGACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTT
GCCAAAACAGAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAG
CAGACATCGCTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAA
ACCACAGATGTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACA
CCTGAAGAGGAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAA
GAACCCAAACAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGG
GAGGATGAAAGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTT
AAAAAAGGTGCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCC
AGTCCAGAAGAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCA
GAAGAAGAAAAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAAC
AGAGACACTGATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTA
CAGAGTCCGACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAG
GGAGAAGAGCTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGT
TTGGTATCTGAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTT
GAGAACTTACCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTA
GCTGAGAATGATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAA
ACCCAAACAGATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTG
GCAAGCTCCTCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTG
TGGGAAATGCAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTC
ATCATCACAAAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAA
CAAAAGATATTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACC
CCAACAAGTGAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCC
TATGCAGATGAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGG
GCTGATCCCCTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCA
GATGACGTGAGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCT
ACAAAAGAAGCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCC
TGCCCCGACTCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCT
CCCGATTCTTCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAA
ATTCCTGTAAGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTA
GATGAGGAAAATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGAT
CTAGACACCTCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGAT
GCTAGTTCTTTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAA
CTTGAGTTAGAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGC
AGGGGGGGCACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGAT
GAGGCTTCCAAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTA
TCAGTAATTGAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATT
GAGACTCTGATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTG
GCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATT
GAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTC
GTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGT
TATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAG
AAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACT
TTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTC
TCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAG
ACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAG
ACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAA
ACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGAT
ATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATC
ATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGG

>In-frame_CAMK2D_ENST00000394526_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_11406nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCC
CTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAA
TTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGAC
TTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTG
CCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTT
AAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACC
ATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGT
GGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCT
GCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTAT
ATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAG
ACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTC
GGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAG
GTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGC
AACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAAT
GATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTGCTCTCTGAA
GTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAAGTGAAGGAG
CTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAATGAAATCCTG
AGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTTATTGTCAGT
GATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAAGAGATCAAA
GGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAGCAGCTGCAG
ACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCCCCAGATGAG
ACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAACAAAAAGAG
GAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTAGCCCCTGAA
CCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTTCAGAAGCGA
GTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCACAGGCCACAT
CCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTTTCCTCTTCC
GCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACGGAAAGACAT
TCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTGTCATCTACA
AAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAAAAACACCCG
CCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACAGCTGGGAAA
ACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGGATTGAGGAA
ACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCACAAATCAGCA
AAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAGAAAACAGAG
AATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATAGGAGTTAAG
AAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAAAGCCACAGA
GAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCCACTGACTTC
TCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAGCTTCACTTA
GACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTACAAAGCGGT
GCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCTCAGATTAGT
TCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAAAGTGAGGAG
CAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAAGACATTACT
GGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTAGGCTCTCCC
AAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTGACTGAGGAG
GCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACAGCCACCTCA
GACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATTAGAAGTCCC
CAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCACAAAGACTCT
CTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCCCCTTGCCGT
GACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTTGCCAAAACA
GAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAGCAGACATCG
CTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAAACCACAGAT
GTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACACCTGAAGAG
GAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAAGAACCCAAA
CAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGGGAGGATGAA
AGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTTAAAAAAGGT
GCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCCAGTCCAGAA
GAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCAGAAGAAGAA
AAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAACAGAGACACT
GATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTACAGAGTCCG
ACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAGGGAGAAGAG
CTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGTTTGGTATCT
GAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTTGAGAACTTA
CCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTAGCTGAGAAT
GATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAAACCCAAACA
GATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTGGCAAGCTCC
TCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTGTGGGAAATG
CAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTCATCATCACA
AAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAACAAAAGATA
TTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACCCCAACAAGT
GAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCCTATGCAGAT
GAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGGGCTGATCCC
CTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCAGATGACGTG
AGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCTACAAAAGAA
GCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCCTGCCCCGAC
TCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCTCCCGATTCT
TCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAAATTCCTGTA
AGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTAGATGAGGAA
AATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGATCTAGACACC
TCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGATGCTAGTTCT
TTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAACTTGAGTTA
GAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGCAGGGGGGGC
ACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGATGAGGCTTCC
AAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTATCAGTAATT
GAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATTGAGACTCTG
ATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000429180_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_5286nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGCCGCGCCTCTCCATGTCTTGAACGTGACAACAGCAGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATG
CGAGGATGCAGACACAATGGGCTCCGAATCATTATTCCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGC
CACAGACTGGCAACAATGCCTCCAATGGTGGAAGGAGAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTT
GGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTTAATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACC
AAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAAT
GGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCA
GAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGC
AATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGG
ATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACT
TTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTT
GGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCA
TTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTT
ACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAA
GCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGG
GATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTC
AGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATG
AAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCA
GATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000429180_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_5250nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCA
AGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAG
TACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTC
ATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGG
TTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCAC
CCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACA
GCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATAT
CAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCT
GAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAA
CCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACC
TGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATT
GATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATT
ATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTATTCCAAAGTTATAAAGCGTGTTGTATTGAAGAGTGAC

>In-frame_CAMK2D_ENST00000429180_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_11505nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATGATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTG
CTCTCTGAAGTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAA
GTGAAGGAGCTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAAT
GAAATCCTGAGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTT
ATTGTCAGTGATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAA
GAGATCAAAGGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAG
CAGCTGCAGACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCC
CCAGATGAGACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAA
CAAAAAGAGGAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTA
GCCCCTGAACCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTT
CAGAAGCGAGTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCAC
AGGCCACATCCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTT
TCCTCTTCCGCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACG
GAAAGACATTCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTG
TCATCTACAAAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAA
AAACACCCGCCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACA
GCTGGGAAAACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGG
ATTGAGGAAACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCAC
AAATCAGCAAAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAG
AAAACAGAGAATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATA
GGAGTTAAGAAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAA
AGCCACAGAGAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCC
ACTGACTTCTCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAG
CTTCACTTAGACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTA
CAAAGCGGTGCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCT
CAGATTAGTTCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAA
AGTGAGGAGCAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAA
GACATTACTGGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTA
GGCTCTCCCAAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTG
ACTGAGGAGGCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACA
GCCACCTCAGACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATT
AGAAGTCCCCAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCAC
AAAGACTCTCTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCC
CCTTGCCGTGACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTT
GCCAAAACAGAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAG
CAGACATCGCTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAA
ACCACAGATGTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACA
CCTGAAGAGGAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAA
GAACCCAAACAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGG
GAGGATGAAAGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTT
AAAAAAGGTGCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCC
AGTCCAGAAGAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCA
GAAGAAGAAAAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAAC
AGAGACACTGATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTA
CAGAGTCCGACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAG
GGAGAAGAGCTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGT
TTGGTATCTGAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTT
GAGAACTTACCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTA
GCTGAGAATGATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAA
ACCCAAACAGATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTG
GCAAGCTCCTCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTG
TGGGAAATGCAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTC
ATCATCACAAAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAA
CAAAAGATATTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACC
CCAACAAGTGAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCC
TATGCAGATGAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGG
GCTGATCCCCTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCA
GATGACGTGAGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCT
ACAAAAGAAGCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCC
TGCCCCGACTCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCT
CCCGATTCTTCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAA
ATTCCTGTAAGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTA
GATGAGGAAAATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGAT
CTAGACACCTCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGAT
GCTAGTTCTTTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAA
CTTGAGTTAGAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGC
AGGGGGGGCACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGAT
GAGGCTTCCAAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTA
TCAGTAATTGAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATT
GAGACTCTGATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTG
GCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATT
GAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTC
GTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGT
TATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAG
AAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACT
TTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTC
TCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAG
ACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAG
ACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAA
ACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGAT
ATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATC
ATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGG

>In-frame_CAMK2D_ENST00000429180_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_11406nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCC
CTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAA
TTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGAC
TTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTG
CCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTT
AAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACC
ATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGT
GGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCT
GCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTAT
ATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAG
ACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTC
GGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAG
GTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGC
AACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAAT
GATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTGCTCTCTGAA
GTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAAGTGAAGGAG
CTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAATGAAATCCTG
AGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTTATTGTCAGT
GATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAAGAGATCAAA
GGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAGCAGCTGCAG
ACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCCCCAGATGAG
ACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAACAAAAAGAG
GAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTAGCCCCTGAA
CCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTTCAGAAGCGA
GTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCACAGGCCACAT
CCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTTTCCTCTTCC
GCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACGGAAAGACAT
TCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTGTCATCTACA
AAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAAAAACACCCG
CCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACAGCTGGGAAA
ACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGGATTGAGGAA
ACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCACAAATCAGCA
AAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAGAAAACAGAG
AATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATAGGAGTTAAG
AAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAAAGCCACAGA
GAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCCACTGACTTC
TCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAGCTTCACTTA
GACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTACAAAGCGGT
GCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCTCAGATTAGT
TCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAAAGTGAGGAG
CAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAAGACATTACT
GGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTAGGCTCTCCC
AAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTGACTGAGGAG
GCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACAGCCACCTCA
GACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATTAGAAGTCCC
CAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCACAAAGACTCT
CTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCCCCTTGCCGT
GACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTTGCCAAAACA
GAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAGCAGACATCG
CTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAAACCACAGAT
GTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACACCTGAAGAG
GAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAAGAACCCAAA
CAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGGGAGGATGAA
AGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTTAAAAAAGGT
GCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCCAGTCCAGAA
GAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCAGAAGAAGAA
AAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAACAGAGACACT
GATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTACAGAGTCCG
ACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAGGGAGAAGAG
CTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGTTTGGTATCT
GAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTTGAGAACTTA
CCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTAGCTGAGAAT
GATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAAACCCAAACA
GATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTGGCAAGCTCC
TCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTGTGGGAAATG
CAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTCATCATCACA
AAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAACAAAAGATA
TTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACCCCAACAAGT
GAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCCTATGCAGAT
GAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGGGCTGATCCC
CTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCAGATGACGTG
AGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCTACAAAAGAA
GCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCCTGCCCCGAC
TCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCTCCCGATTCT
TCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAAATTCCTGTA
AGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTAGATGAGGAA
AATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGATCTAGACACC
TCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGATGCTAGTTCT
TTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAACTTGAGTTA
GAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGCAGGGGGGGC
ACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGATGAGGCTTCC
AAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTATCAGTAATT
GAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATTGAGACTCTG
ATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000296402_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_5286nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGCCGCGCCTCTCCATGTCTTGAACGTGACAACAGCAGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATG
CGAGGATGCAGACACAATGGGCTCCGAATCATTATTCCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGC
CACAGACTGGCAACAATGCCTCCAATGGTGGAAGGAGAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTT
GGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTTAATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACC
AAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAAT
GGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCA
GAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGC
AATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGG
ATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACT
TTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTT
GGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCA
TTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTT
ACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAA
GCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGG
GATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTC
AGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATG
AAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCA
GATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000296402_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_5250nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCA
AGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAG
TACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTC
ATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGG
TTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCAC
CCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACA
GCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATAT
CAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCT
GAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAA
CCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACC
TGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATT
GATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATT
ATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTATTCCAAAGTTATAAAGCGTGTTGTATTGAAGAGTGAC

>In-frame_CAMK2D_ENST00000296402_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_11505nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATGATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTG
CTCTCTGAAGTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAA
GTGAAGGAGCTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAAT
GAAATCCTGAGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTT
ATTGTCAGTGATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAA
GAGATCAAAGGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAG
CAGCTGCAGACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCC
CCAGATGAGACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAA
CAAAAAGAGGAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTA
GCCCCTGAACCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTT
CAGAAGCGAGTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCAC
AGGCCACATCCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTT
TCCTCTTCCGCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACG
GAAAGACATTCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTG
TCATCTACAAAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAA
AAACACCCGCCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACA
GCTGGGAAAACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGG
ATTGAGGAAACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCAC
AAATCAGCAAAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAG
AAAACAGAGAATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATA
GGAGTTAAGAAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAA
AGCCACAGAGAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCC
ACTGACTTCTCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAG
CTTCACTTAGACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTA
CAAAGCGGTGCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCT
CAGATTAGTTCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAA
AGTGAGGAGCAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAA
GACATTACTGGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTA
GGCTCTCCCAAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTG
ACTGAGGAGGCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACA
GCCACCTCAGACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATT
AGAAGTCCCCAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCAC
AAAGACTCTCTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCC
CCTTGCCGTGACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTT
GCCAAAACAGAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAG
CAGACATCGCTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAA
ACCACAGATGTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACA
CCTGAAGAGGAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAA
GAACCCAAACAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGG
GAGGATGAAAGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTT
AAAAAAGGTGCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCC
AGTCCAGAAGAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCA
GAAGAAGAAAAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAAC
AGAGACACTGATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTA
CAGAGTCCGACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAG
GGAGAAGAGCTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGT
TTGGTATCTGAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTT
GAGAACTTACCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTA
GCTGAGAATGATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAA
ACCCAAACAGATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTG
GCAAGCTCCTCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTG
TGGGAAATGCAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTC
ATCATCACAAAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAA
CAAAAGATATTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACC
CCAACAAGTGAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCC
TATGCAGATGAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGG
GCTGATCCCCTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCA
GATGACGTGAGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCT
ACAAAAGAAGCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCC
TGCCCCGACTCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCT
CCCGATTCTTCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAA
ATTCCTGTAAGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTA
GATGAGGAAAATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGAT
CTAGACACCTCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGAT
GCTAGTTCTTTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAA
CTTGAGTTAGAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGC
AGGGGGGGCACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGAT
GAGGCTTCCAAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTA
TCAGTAATTGAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATT
GAGACTCTGATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTG
GCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATT
GAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTC
GTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGT
TATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAG
AAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACT
TTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTC
TCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAG
ACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAG
ACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAA
ACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGAT
ATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATC
ATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGG

>In-frame_CAMK2D_ENST00000296402_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_11406nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCC
CTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAA
TTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGAC
TTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTG
CCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTT
AAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACC
ATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGT
GGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCT
GCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTAT
ATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAG
ACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTC
GGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAG
GTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGC
AACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAAT
GATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTGCTCTCTGAA
GTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAAGTGAAGGAG
CTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAATGAAATCCTG
AGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTTATTGTCAGT
GATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAAGAGATCAAA
GGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAGCAGCTGCAG
ACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCCCCAGATGAG
ACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAACAAAAAGAG
GAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTAGCCCCTGAA
CCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTTCAGAAGCGA
GTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCACAGGCCACAT
CCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTTTCCTCTTCC
GCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACGGAAAGACAT
TCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTGTCATCTACA
AAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAAAAACACCCG
CCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACAGCTGGGAAA
ACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGGATTGAGGAA
ACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCACAAATCAGCA
AAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAGAAAACAGAG
AATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATAGGAGTTAAG
AAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAAAGCCACAGA
GAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCCACTGACTTC
TCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAGCTTCACTTA
GACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTACAAAGCGGT
GCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCTCAGATTAGT
TCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAAAGTGAGGAG
CAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAAGACATTACT
GGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTAGGCTCTCCC
AAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTGACTGAGGAG
GCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACAGCCACCTCA
GACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATTAGAAGTCCC
CAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCACAAAGACTCT
CTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCCCCTTGCCGT
GACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTTGCCAAAACA
GAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAGCAGACATCG
CTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAAACCACAGAT
GTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACACCTGAAGAG
GAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAAGAACCCAAA
CAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGGGAGGATGAA
AGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTTAAAAAAGGT
GCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCCAGTCCAGAA
GAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCAGAAGAAGAA
AAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAACAGAGACACT
GATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTACAGAGTCCG
ACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAGGGAGAAGAG
CTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGTTTGGTATCT
GAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTTGAGAACTTA
CCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTAGCTGAGAAT
GATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAAACCCAAACA
GATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTGGCAAGCTCC
TCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTGTGGGAAATG
CAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTCATCATCACA
AAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAACAAAAGATA
TTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACCCCAACAAGT
GAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCCTATGCAGAT
GAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGGGCTGATCCC
CTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCAGATGACGTG
AGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCTACAAAAGAA
GCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCCTGCCCCGAC
TCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCTCCCGATTCT
TCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAAATTCCTGTA
AGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTAGATGAGGAA
AATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGATCTAGACACC
TCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGATGCTAGTTCT
TTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAACTTGAGTTA
GAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGCAGGGGGGGC
ACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGATGAGGCTTCC
AAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTATCAGTAATT
GAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATTGAGACTCTG
ATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000418639_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_5286nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGCCGCGCCTCTCCATGTCTTGAACGTGACAACAGCAGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATG
CGAGGATGCAGACACAATGGGCTCCGAATCATTATTCCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGC
CACAGACTGGCAACAATGCCTCCAATGGTGGAAGGAGAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTT
GGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTTAATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACC
AAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAAT
GGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCA
GAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGC
AATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGG
ATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACT
TTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTT
GGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCA
TTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTT
ACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAA
GCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGG
GATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTC
AGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATG
AAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCA
GATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000418639_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_5250nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCA
AGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAG
TACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTC
ATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGG
TTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCAC
CCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACA
GCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATAT
CAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCT
GAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAA
CCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACC
TGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATT
GATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATT
ATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTATTCCAAAGTTATAAAGCGTGTTGTATTGAAGAGTGAC

>In-frame_CAMK2D_ENST00000418639_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_11505nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATGATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTG
CTCTCTGAAGTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAA
GTGAAGGAGCTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAAT
GAAATCCTGAGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTT
ATTGTCAGTGATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAA
GAGATCAAAGGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAG
CAGCTGCAGACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCC
CCAGATGAGACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAA
CAAAAAGAGGAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTA
GCCCCTGAACCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTT
CAGAAGCGAGTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCAC
AGGCCACATCCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTT
TCCTCTTCCGCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACG
GAAAGACATTCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTG
TCATCTACAAAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAA
AAACACCCGCCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACA
GCTGGGAAAACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGG
ATTGAGGAAACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCAC
AAATCAGCAAAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAG
AAAACAGAGAATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATA
GGAGTTAAGAAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAA
AGCCACAGAGAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCC
ACTGACTTCTCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAG
CTTCACTTAGACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTA
CAAAGCGGTGCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCT
CAGATTAGTTCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAA
AGTGAGGAGCAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAA
GACATTACTGGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTA
GGCTCTCCCAAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTG
ACTGAGGAGGCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACA
GCCACCTCAGACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATT
AGAAGTCCCCAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCAC
AAAGACTCTCTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCC
CCTTGCCGTGACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTT
GCCAAAACAGAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAG
CAGACATCGCTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAA
ACCACAGATGTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACA
CCTGAAGAGGAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAA
GAACCCAAACAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGG
GAGGATGAAAGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTT
AAAAAAGGTGCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCC
AGTCCAGAAGAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCA
GAAGAAGAAAAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAAC
AGAGACACTGATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTA
CAGAGTCCGACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAG
GGAGAAGAGCTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGT
TTGGTATCTGAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTT
GAGAACTTACCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTA
GCTGAGAATGATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAA
ACCCAAACAGATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTG
GCAAGCTCCTCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTG
TGGGAAATGCAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTC
ATCATCACAAAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAA
CAAAAGATATTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACC
CCAACAAGTGAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCC
TATGCAGATGAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGG
GCTGATCCCCTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCA
GATGACGTGAGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCT
ACAAAAGAAGCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCC
TGCCCCGACTCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCT
CCCGATTCTTCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAA
ATTCCTGTAAGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTA
GATGAGGAAAATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGAT
CTAGACACCTCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGAT
GCTAGTTCTTTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAA
CTTGAGTTAGAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGC
AGGGGGGGCACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGAT
GAGGCTTCCAAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTA
TCAGTAATTGAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATT
GAGACTCTGATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTG
GCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATT
GAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTC
GTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGT
TATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAG
AAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACT
TTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTC
TCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAG
ACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAG
ACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAA
ACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGAT
ATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATC
ATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGG

>In-frame_CAMK2D_ENST00000418639_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_11406nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCC
CTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAA
TTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGAC
TTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTG
CCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTT
AAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACC
ATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGT
GGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCT
GCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTAT
ATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAG
ACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTC
GGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAG
GTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGC
AACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAAT
GATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTGCTCTCTGAA
GTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAAGTGAAGGAG
CTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAATGAAATCCTG
AGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTTATTGTCAGT
GATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAAGAGATCAAA
GGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAGCAGCTGCAG
ACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCCCCAGATGAG
ACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAACAAAAAGAG
GAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTAGCCCCTGAA
CCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTTCAGAAGCGA
GTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCACAGGCCACAT
CCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTTTCCTCTTCC
GCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACGGAAAGACAT
TCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTGTCATCTACA
AAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAAAAACACCCG
CCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACAGCTGGGAAA
ACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGGATTGAGGAA
ACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCACAAATCAGCA
AAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAGAAAACAGAG
AATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATAGGAGTTAAG
AAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAAAGCCACAGA
GAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCCACTGACTTC
TCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAGCTTCACTTA
GACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTACAAAGCGGT
GCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCTCAGATTAGT
TCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAAAGTGAGGAG
CAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAAGACATTACT
GGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTAGGCTCTCCC
AAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTGACTGAGGAG
GCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACAGCCACCTCA
GACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATTAGAAGTCCC
CAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCACAAAGACTCT
CTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCCCCTTGCCGT
GACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTTGCCAAAACA
GAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAGCAGACATCG
CTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAAACCACAGAT
GTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACACCTGAAGAG
GAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAAGAACCCAAA
CAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGGGAGGATGAA
AGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTTAAAAAAGGT
GCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCCAGTCCAGAA
GAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCAGAAGAAGAA
AAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAACAGAGACACT
GATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTACAGAGTCCG
ACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAGGGAGAAGAG
CTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGTTTGGTATCT
GAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTTGAGAACTTA
CCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTAGCTGAGAAT
GATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAAACCCAAACA
GATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTGGCAAGCTCC
TCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTGTGGGAAATG
CAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTCATCATCACA
AAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAACAAAAGATA
TTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACCCCAACAAGT
GAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCCTATGCAGAT
GAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGGGCTGATCCC
CTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCAGATGACGTG
AGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCTACAAAAGAA
GCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCCTGCCCCGAC
TCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCTCCCGATTCT
TCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAAATTCCTGTA
AGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTAGATGAGGAA
AATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGATCTAGACACC
TCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGATGCTAGTTCT
TTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAACTTGAGTTA
GAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGCAGGGGGGGC
ACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGATGAGGCTTCC
AAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTATCAGTAATT
GAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATTGAGACTCTG
ATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000511664_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_5286nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGCATTCAGCAGATC
CTGGAGGCTGTGCTACACTGCCATCAGATGGGCGTGGTCCATCGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGCCGCGCCTCTCCATGTCTTGAACGTGACAACAGCAGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATG
CGAGGATGCAGACACAATGGGCTCCGAATCATTATTCCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGC
CACAGACTGGCAACAATGCCTCCAATGGTGGAAGGAGAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTT
GGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTTAATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACC
AAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAAT
GGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCA
GAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGC
AATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGG
ATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACT
TTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTT
GGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCA
TTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTT
ACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAA
GCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGG
GATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTC
AGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATG
AAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCA
GATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000511664_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_5250nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGCATTCAGCAGATC
CTGGAGGCTGTGCTACACTGCCATCAGATGGGCGTGGTCCATCGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCA
AGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAG
TACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTC
ATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGG
TTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCAC
CCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACA
GCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATAT
CAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCT
GAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAA
CCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACC
TGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATT
GATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATT
ATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTATTCCAAAGTTATAAAGCGTGTTGTATTGAAGAGTGAC

>In-frame_CAMK2D_ENST00000511664_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_11505nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGCATTCAGCAGATC
CTGGAGGCTGTGCTACACTGCCATCAGATGGGCGTGGTCCATCGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATGATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTG
CTCTCTGAAGTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAA
GTGAAGGAGCTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAAT
GAAATCCTGAGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTT
ATTGTCAGTGATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAA
GAGATCAAAGGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAG
CAGCTGCAGACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCC
CCAGATGAGACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAA
CAAAAAGAGGAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTA
GCCCCTGAACCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTT
CAGAAGCGAGTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCAC
AGGCCACATCCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTT
TCCTCTTCCGCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACG
GAAAGACATTCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTG
TCATCTACAAAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAA
AAACACCCGCCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACA
GCTGGGAAAACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGG
ATTGAGGAAACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCAC
AAATCAGCAAAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAG
AAAACAGAGAATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATA
GGAGTTAAGAAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAA
AGCCACAGAGAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCC
ACTGACTTCTCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAG
CTTCACTTAGACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTA
CAAAGCGGTGCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCT
CAGATTAGTTCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAA
AGTGAGGAGCAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAA
GACATTACTGGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTA
GGCTCTCCCAAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTG
ACTGAGGAGGCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACA
GCCACCTCAGACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATT
AGAAGTCCCCAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCAC
AAAGACTCTCTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCC
CCTTGCCGTGACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTT
GCCAAAACAGAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAG
CAGACATCGCTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAA
ACCACAGATGTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACA
CCTGAAGAGGAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAA
GAACCCAAACAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGG
GAGGATGAAAGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTT
AAAAAAGGTGCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCC
AGTCCAGAAGAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCA
GAAGAAGAAAAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAAC
AGAGACACTGATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTA
CAGAGTCCGACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAG
GGAGAAGAGCTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGT
TTGGTATCTGAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTT
GAGAACTTACCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTA
GCTGAGAATGATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAA
ACCCAAACAGATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTG
GCAAGCTCCTCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTG
TGGGAAATGCAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTC
ATCATCACAAAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAA
CAAAAGATATTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACC
CCAACAAGTGAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCC
TATGCAGATGAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGG
GCTGATCCCCTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCA
GATGACGTGAGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCT
ACAAAAGAAGCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCC
TGCCCCGACTCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCT
CCCGATTCTTCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAA
ATTCCTGTAAGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTA
GATGAGGAAAATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGAT
CTAGACACCTCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGAT
GCTAGTTCTTTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAA
CTTGAGTTAGAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGC
AGGGGGGGCACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGAT
GAGGCTTCCAAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTA
TCAGTAATTGAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATT
GAGACTCTGATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTG
GCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATT
GAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTC
GTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGT
TATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAG
AAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACT
TTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTC
TCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAG
ACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAG
ACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAA
ACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGAT
ATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATC
ATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGG

>In-frame_CAMK2D_ENST00000511664_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_11406nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGCATTCAGCAGATC
CTGGAGGCTGTGCTACACTGCCATCAGATGGGCGTGGTCCATCGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCC
CTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAA
TTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGAC
TTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTG
CCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTT
AAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACC
ATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGT
GGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCT
GCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTAT
ATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAG
ACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTC
GGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAG
GTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGC
AACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAAT
GATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTGCTCTCTGAA
GTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAAGTGAAGGAG
CTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAATGAAATCCTG
AGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTTATTGTCAGT
GATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAAGAGATCAAA
GGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAGCAGCTGCAG
ACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCCCCAGATGAG
ACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAACAAAAAGAG
GAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTAGCCCCTGAA
CCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTTCAGAAGCGA
GTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCACAGGCCACAT
CCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTTTCCTCTTCC
GCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACGGAAAGACAT
TCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTGTCATCTACA
AAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAAAAACACCCG
CCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACAGCTGGGAAA
ACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGGATTGAGGAA
ACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCACAAATCAGCA
AAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAGAAAACAGAG
AATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATAGGAGTTAAG
AAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAAAGCCACAGA
GAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCCACTGACTTC
TCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAGCTTCACTTA
GACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTACAAAGCGGT
GCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCTCAGATTAGT
TCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAAAGTGAGGAG
CAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAAGACATTACT
GGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTAGGCTCTCCC
AAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTGACTGAGGAG
GCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACAGCCACCTCA
GACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATTAGAAGTCCC
CAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCACAAAGACTCT
CTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCCCCTTGCCGT
GACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTTGCCAAAACA
GAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAGCAGACATCG
CTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAAACCACAGAT
GTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACACCTGAAGAG
GAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAAGAACCCAAA
CAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGGGAGGATGAA
AGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTTAAAAAAGGT
GCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCCAGTCCAGAA
GAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCAGAAGAAGAA
AAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAACAGAGACACT
GATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTACAGAGTCCG
ACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAGGGAGAAGAG
CTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGTTTGGTATCT
GAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTTGAGAACTTA
CCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTAGCTGAGAAT
GATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAAACCCAAACA
GATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTGGCAAGCTCC
TCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTGTGGGAAATG
CAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTCATCATCACA
AAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAACAAAAGATA
TTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACCCCAACAAGT
GAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCCTATGCAGAT
GAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGGGCTGATCCC
CTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCAGATGACGTG
AGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCTACAAAAGAA
GCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCCTGCCCCGAC
TCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCTCCCGATTCT
TCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAAATTCCTGTA
AGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTAGATGAGGAA
AATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGATCTAGACACC
TCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGATGCTAGTTCT
TTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAACTTGAGTTA
GAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGCAGGGGGGGC
ACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGATGAGGCTTCC
AAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTATCAGTAATT
GAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATTGAGACTCTG
ATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000342666_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_5286nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGCCGCGCCTCTCCATGTCTTGAACGTGACAACAGCAGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATG
CGAGGATGCAGACACAATGGGCTCCGAATCATTATTCCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGC
CACAGACTGGCAACAATGCCTCCAATGGTGGAAGGAGAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTT
GGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTTAATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACC
AAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAAT
GGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCA
GAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGC
AATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGG
ATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACT
TTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTT
GGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCA
TTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTT
ACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAA
GCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGG
GATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTC
AGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATG
AAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCA
GATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000342666_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_5250nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCA
AGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAG
TACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTC
ATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGG
TTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCAC
CCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACA
GCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATAT
CAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCT
GAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAA
CCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACC
TGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATT
GATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATT
ATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTATTCCAAAGTTATAAAGCGTGTTGTATTGAAGAGTGAC

>In-frame_CAMK2D_ENST00000342666_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_11505nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATGATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTG
CTCTCTGAAGTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAA
GTGAAGGAGCTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAAT
GAAATCCTGAGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTT
ATTGTCAGTGATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAA
GAGATCAAAGGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAG
CAGCTGCAGACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCC
CCAGATGAGACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAA
CAAAAAGAGGAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTA
GCCCCTGAACCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTT
CAGAAGCGAGTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCAC
AGGCCACATCCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTT
TCCTCTTCCGCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACG
GAAAGACATTCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTG
TCATCTACAAAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAA
AAACACCCGCCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACA
GCTGGGAAAACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGG
ATTGAGGAAACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCAC
AAATCAGCAAAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAG
AAAACAGAGAATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATA
GGAGTTAAGAAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAA
AGCCACAGAGAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCC
ACTGACTTCTCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAG
CTTCACTTAGACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTA
CAAAGCGGTGCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCT
CAGATTAGTTCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAA
AGTGAGGAGCAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAA
GACATTACTGGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTA
GGCTCTCCCAAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTG
ACTGAGGAGGCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACA
GCCACCTCAGACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATT
AGAAGTCCCCAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCAC
AAAGACTCTCTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCC
CCTTGCCGTGACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTT
GCCAAAACAGAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAG
CAGACATCGCTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAA
ACCACAGATGTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACA
CCTGAAGAGGAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAA
GAACCCAAACAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGG
GAGGATGAAAGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTT
AAAAAAGGTGCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCC
AGTCCAGAAGAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCA
GAAGAAGAAAAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAAC
AGAGACACTGATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTA
CAGAGTCCGACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAG
GGAGAAGAGCTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGT
TTGGTATCTGAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTT
GAGAACTTACCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTA
GCTGAGAATGATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAA
ACCCAAACAGATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTG
GCAAGCTCCTCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTG
TGGGAAATGCAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTC
ATCATCACAAAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAA
CAAAAGATATTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACC
CCAACAAGTGAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCC
TATGCAGATGAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGG
GCTGATCCCCTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCA
GATGACGTGAGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCT
ACAAAAGAAGCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCC
TGCCCCGACTCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCT
CCCGATTCTTCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAA
ATTCCTGTAAGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTA
GATGAGGAAAATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGAT
CTAGACACCTCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGAT
GCTAGTTCTTTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAA
CTTGAGTTAGAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGC
AGGGGGGGCACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGAT
GAGGCTTCCAAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTA
TCAGTAATTGAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATT
GAGACTCTGATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTG
GCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATT
GAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTC
GTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGT
TATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAG
AAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACT
TTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTC
TCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAG
ACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAG
ACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAA
ACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGAT
ATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATC
ATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGG

>In-frame_CAMK2D_ENST00000342666_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_11406nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCC
CTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAA
TTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGAC
TTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTG
CCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTT
AAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACC
ATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGT
GGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCT
GCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTAT
ATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAG
ACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTC
GGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAG
GTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGC
AACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAAT
GATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTGCTCTCTGAA
GTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAAGTGAAGGAG
CTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAATGAAATCCTG
AGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTTATTGTCAGT
GATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAAGAGATCAAA
GGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAGCAGCTGCAG
ACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCCCCAGATGAG
ACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAACAAAAAGAG
GAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTAGCCCCTGAA
CCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTTCAGAAGCGA
GTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCACAGGCCACAT
CCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTTTCCTCTTCC
GCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACGGAAAGACAT
TCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTGTCATCTACA
AAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAAAAACACCCG
CCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACAGCTGGGAAA
ACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGGATTGAGGAA
ACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCACAAATCAGCA
AAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAGAAAACAGAG
AATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATAGGAGTTAAG
AAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAAAGCCACAGA
GAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCCACTGACTTC
TCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAGCTTCACTTA
GACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTACAAAGCGGT
GCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCTCAGATTAGT
TCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAAAGTGAGGAG
CAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAAGACATTACT
GGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTAGGCTCTCCC
AAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTGACTGAGGAG
GCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACAGCCACCTCA
GACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATTAGAAGTCCC
CAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCACAAAGACTCT
CTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCCCCTTGCCGT
GACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTTGCCAAAACA
GAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAGCAGACATCG
CTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAAACCACAGAT
GTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACACCTGAAGAG
GAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAAGAACCCAAA
CAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGGGAGGATGAA
AGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTTAAAAAAGGT
GCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCCAGTCCAGAA
GAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCAGAAGAAGAA
AAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAACAGAGACACT
GATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTACAGAGTCCG
ACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAGGGAGAAGAG
CTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGTTTGGTATCT
GAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTTGAGAACTTA
CCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTAGCTGAGAAT
GATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAAACCCAAACA
GATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTGGCAAGCTCC
TCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTGTGGGAAATG
CAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTCATCATCACA
AAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAACAAAAGATA
TTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACCCCAACAAGT
GAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCCTATGCAGAT
GAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGGGCTGATCCC
CTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCAGATGACGTG
AGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCTACAAAAGAA
GCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCCTGCCCCGAC
TCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCTCCCGATTCT
TCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAAATTCCTGTA
AGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTAGATGAGGAA
AATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGATCTAGACACC
TCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGATGCTAGTTCT
TTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAACTTGAGTTA
GAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGCAGGGGGGGC
ACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGATGAGGCTTCC
AAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTATCAGTAATT
GAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATTGAGACTCTG
ATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000515496_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_5286nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGCCGCGCCTCTCCATGTCTTGAACGTGACAACAGCAGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATG
CGAGGATGCAGACACAATGGGCTCCGAATCATTATTCCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGC
CACAGACTGGCAACAATGCCTCCAATGGTGGAAGGAGAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTT
GGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTTAATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACC
AAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAAT
GGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCA
GAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGC
AATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGG
ATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACT
TTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTT
GGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCA
TTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTT
ACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAA
GCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGG
GATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTC
AGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATG
AAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCA
GATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000515496_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_5250nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCA
AGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAG
TACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTC
ATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGG
TTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCAC
CCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACA
GCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATAT
CAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCT
GAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAA
CCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACC
TGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATT
GATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATT
ATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTATTCCAAAGTTATAAAGCGTGTTGTATTGAAGAGTGAC

>In-frame_CAMK2D_ENST00000515496_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_11505nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATGATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTG
CTCTCTGAAGTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAA
GTGAAGGAGCTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAAT
GAAATCCTGAGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTT
ATTGTCAGTGATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAA
GAGATCAAAGGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAG
CAGCTGCAGACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCC
CCAGATGAGACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAA
CAAAAAGAGGAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTA
GCCCCTGAACCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTT
CAGAAGCGAGTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCAC
AGGCCACATCCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTT
TCCTCTTCCGCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACG
GAAAGACATTCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTG
TCATCTACAAAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAA
AAACACCCGCCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACA
GCTGGGAAAACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGG
ATTGAGGAAACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCAC
AAATCAGCAAAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAG
AAAACAGAGAATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATA
GGAGTTAAGAAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAA
AGCCACAGAGAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCC
ACTGACTTCTCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAG
CTTCACTTAGACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTA
CAAAGCGGTGCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCT
CAGATTAGTTCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAA
AGTGAGGAGCAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAA
GACATTACTGGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTA
GGCTCTCCCAAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTG
ACTGAGGAGGCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACA
GCCACCTCAGACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATT
AGAAGTCCCCAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCAC
AAAGACTCTCTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCC
CCTTGCCGTGACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTT
GCCAAAACAGAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAG
CAGACATCGCTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAA
ACCACAGATGTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACA
CCTGAAGAGGAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAA
GAACCCAAACAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGG
GAGGATGAAAGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTT
AAAAAAGGTGCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCC
AGTCCAGAAGAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCA
GAAGAAGAAAAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAAC
AGAGACACTGATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTA
CAGAGTCCGACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAG
GGAGAAGAGCTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGT
TTGGTATCTGAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTT
GAGAACTTACCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTA
GCTGAGAATGATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAA
ACCCAAACAGATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTG
GCAAGCTCCTCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTG
TGGGAAATGCAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTC
ATCATCACAAAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAA
CAAAAGATATTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACC
CCAACAAGTGAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCC
TATGCAGATGAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGG
GCTGATCCCCTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCA
GATGACGTGAGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCT
ACAAAAGAAGCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCC
TGCCCCGACTCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCT
CCCGATTCTTCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAA
ATTCCTGTAAGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTA
GATGAGGAAAATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGAT
CTAGACACCTCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGAT
GCTAGTTCTTTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAA
CTTGAGTTAGAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGC
AGGGGGGGCACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGAT
GAGGCTTCCAAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTA
TCAGTAATTGAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATT
GAGACTCTGATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTG
GCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATT
GAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTC
GTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGT
TATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAG
AAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACT
TTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTC
TCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAG
ACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAG
ACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAA
ACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGAT
ATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATC
ATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGG

>In-frame_CAMK2D_ENST00000515496_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_11406nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCC
CTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAA
TTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGAC
TTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTG
CCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTT
AAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACC
ATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGT
GGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCT
GCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTAT
ATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAG
ACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTC
GGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAG
GTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGC
AACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAAT
GATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTGCTCTCTGAA
GTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAAGTGAAGGAG
CTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAATGAAATCCTG
AGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTTATTGTCAGT
GATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAAGAGATCAAA
GGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAGCAGCTGCAG
ACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCCCCAGATGAG
ACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAACAAAAAGAG
GAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTAGCCCCTGAA
CCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTTCAGAAGCGA
GTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCACAGGCCACAT
CCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTTTCCTCTTCC
GCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACGGAAAGACAT
TCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTGTCATCTACA
AAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAAAAACACCCG
CCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACAGCTGGGAAA
ACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGGATTGAGGAA
ACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCACAAATCAGCA
AAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAGAAAACAGAG
AATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATAGGAGTTAAG
AAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAAAGCCACAGA
GAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCCACTGACTTC
TCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAGCTTCACTTA
GACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTACAAAGCGGT
GCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCTCAGATTAGT
TCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAAAGTGAGGAG
CAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAAGACATTACT
GGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTAGGCTCTCCC
AAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTGACTGAGGAG
GCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACAGCCACCTCA
GACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATTAGAAGTCCC
CAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCACAAAGACTCT
CTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCCCCTTGCCGT
GACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTTGCCAAAACA
GAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAGCAGACATCG
CTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAAACCACAGAT
GTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACACCTGAAGAG
GAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAAGAACCCAAA
CAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGGGAGGATGAA
AGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTTAAAAAAGGT
GCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCCAGTCCAGAA
GAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCAGAAGAAGAA
AAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAACAGAGACACT
GATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTACAGAGTCCG
ACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAGGGAGAAGAG
CTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGTTTGGTATCT
GAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTTGAGAACTTA
CCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTAGCTGAGAAT
GATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAAACCCAAACA
GATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTGGCAAGCTCC
TCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTGTGGGAAATG
CAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTCATCATCACA
AAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAACAAAAGATA
TTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACCCCAACAAGT
GAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCCTATGCAGAT
GAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGGGCTGATCCC
CTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCAGATGACGTG
AGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCTACAAAAGAA
GCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCCTGCCCCGAC
TCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCTCCCGATTCT
TCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAAATTCCTGTA
AGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTAGATGAGGAA
AATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGATCTAGACACC
TCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGATGCTAGTTCT
TTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAACTTGAGTTA
GAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGCAGGGGGGGC
ACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGATGAGGCTTCC
AAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTATCAGTAATT
GAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATTGAGACTCTG
ATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000514328_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_5286nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGCCGCGCCTCTCCATGTCTTGAACGTGACAACAGCAGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATG
CGAGGATGCAGACACAATGGGCTCCGAATCATTATTCCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGC
CACAGACTGGCAACAATGCCTCCAATGGTGGAAGGAGAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTT
GGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTTAATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACC
AAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAAT
GGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCA
GAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGC
AATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGG
ATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACT
TTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTT
GGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCA
TTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTT
ACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAA
GCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGG
GATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTC
AGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATG
AAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCA
GATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000514328_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_5250nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCA
AGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAG
TACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTC
ATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGG
TTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCAC
CCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACA
GCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATAT
CAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCT
GAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAA
CCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACC
TGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATT
GATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATT
ATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTATTCCAAAGTTATAAAGCGTGTTGTATTGAAGAGTGAC

>In-frame_CAMK2D_ENST00000514328_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_11505nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATGATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTG
CTCTCTGAAGTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAA
GTGAAGGAGCTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAAT
GAAATCCTGAGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTT
ATTGTCAGTGATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAA
GAGATCAAAGGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAG
CAGCTGCAGACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCC
CCAGATGAGACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAA
CAAAAAGAGGAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTA
GCCCCTGAACCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTT
CAGAAGCGAGTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCAC
AGGCCACATCCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTT
TCCTCTTCCGCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACG
GAAAGACATTCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTG
TCATCTACAAAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAA
AAACACCCGCCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACA
GCTGGGAAAACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGG
ATTGAGGAAACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCAC
AAATCAGCAAAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAG
AAAACAGAGAATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATA
GGAGTTAAGAAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAA
AGCCACAGAGAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCC
ACTGACTTCTCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAG
CTTCACTTAGACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTA
CAAAGCGGTGCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCT
CAGATTAGTTCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAA
AGTGAGGAGCAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAA
GACATTACTGGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTA
GGCTCTCCCAAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTG
ACTGAGGAGGCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACA
GCCACCTCAGACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATT
AGAAGTCCCCAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCAC
AAAGACTCTCTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCC
CCTTGCCGTGACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTT
GCCAAAACAGAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAG
CAGACATCGCTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAA
ACCACAGATGTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACA
CCTGAAGAGGAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAA
GAACCCAAACAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGG
GAGGATGAAAGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTT
AAAAAAGGTGCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCC
AGTCCAGAAGAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCA
GAAGAAGAAAAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAAC
AGAGACACTGATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTA
CAGAGTCCGACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAG
GGAGAAGAGCTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGT
TTGGTATCTGAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTT
GAGAACTTACCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTA
GCTGAGAATGATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAA
ACCCAAACAGATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTG
GCAAGCTCCTCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTG
TGGGAAATGCAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTC
ATCATCACAAAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAA
CAAAAGATATTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACC
CCAACAAGTGAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCC
TATGCAGATGAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGG
GCTGATCCCCTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCA
GATGACGTGAGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCT
ACAAAAGAAGCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCC
TGCCCCGACTCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCT
CCCGATTCTTCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAA
ATTCCTGTAAGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTA
GATGAGGAAAATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGAT
CTAGACACCTCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGAT
GCTAGTTCTTTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAA
CTTGAGTTAGAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGC
AGGGGGGGCACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGAT
GAGGCTTCCAAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTA
TCAGTAATTGAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATT
GAGACTCTGATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTG
GCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATT
GAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTC
GTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGT
TATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAG
AAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACT
TTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTC
TCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAG
ACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAG
ACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAA
ACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGAT
ATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATC
ATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGG

>In-frame_CAMK2D_ENST00000514328_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_11406nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCC
CTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAA
TTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGAC
TTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTG
CCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTT
AAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACC
ATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGT
GGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCT
GCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTAT
ATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAG
ACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTC
GGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAG
GTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGC
AACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAAT
GATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTGCTCTCTGAA
GTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAAGTGAAGGAG
CTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAATGAAATCCTG
AGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTTATTGTCAGT
GATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAAGAGATCAAA
GGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAGCAGCTGCAG
ACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCCCCAGATGAG
ACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAACAAAAAGAG
GAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTAGCCCCTGAA
CCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTTCAGAAGCGA
GTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCACAGGCCACAT
CCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTTTCCTCTTCC
GCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACGGAAAGACAT
TCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTGTCATCTACA
AAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAAAAACACCCG
CCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACAGCTGGGAAA
ACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGGATTGAGGAA
ACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCACAAATCAGCA
AAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAGAAAACAGAG
AATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATAGGAGTTAAG
AAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAAAGCCACAGA
GAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCCACTGACTTC
TCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAGCTTCACTTA
GACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTACAAAGCGGT
GCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCTCAGATTAGT
TCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAAAGTGAGGAG
CAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAAGACATTACT
GGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTAGGCTCTCCC
AAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTGACTGAGGAG
GCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACAGCCACCTCA
GACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATTAGAAGTCCC
CAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCACAAAGACTCT
CTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCCCCTTGCCGT
GACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTTGCCAAAACA
GAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAGCAGACATCG
CTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAAACCACAGAT
GTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACACCTGAAGAG
GAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAAGAACCCAAA
CAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGGGAGGATGAA
AGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTTAAAAAAGGT
GCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCCAGTCCAGAA
GAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCAGAAGAAGAA
AAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAACAGAGACACT
GATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTACAGAGTCCG
ACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAGGGAGAAGAG
CTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGTTTGGTATCT
GAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTTGAGAACTTA
CCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTAGCTGAGAAT
GATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAAACCCAAACA
GATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTGGCAAGCTCC
TCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTGTGGGAAATG
CAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTCATCATCACA
AAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAACAAAAGATA
TTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACCCCAACAAGT
GAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCCTATGCAGAT
GAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGGGCTGATCCC
CTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCAGATGACGTG
AGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCTACAAAAGAA
GCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCCTGCCCCGAC
TCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCTCCCGATTCT
TCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAAATTCCTGTA
AGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTAGATGAGGAA
AATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGATCTAGACACC
TCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGATGCTAGTTCT
TTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAACTTGAGTTA
GAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGCAGGGGGGGC
ACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGATGAGGCTTCC
AAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTATCAGTAATT
GAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATTGAGACTCTG
ATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000394522_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_5286nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGCCGCGCCTCTCCATGTCTTGAACGTGACAACAGCAGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATG
CGAGGATGCAGACACAATGGGCTCCGAATCATTATTCCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGC
CACAGACTGGCAACAATGCCTCCAATGGTGGAAGGAGAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTT
GGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTTAATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACC
AAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAAT
GGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCA
GAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGC
AATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGG
ATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACT
TTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTT
GGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCA
TTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTT
ACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAA
GCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGG
GATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTC
AGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATG
AAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCA
GATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000394522_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_5250nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCA
AGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAG
TACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTC
ATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGG
TTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCAC
CCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACA
GCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATAT
CAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCT
GAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAA
CCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACC
TGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATT
GATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATT
ATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTATTCCAAAGTTATAAAGCGTGTTGTATTGAAGAGTGAC

>In-frame_CAMK2D_ENST00000394522_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_11505nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATGATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTG
CTCTCTGAAGTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAA
GTGAAGGAGCTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAAT
GAAATCCTGAGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTT
ATTGTCAGTGATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAA
GAGATCAAAGGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAG
CAGCTGCAGACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCC
CCAGATGAGACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAA
CAAAAAGAGGAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTA
GCCCCTGAACCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTT
CAGAAGCGAGTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCAC
AGGCCACATCCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTT
TCCTCTTCCGCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACG
GAAAGACATTCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTG
TCATCTACAAAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAA
AAACACCCGCCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACA
GCTGGGAAAACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGG
ATTGAGGAAACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCAC
AAATCAGCAAAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAG
AAAACAGAGAATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATA
GGAGTTAAGAAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAA
AGCCACAGAGAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCC
ACTGACTTCTCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAG
CTTCACTTAGACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTA
CAAAGCGGTGCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCT
CAGATTAGTTCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAA
AGTGAGGAGCAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAA
GACATTACTGGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTA
GGCTCTCCCAAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTG
ACTGAGGAGGCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACA
GCCACCTCAGACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATT
AGAAGTCCCCAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCAC
AAAGACTCTCTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCC
CCTTGCCGTGACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTT
GCCAAAACAGAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAG
CAGACATCGCTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAA
ACCACAGATGTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACA
CCTGAAGAGGAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAA
GAACCCAAACAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGG
GAGGATGAAAGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTT
AAAAAAGGTGCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCC
AGTCCAGAAGAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCA
GAAGAAGAAAAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAAC
AGAGACACTGATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTA
CAGAGTCCGACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAG
GGAGAAGAGCTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGT
TTGGTATCTGAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTT
GAGAACTTACCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTA
GCTGAGAATGATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAA
ACCCAAACAGATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTG
GCAAGCTCCTCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTG
TGGGAAATGCAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTC
ATCATCACAAAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAA
CAAAAGATATTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACC
CCAACAAGTGAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCC
TATGCAGATGAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGG
GCTGATCCCCTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCA
GATGACGTGAGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCT
ACAAAAGAAGCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCC
TGCCCCGACTCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCT
CCCGATTCTTCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAA
ATTCCTGTAAGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTA
GATGAGGAAAATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGAT
CTAGACACCTCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGAT
GCTAGTTCTTTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAA
CTTGAGTTAGAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGC
AGGGGGGGCACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGAT
GAGGCTTCCAAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTA
TCAGTAATTGAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATT
GAGACTCTGATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTG
GCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATT
GAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTC
GTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGT
TATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAG
AAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACT
TTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTC
TCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAG
ACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAG
ACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAA
ACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGAT
ATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATC
ATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGG

>In-frame_CAMK2D_ENST00000394522_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_11406nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCC
CTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAA
TTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGAC
TTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTG
CCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTT
AAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACC
ATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGT
GGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCT
GCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTAT
ATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAG
ACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTC
GGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAG
GTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGC
AACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAAT
GATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTGCTCTCTGAA
GTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAAGTGAAGGAG
CTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAATGAAATCCTG
AGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTTATTGTCAGT
GATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAAGAGATCAAA
GGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAGCAGCTGCAG
ACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCCCCAGATGAG
ACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAACAAAAAGAG
GAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTAGCCCCTGAA
CCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTTCAGAAGCGA
GTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCACAGGCCACAT
CCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTTTCCTCTTCC
GCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACGGAAAGACAT
TCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTGTCATCTACA
AAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAAAAACACCCG
CCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACAGCTGGGAAA
ACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGGATTGAGGAA
ACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCACAAATCAGCA
AAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAGAAAACAGAG
AATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATAGGAGTTAAG
AAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAAAGCCACAGA
GAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCCACTGACTTC
TCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAGCTTCACTTA
GACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTACAAAGCGGT
GCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCTCAGATTAGT
TCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAAAGTGAGGAG
CAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAAGACATTACT
GGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTAGGCTCTCCC
AAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTGACTGAGGAG
GCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACAGCCACCTCA
GACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATTAGAAGTCCC
CAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCACAAAGACTCT
CTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCCCCTTGCCGT
GACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTTGCCAAAACA
GAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAGCAGACATCG
CTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAAACCACAGAT
GTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACACCTGAAGAG
GAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAAGAACCCAAA
CAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGGGAGGATGAA
AGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTTAAAAAAGGT
GCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCCAGTCCAGAA
GAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCAGAAGAAGAA
AAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAACAGAGACACT
GATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTACAGAGTCCG
ACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAGGGAGAAGAG
CTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGTTTGGTATCT
GAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTTGAGAACTTA
CCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTAGCTGAGAAT
GATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAAACCCAAACA
GATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTGGCAAGCTCC
TCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTGTGGGAAATG
CAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTCATCATCACA
AAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAACAAAAGATA
TTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACCCCAACAAGT
GAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCCTATGCAGAT
GAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGGGCTGATCCC
CTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCAGATGACGTG
AGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCTACAAAAGAA
GCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCCTGCCCCGAC
TCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCTCCCGATTCT
TCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAAATTCCTGTA
AGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTAGATGAGGAA
AATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGATCTAGACACC
TCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGATGCTAGTTCT
TTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAACTTGAGTTA
GAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGCAGGGGGGGC
ACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGATGAGGCTTCC
AAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTATCAGTAATT
GAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATTGAGACTCTG
ATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000505990_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_5286nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGCATTCAGCAGATC
CTGGAGGCTGTGCTACACTGCCATCAGATGGGCGTGGTCCATCGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGCCGCGCCTCTCCATGTCTTGAACGTGACAACAGCAGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATG
CGAGGATGCAGACACAATGGGCTCCGAATCATTATTCCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGC
CACAGACTGGCAACAATGCCTCCAATGGTGGAAGGAGAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTT
GGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTTAATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACC
AAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAAT
GGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCA
GAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGC
AATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGG
ATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACT
TTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTT
GGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCA
TTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTT
ACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAA
GCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGG
GATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTC
AGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATG
AAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCA
GATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000505990_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_5250nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGCATTCAGCAGATC
CTGGAGGCTGTGCTACACTGCCATCAGATGGGCGTGGTCCATCGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCA
AGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAG
TACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTC
ATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGG
TTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCAC
CCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACA
GCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATAT
CAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCT
GAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAA
CCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACC
TGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATT
GATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATT
ATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTATTCCAAAGTTATAAAGCGTGTTGTATTGAAGAGTGAC

>In-frame_CAMK2D_ENST00000505990_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_11505nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGCATTCAGCAGATC
CTGGAGGCTGTGCTACACTGCCATCAGATGGGCGTGGTCCATCGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATGATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTG
CTCTCTGAAGTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAA
GTGAAGGAGCTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAAT
GAAATCCTGAGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTT
ATTGTCAGTGATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAA
GAGATCAAAGGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAG
CAGCTGCAGACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCC
CCAGATGAGACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAA
CAAAAAGAGGAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTA
GCCCCTGAACCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTT
CAGAAGCGAGTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCAC
AGGCCACATCCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTT
TCCTCTTCCGCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACG
GAAAGACATTCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTG
TCATCTACAAAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAA
AAACACCCGCCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACA
GCTGGGAAAACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGG
ATTGAGGAAACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCAC
AAATCAGCAAAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAG
AAAACAGAGAATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATA
GGAGTTAAGAAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAA
AGCCACAGAGAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCC
ACTGACTTCTCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAG
CTTCACTTAGACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTA
CAAAGCGGTGCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCT
CAGATTAGTTCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAA
AGTGAGGAGCAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAA
GACATTACTGGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTA
GGCTCTCCCAAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTG
ACTGAGGAGGCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACA
GCCACCTCAGACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATT
AGAAGTCCCCAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCAC
AAAGACTCTCTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCC
CCTTGCCGTGACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTT
GCCAAAACAGAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAG
CAGACATCGCTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAA
ACCACAGATGTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACA
CCTGAAGAGGAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAA
GAACCCAAACAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGG
GAGGATGAAAGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTT
AAAAAAGGTGCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCC
AGTCCAGAAGAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCA
GAAGAAGAAAAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAAC
AGAGACACTGATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTA
CAGAGTCCGACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAG
GGAGAAGAGCTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGT
TTGGTATCTGAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTT
GAGAACTTACCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTA
GCTGAGAATGATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAA
ACCCAAACAGATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTG
GCAAGCTCCTCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTG
TGGGAAATGCAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTC
ATCATCACAAAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAA
CAAAAGATATTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACC
CCAACAAGTGAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCC
TATGCAGATGAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGG
GCTGATCCCCTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCA
GATGACGTGAGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCT
ACAAAAGAAGCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCC
TGCCCCGACTCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCT
CCCGATTCTTCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAA
ATTCCTGTAAGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTA
GATGAGGAAAATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGAT
CTAGACACCTCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGAT
GCTAGTTCTTTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAA
CTTGAGTTAGAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGC
AGGGGGGGCACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGAT
GAGGCTTCCAAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTA
TCAGTAATTGAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATT
GAGACTCTGATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTG
GCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATT
GAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTC
GTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGT
TATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAG
AAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACT
TTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTC
TCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAG
ACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAG
ACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAA
ACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGAT
ATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATC
ATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGG

>In-frame_CAMK2D_ENST00000505990_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_11406nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGCATTCAGCAGATC
CTGGAGGCTGTGCTACACTGCCATCAGATGGGCGTGGTCCATCGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCC
CTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAA
TTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGAC
TTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTG
CCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTT
AAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACC
ATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGT
GGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCT
GCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTAT
ATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAG
ACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTC
GGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAG
GTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGC
AACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAAT
GATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTGCTCTCTGAA
GTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAAGTGAAGGAG
CTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAATGAAATCCTG
AGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTTATTGTCAGT
GATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAAGAGATCAAA
GGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAGCAGCTGCAG
ACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCCCCAGATGAG
ACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAACAAAAAGAG
GAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTAGCCCCTGAA
CCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTTCAGAAGCGA
GTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCACAGGCCACAT
CCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTTTCCTCTTCC
GCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACGGAAAGACAT
TCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTGTCATCTACA
AAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAAAAACACCCG
CCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACAGCTGGGAAA
ACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGGATTGAGGAA
ACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCACAAATCAGCA
AAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAGAAAACAGAG
AATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATAGGAGTTAAG
AAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAAAGCCACAGA
GAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCCACTGACTTC
TCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAGCTTCACTTA
GACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTACAAAGCGGT
GCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCTCAGATTAGT
TCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAAAGTGAGGAG
CAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAAGACATTACT
GGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTAGGCTCTCCC
AAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTGACTGAGGAG
GCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACAGCCACCTCA
GACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATTAGAAGTCCC
CAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCACAAAGACTCT
CTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCCCCTTGCCGT
GACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTTGCCAAAACA
GAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAGCAGACATCG
CTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAAACCACAGAT
GTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACACCTGAAGAG
GAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAAGAACCCAAA
CAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGGGAGGATGAA
AGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTTAAAAAAGGT
GCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCCAGTCCAGAA
GAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCAGAAGAAGAA
AAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAACAGAGACACT
GATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTACAGAGTCCG
ACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAGGGAGAAGAG
CTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGTTTGGTATCT
GAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTTGAGAACTTA
CCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTAGCTGAGAAT
GATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAAACCCAAACA
GATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTGGCAAGCTCC
TCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTGTGGGAAATG
CAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTCATCATCACA
AAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAACAAAAGATA
TTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACCCCAACAAGT
GAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCCTATGCAGAT
GAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGGGCTGATCCC
CTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCAGATGACGTG
AGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCTACAAAAGAA
GCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCCTGCCCCGAC
TCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCTCCCGATTCT
TCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAAATTCCTGTA
AGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTAGATGAGGAA
AATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGATCTAGACACC
TCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGATGCTAGTTCT
TTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAACTTGAGTTA
GAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGCAGGGGGGGC
ACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGATGAGGCTTCC
AAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTATCAGTAATT
GAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATTGAGACTCTG
ATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000379773_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_5286nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGCCGCGCCTCTCCATGTCTTGAACGTGACAACAGCAGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATG
CGAGGATGCAGACACAATGGGCTCCGAATCATTATTCCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGC
CACAGACTGGCAACAATGCCTCCAATGGTGGAAGGAGAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTT
GGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTTAATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACC
AAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAAT
GGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCA
GAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGC
AATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGG
ATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACT
TTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTT
GGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCA
TTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTT
ACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAA
GCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGG
GATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTC
AGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATG
AAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCA
GATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000379773_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_5250nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCA
AGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAG
TACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTC
ATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGG
TTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCAC
CCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACA
GCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATAT
CAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCT
GAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAA
CCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACC
TGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATT
GATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATT
ATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTATTCCAAAGTTATAAAGCGTGTTGTATTGAAGAGTGAC

>In-frame_CAMK2D_ENST00000379773_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_11505nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATGATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTG
CTCTCTGAAGTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAA
GTGAAGGAGCTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAAT
GAAATCCTGAGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTT
ATTGTCAGTGATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAA
GAGATCAAAGGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAG
CAGCTGCAGACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCC
CCAGATGAGACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAA
CAAAAAGAGGAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTA
GCCCCTGAACCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTT
CAGAAGCGAGTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCAC
AGGCCACATCCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTT
TCCTCTTCCGCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACG
GAAAGACATTCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTG
TCATCTACAAAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAA
AAACACCCGCCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACA
GCTGGGAAAACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGG
ATTGAGGAAACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCAC
AAATCAGCAAAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAG
AAAACAGAGAATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATA
GGAGTTAAGAAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAA
AGCCACAGAGAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCC
ACTGACTTCTCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAG
CTTCACTTAGACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTA
CAAAGCGGTGCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCT
CAGATTAGTTCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAA
AGTGAGGAGCAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAA
GACATTACTGGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTA
GGCTCTCCCAAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTG
ACTGAGGAGGCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACA
GCCACCTCAGACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATT
AGAAGTCCCCAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCAC
AAAGACTCTCTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCC
CCTTGCCGTGACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTT
GCCAAAACAGAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAG
CAGACATCGCTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAA
ACCACAGATGTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACA
CCTGAAGAGGAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAA
GAACCCAAACAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGG
GAGGATGAAAGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTT
AAAAAAGGTGCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCC
AGTCCAGAAGAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCA
GAAGAAGAAAAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAAC
AGAGACACTGATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTA
CAGAGTCCGACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAG
GGAGAAGAGCTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGT
TTGGTATCTGAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTT
GAGAACTTACCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTA
GCTGAGAATGATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAA
ACCCAAACAGATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTG
GCAAGCTCCTCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTG
TGGGAAATGCAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTC
ATCATCACAAAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAA
CAAAAGATATTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACC
CCAACAAGTGAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCC
TATGCAGATGAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGG
GCTGATCCCCTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCA
GATGACGTGAGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCT
ACAAAAGAAGCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCC
TGCCCCGACTCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCT
CCCGATTCTTCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAA
ATTCCTGTAAGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTA
GATGAGGAAAATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGAT
CTAGACACCTCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGAT
GCTAGTTCTTTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAA
CTTGAGTTAGAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGC
AGGGGGGGCACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGAT
GAGGCTTCCAAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTA
TCAGTAATTGAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATT
GAGACTCTGATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTG
GCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATT
GAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTC
GTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGT
TATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAG
AAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACT
TTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTC
TCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAG
ACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAG
ACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAA
ACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGAT
ATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATC
ATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGG

>In-frame_CAMK2D_ENST00000379773_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_11406nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCC
CTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAA
TTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGAC
TTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTG
CCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTT
AAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACC
ATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGT
GGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCT
GCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTAT
ATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAG
ACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTC
GGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAG
GTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGC
AACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAAT
GATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTGCTCTCTGAA
GTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAAGTGAAGGAG
CTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAATGAAATCCTG
AGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTTATTGTCAGT
GATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAAGAGATCAAA
GGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAGCAGCTGCAG
ACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCCCCAGATGAG
ACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAACAAAAAGAG
GAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTAGCCCCTGAA
CCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTTCAGAAGCGA
GTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCACAGGCCACAT
CCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTTTCCTCTTCC
GCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACGGAAAGACAT
TCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTGTCATCTACA
AAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAAAAACACCCG
CCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACAGCTGGGAAA
ACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGGATTGAGGAA
ACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCACAAATCAGCA
AAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAGAAAACAGAG
AATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATAGGAGTTAAG
AAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAAAGCCACAGA
GAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCCACTGACTTC
TCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAGCTTCACTTA
GACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTACAAAGCGGT
GCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCTCAGATTAGT
TCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAAAGTGAGGAG
CAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAAGACATTACT
GGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTAGGCTCTCCC
AAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTGACTGAGGAG
GCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACAGCCACCTCA
GACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATTAGAAGTCCC
CAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCACAAAGACTCT
CTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCCCCTTGCCGT
GACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTTGCCAAAACA
GAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAGCAGACATCG
CTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAAACCACAGAT
GTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACACCTGAAGAG
GAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAAGAACCCAAA
CAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGGGAGGATGAA
AGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTTAAAAAAGGT
GCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCCAGTCCAGAA
GAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCAGAAGAAGAA
AAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAACAGAGACACT
GATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTACAGAGTCCG
ACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAGGGAGAAGAG
CTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGTTTGGTATCT
GAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTTGAGAACTTA
CCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTAGCTGAGAAT
GATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAAACCCAAACA
GATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTGGCAAGCTCC
TCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTGTGGGAAATG
CAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTCATCATCACA
AAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAACAAAAGATA
TTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACCCCAACAAGT
GAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCCTATGCAGAT
GAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGGGCTGATCCC
CTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCAGATGACGTG
AGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCTACAAAAGAA
GCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCCTGCCCCGAC
TCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCTCCCGATTCT
TCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAAATTCCTGTA
AGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTAGATGAGGAA
AATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGATCTAGACACC
TCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGATGCTAGTTCT
TTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAACTTGAGTTA
GAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGCAGGGGGGGC
ACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGATGAGGCTTCC
AAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTATCAGTAATT
GAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATTGAGACTCTG
ATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000508738_chr4_114436225_-_ANK2_ENST00000506722_chr4_114179206_+_5286nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGCCGCGCCTCTCCATGTCTTGAACGTGACAACAGCAGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATG
CGAGGATGCAGACACAATGGGCTCCGAATCATTATTCCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGC
CACAGACTGGCAACAATGCCTCCAATGGTGGAAGGAGAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTT
GGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTTAATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACC
AAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAAT
GGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCA
GAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGC
AATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGG
ATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACT
TTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTT
GGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCA
TTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTT
ACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAA
GCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGG
GATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTC
AGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATG
AAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCA
GATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000508738_chr4_114436225_-_ANK2_ENST00000394537_chr4_114179206_+_5250nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCA
AGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAG
TACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTC
ATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGG
TTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCAC
CCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACA
GCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATAT
CAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCT
GAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAA
CCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACC
TGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATT
GATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATT
ATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTATTCCAAAGTTATAAAGCGTGTTGTATTGAAGAGTGAC

>In-frame_CAMK2D_ENST00000508738_chr4_114436225_-_ANK2_ENST00000357077_chr4_114179206_+_11505nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGTAAACTTCACCTGCCAACGGCTCCTCCCCCACTT
AATGAGGGAGAAAGTTTGGTCAGCCGCATTCTTCAGCTGGGGCCTCCTGGAACCAAATTCCTTGGGCCTGTGATCGTGGAGATCCCTCAC
TTTGCGGCCCTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACT
GAAGATGAATTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATC
ACCCGAGACTTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGC
ACAGTGGTGCCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGT
GAGCTGGTTAAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATT
ACCATGACCATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGC
ATAACAGGTGGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACA
AACGTGTCTGCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGC
GTACCTTATATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAA
GTGGATAAGACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTT
GATTGTTTCGGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTA
TTTGTCAAGGTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAA
GCTATTTGCAACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCA
GAAAAAAATGATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTG
CTCTCTGAAGTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAA
GTGAAGGAGCTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAAT
GAAATCCTGAGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTT
ATTGTCAGTGATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAA
GAGATCAAAGGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAG
CAGCTGCAGACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCC
CCAGATGAGACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAA
CAAAAAGAGGAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTA
GCCCCTGAACCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTT
CAGAAGCGAGTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCAC
AGGCCACATCCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTT
TCCTCTTCCGCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACG
GAAAGACATTCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTG
TCATCTACAAAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAA
AAACACCCGCCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACA
GCTGGGAAAACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGG
ATTGAGGAAACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCAC
AAATCAGCAAAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAG
AAAACAGAGAATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATA
GGAGTTAAGAAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAA
AGCCACAGAGAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCC
ACTGACTTCTCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAG
CTTCACTTAGACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTA
CAAAGCGGTGCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCT
CAGATTAGTTCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAA
AGTGAGGAGCAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAA
GACATTACTGGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTA
GGCTCTCCCAAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTG
ACTGAGGAGGCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACA
GCCACCTCAGACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATT
AGAAGTCCCCAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCAC
AAAGACTCTCTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCC
CCTTGCCGTGACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTT
GCCAAAACAGAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAG
CAGACATCGCTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAA
ACCACAGATGTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACA
CCTGAAGAGGAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAA
GAACCCAAACAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGG
GAGGATGAAAGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTT
AAAAAAGGTGCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCC
AGTCCAGAAGAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCA
GAAGAAGAAAAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAAC
AGAGACACTGATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTA
CAGAGTCCGACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAG
GGAGAAGAGCTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGT
TTGGTATCTGAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTT
GAGAACTTACCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTA
GCTGAGAATGATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAA
ACCCAAACAGATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTG
GCAAGCTCCTCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTG
TGGGAAATGCAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTC
ATCATCACAAAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAA
CAAAAGATATTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACC
CCAACAAGTGAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCC
TATGCAGATGAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGG
GCTGATCCCCTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCA
GATGACGTGAGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCT
ACAAAAGAAGCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCC
TGCCCCGACTCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCT
CCCGATTCTTCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAA
ATTCCTGTAAGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTA
GATGAGGAAAATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGAT
CTAGACACCTCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGAT
GCTAGTTCTTTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAA
CTTGAGTTAGAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGC
AGGGGGGGCACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGAT
GAGGCTTCCAAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTA
TCAGTAATTGAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATT
GAGACTCTGATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTG
GCTTATATTGCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATT
GAAAATCCCAACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTC
GTTGAATGTCTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGT
TATGCAGAAATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAG
AAAGAGGAGCAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACT
TTTCAGGATGGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTC
TCAGGGAAAATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAG
ACTCAGAAGGCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAG
ACCCCAACATCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAA
ACCAGCCTCGTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGAT
ATGCCTGAAATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATC
ATTAGGCGGTATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGG

>In-frame_CAMK2D_ENST00000508738_chr4_114436225_-_ANK2_ENST00000264366_chr4_114179206_+_11406nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTAATGGTTTTACTCCACTGCACATTGCCTGCAAGAAAAACCGCATCAAAGTCATGGAACTGCTGGTGAAATATGGGGCTTCA
ATCCAAGCTATAACAGAGTCTGGCCTCACACCAATACATGTGGCTGCCTTCATGGGCCACTTGAACATTGTCCTCCTTCTGCTGCAGAAC
GGAGCCTCTCCAGATGTCACTAACATTCGTGGTGAGACGGCACTACACATGGCAGCCCGAGCCGGGCAGGTGGAAGTGGTCCGATGCCTC
CTGAGAAATGGTGCCCTTGTTGATGCCAGAGCCAGGGAGGAACAGACACCTTTACATATTGCCTCCCGCCTGGGTAAGACAGAAATTGTC
CAGCTGCTTCTACAACATATGGCTCATCCAGATGCGGCCACTACAAATGGGTACACACCACTGCACATCTCTGCCCGGGAGGGCCAGGTG
GATGTGGCATCAGTCCTATTGGAAGCAGGAGCAGCCCACTCCTTAGCTACCAAGAAGGGTTTTACTCCCCTGCATGTAGCAGCCAAGTAT
GGAAGCCTGGATGTGGCAAAACTTCTCTTGCAACGCCGTGCTGCCGCAGATTCTGCAGGGAAGAACGGCCTTACCCCGCTCCATGTTGCT
GCTCATTATGACAACCAGAAGGTGGCGCTGCTGTTACTGGAGAAGGGTGCTTCCCCTCATGCCACTGCCAAGAATGGCTATACTCCGTTA
CATATTGCTGCCAAGAAGAATCAAATGCAGATAGCTTCCACACTCCTGAACTATGGAGCAGAGACAAACATTGTGACAAAGCAAGGAGTA
ACTCCACTCCATCTGGCCTCGCAGGAGGGGCACACAGATATGGTTACCTTGCTTCTGGATAAGGGAGCCAATATCCACATGTCAACTAAG
AGTGGACTCACATCCTTACACCTTGCAGCCCAGGAAGATAAAGTGAATGTTGCTGATATTCTCACCAAGCATGGAGCTGATCAGGATGCT
CATACAAAGCTTGGTTACACACCTTTAATTGTGGCCTGTCACTATGGAAATGTGAAAATGGTCAACTTTCTTCTGAAGCAGGGAGCAAAT
GTTAACGCAAAAACCAAGAACGGCTACACGCCTTTGCACCAGGCCGCTCAGCAGGGTCACACGCACATCATCAACGTCCTGCTCCAGCAT
GGGGCCAAGCCCAACGCCACCACTGCGAATGGCAACACTGCCTTGGCGATTGCTAAGCGTCTGGGCTACATCTCCGTGGTCGACACCCTG
AAGGTTGTGACTGAGGAGGTCACCACCACCACCACAACTATTACAGAAAAACACAAACTAAATGTACCTGAGACGATGACTGAGGTTCTT
GATGTTTCTGATGAAGAGGGTGATGACACAATGACTGGTGATGGGGGAGAATACCTTAGGCCTGAGGACCTAAAAGAACTGGGTGATGAC
TCACTACCCAGCAGTCAGTTCCTGGATGGTATGAATTACCTGCGATACAGCTTGGAGGGAGGACGATCTGACAGCCTTCGATCCTTCAGT
TCCGACAGGTCTCACACTCTGAGCCATGCCTCCTACCTGAGGGACAGTGCCGTGATGGATGACTCAGTTGTGATTCCCAGTCACCAGGTG
TCAACTCTAGCCAAGGAGGCAGAAAGGAATTCTTATCGCCTAAGCTGGGGCACTGAGAACTTAGACAACGTGGCTCTTTCTTCTAGTCCT
ATTCATTCAGGTTTCCTGGTTAGTTTTATGGTGGATGCCCGAGGTGGTGCTATGCGAGGATGCAGACACAATGGGCTCCGAATCATTATT
CCACCTCGGAAATGTACTGCTCCAACGCGAGTCACCTGCCGACTGGTCAAGCGCCACAGACTGGCAACAATGCCTCCAATGGTGGAAGGA
GAAGGCCTGGCCAGTCGCCTGATCGAAGTTGGACCTTCTGGTGCTCAGTTCCTTGGGCCTGTGATCGTGGAGATCCCTCACTTTGCGGCC
CTTCGAGGAAAGGAAAGGGAACTGGTGGTCCTGCGCAGTGAGAATGGGGACAGCTGGAAAGAGCATTTCTGTGACTACACTGAAGATGAA
TTGAATGAAATTCTTAACGGCATGGATGAAGTACTGGATAGCCCAGAAGACCTAGAAAAGAAACGAATCTGCCGCATCATCACCCGAGAC
TTCCCACAGTACTTTGCAGTGGTGTCTCGTATCAAACAGGACAGCAATCTGATTGGCCCAGAAGGAGGTGTACTGAGCAGCACAGTGGTG
CCCCAGGTGCAGGCCGTCTTCCCAGAGGGGGCACTCACCAAGCGGATCCGCGTAGGCCTGCAGGCTCAACCTATGCACAGTGAGCTGGTT
AAGAAGATCCTAGGCAACAAAGCTACCTTCAGCCCTATAGTCACTTTGGAACCTAGAAGAAGAAAATTCCACAAACCAATTACCATGACC
ATTCCTGTCCCCAAAGCTTCAAGTGATGTCATGTTGAATGGTTTTGGGGGAGATGCACCAACCTTAAGATTACTATGCAGCATAACAGGT
GGAACCACCCCTGCCCAGTGGGAAGATATTACAGGAACTACGCCATTAACATTTGTCAATGAATGTGTTTCCTTTACAACAAACGTGTCT
GCCAGGTTCTGGCTGATAGATTGTCGACAGATCCAGGAATCCGTTACTTTTGCATCACAAGTATACAGAGAAATTATCTGCGTACCTTAT
ATGGCCAAATTTGTAGTGTTTGCCAAATCACATGACCCCATTGAAGCCAGGTTGAGGTGTTTCTGCATGACTGATGATAAAGTGGATAAG
ACCCTTGAACAACAAGAAAATTTTGCTGAGGTGGCCAGAAGCAGGGATGTGGAGGTGTTAGAAGGAAAACCCATCTACGTTGATTGTTTC
GGCAACTTGGTACCATTAACTAAAAGTGGCCAGCATCATATATTCAGTTTTTTTGCCTTCAAAGAAAATAGACTTCCTCTATTTGTCAAG
GTACGCGATACGACTCAGGAACCTTGCGGACGACTATCATTTATGAAGGAGCCAAAATCCACGAGAGGCCTGGTGCATCAAGCTATTTGC
AACTTAAACATCACTTTGCCGATTTATACAAAGGAATCAGAGTCAGATCAAGAACAGGAGGAAGAGATCGATATGACATCAGAAAAAAAT
GATGAGACAGAATCTACAGAAACATCTGTCCTGAAAAGTCACCTGGTTAATGAAGTTCCTGTCCTAGCAAGTCCGGACTTGCTCTCTGAA
GTTTCTGAGATGAAACAAGATTTGATCAAAATGACCGCCATCTTGACCACAGATGTGTCTGATAAGGCAGGTTCTATTAAAGTGAAGGAG
CTGGTGAAGGCTGCTGAGGAAGAGCCAGGAGAGCCTTTTGAAATCGTTGAAAGAGTTAAAGAGGACTTAGAGAAAGTGAATGAAATCCTG
AGAAGTGGAACCTGCACAAGAGATGAAAGCAGTGTGCAGAGCTCTCGGTCTGAGAGAGGATTAGTTGAAGAGGAATGGGTTATTGTCAGT
GATGAGGAAATAGAAGAGGCTAGGCAAAAAGCACCTTTAGAAATCACTGAATATCCATGTGTAGAAGTTAGAATAGATAAAGAGATCAAA
GGAAAAGTAGAGAAAGACTCAACTGGGCTAGTGAACTACCTTACTGATGATCTGAATACCTGTGTGCCTCTTCCCAAAGAGCAGCTGCAG
ACAGTTCAAGATAAGGCAGGGAAGAAATGTGAGGCTCTGGCTGTTGGCAGGAGCTCTGAAAAGGAAGGGAAAGACATACCCCCAGATGAG
ACACAGAGTACACAGAAACAGCACAAACCAAGCTTGGGAATAAAGAAGCCAGTAAGAAGGAAATTAAAAGAAAAGCAGAAACAAAAAGAG
GAAGGTTTACAAGCTAGTGCAGAGAAAGCTGAACTTAAAAAAGGTAGTTCAGAAGAGTCATTAGGTGAAGACCCAGGTTTAGCCCCTGAA
CCCCTTCCCACTGTCAAGGCCACATCTCCTTTGATAGAAGAAACTCCCATTGGTTCCATAAAGGACAAAGTAAAGGCCCTTCAGAAGCGA
GTGGAAGATGAACAGAAAGGTCGAAGCAAGTTGCCCATCAGAGTCAAAGGCAAGGAGGACGTGCCAAAAAAGACCACCCACAGGCCACAT
CCAGCTGCGTCACCCTCTCTGAAGTCAGAGAGACATGCGCCAGGGTCTCCCTCCCCTAAAACAGAAAGACACTCTACTCTTTCCTCTTCC
GCAAAAACTGAAAGGCACCCTCCAGTATCACCATCAAGTAAAACTGAGAAACACTCACCTGTGTCACCCTCTGCAAAAACGGAAAGACAT
TCACCTGCGTCATCATCGAGTAAAACTGAGAAACACTCACCTGTATCACCCTCGACAAAAACTGAAAGGCACTCTCCTGTGTCATCTACA
AAAACAGAAAGACACCCACCTGTTTCGCCTTCAGGCAAAACAGACAAACGTCCACCTGTATCGCCCTCCGGGAGGACAGAAAAACACCCG
CCAGTATCGCCTGGGAGAACAGAAAAACGCTTGCCTGTTTCACCCTCCGGAAGAACGGACAAGCACCAACCTGTATCAACAGCTGGGAAA
ACTGAGAAGCACCTGCCTGTGTCACCTTCTGGCAAAACAGAAAAGCAACCACCTGTATCCCCCACTTCAAAAACAGAGAGGATTGAGGAA
ACCATGTCTGTTCGGGAGCTGATGAAGGCTTTCCAGTCAGGTCAGGACCCTTCTAAACATAAAACTGGACTCTTTGAGCACAAATCAGCA
AAACAAAAGCAGCCACAAGAGAAAGGTAAAGTTCGGGTAGAAAAAGAAAAGGGGCCGATACTAACCCAGAGAGAAGCTCAGAAAACAGAG
AATCAGACAATCAAACGAGGCCAGAGACTCCCGGTAACGGGCACAGCAGAATCCAAAAGAGGAGTTCGTGTTTCCTCCATAGGAGTTAAG
AAAGAAGATGCAGCTGGAGGAAAGGAGAAAGTTCTCAGCCACAAAATACCTGAACCTGTTCAGTCAGTGCCTGAAGAAGAAAGCCACAGA
GAGAGCGAAGTGCCCAAAGAAAAGATGGCTGATGAGCAGGGAGACATGGATCTACAGATCAGCCCAGATAGGAAAACCTCCACTGACTTC
TCTGAGGTCATTAAGCAAGAGTTGGAAGACAATGACAAATACCAACAATTCCGCCTGAGTGAGGAGACAGAAAAGGCACAGCTTCACTTA
GACCAAGTACTCACTAGTCCTTTCAACACAACATTTCCACTCGACTACATGAAAGATGAGTTCCTTCCAGCTCTGTCTTTACAAAGCGGT
GCTTTAGATGGCAGTTCTGAAAGCCTAAAGAATGAGGGGGTAGCCGGCTCTCCGTGTGGCAGCCTGATGGAGGGGACCCCTCAGATTAGT
TCAGAAGAAAGCTATAAGCATGAAGGCCTAGCAGAGACCCCTGAGACGAGCCCAGAAAGCCTTTCTTTCTCACCAAAGAAAAGTGAGGAG
CAAACTGGGGAAACAAAGGAAAGCACCAAGACAGAAACCACCACAGAAATTCGTTCAGAAAAAGAGCATCCCACGACCAAAGACATTACT
GGTGGCTCTGAAGAGCGAGGTGCCACAGTCACTGAGGACTCAGAGACCTCTACTGAGAGTTTTCAGAAAGAGGCCACTCTAGGCTCTCCC
AAAGACACAAGCCCTAAAAGACAAGATGATTGCACAGGCAGCTGTAGTGTAGCATTAGCTAAAGAGACACCTACAGGACTGACTGAGGAG
GCAGCCTGTGATGAAGGTCAACGTACCTTTGGTAGTTCAGCCCACAAGACACAAACTGATAGTGAGGTTCAAGAATCCACAGCCACCTCA
GACGAGACAAAGGCCTTGCCGCTGCCTGAGGCTTCTGTAAAGACAGATACAGGAACTGAATCAAAACCTCAGGGAGTCATTAGAAGTCCC
CAAGGGTTAGAACTTGCACTCCCTAGCCGAGATAGCGAAGTCCTCAGCGCTGTGGCTGATGACTCATTAGCAGTGAGCCACAAAGACTCT
CTGGAAGCCAGCCCTGTGCTAGAAGATAACTCTTCACACAAAACCCCTGATTCTCTGGAGCCAAGTCCTCTGAAAGAATCCCCTTGCCGT
GACTCTCTGGAAAGCAGCCCTGTTGAACCAAAGATGAAGGCTGGAATTTTTCCAAGTCACTTTCCTCTTCCTGCAGCTGTTGCCAAAACA
GAACTCTTGACGGAAGTGGCCTCTGTGCGGTCCCGGCTACTCCGAGACCCTGATGGCAGTGCTGAGGATGACAGTCTTGAGCAGACATCG
CTCATGGAGAGCTCAGGGAAGAGCCCCCTTTCTCCTGACACCCCCAGCTCTGAAGAAGTCAGCTATGAGGTTACACCCAAAACCACAGAT
GTAAGTACACCAAAACCAGCTGTGATTCATGAATGTGCAGAGGAGGATGATTCAGAAAACGGGGAGAAAAAGAGGTTCACACCTGAAGAG
GAGATGTTTAAAATGGTAACCAAAATCAAAATGTTTGATGAACTTGAACAAGAAGCAAAGCAGAAAAGGGACTACAAAAAAGAACCCAAA
CAAGAAGAATCTTCTTCATCTTCTGACCCAGATGCTGACTGTTCAGTAGATGTGGATGAACCAAAACATACAGGCAGTGGGGAGGATGAA
AGTGGTGTCCCTGTGTTAGTAACTTCGGAGAGCAGGAAGGTGTCTTCCTCCTCAGAAAGTGAACCTGAGTTGGCACAGCTTAAAAAAGGT
GCTGACTCAGGCCTTTTACCAGAACCAGTGATTCGAGTACAACCTCCTTCTCCACTTCCATCAAGCATGGACTCCAATTCCAGTCCAGAA
GAAGTACAATTCCAGCCTGTCGTTTCCAAACAATATACTTTCAAGATGAATGAAGATACTCAGGAAGAGCCAGGCAAATCAGAAGAAGAA
AAAGATTCTGAATCCCATTTAGCTGAAGACCGTCATGCTGTTTCCACTGAGGCTGAAGACAGGTCTTATGATAAGCTAAACAGAGACACT
GATCAGCCAAAAATCTGTGATGGCCATGGATGTGAGGCCATGAGTCCTAGCAGCTCAGCTGCTCCTGTCTCTTCAGGTCTACAGAGTCCG
ACTGGTGATGATGTTGATGAACAGCCAGTCATCTATAAAGAATCATTAGCTCTCCAAGGCACTCATGAAAAAGACACAGAGGGAGAAGAG
CTTGATGTTTCTAGAGCAGAATCTCCACAAGCAGATTGCCCCAGTGAAAGCTTTTCATCTTCATCCTCTTTGCCTCATTGTTTGGTATCT
GAAGGAAAAGAATTAGATGAAGACATATCTGCCACATCTTCTATTCAAAAAACAGAGGTCACAAAAACTGATGAAACATTTGAGAACTTA
CCAAAGGACTGCCCCTCTCAAGACTCATCCATTACTACTCAAACAGATAGATTTTCCATGGATGTTCCCGTGTCTGACCTAGCTGAGAAT
GATGAAATCTATGATCCACAAATCACTAGCCCTTATGAAAATGTCCCTTCCCAATCTTTTTTCTCTAGTGAAGAAAGCAAAACCCAAACA
GATGCAAATCACACCACAAGTTTTCACTCTTCTGAAGTGTATTCTGTTACCATCACATCCCCTGTTGAAGACGTTGTAGTGGCAAGCTCC
TCTAGTGGAACTGTTTTAAGCAAAGAATCTAATTTTGAGGGCCAGGACATAAAAATGGAATCCCAACAGGAAAGTACCTTGTGGGAAATG
CAATCAGACAGTGTCTCTTCATCTTTCGAGCCTACTATGTCCGCTACAACAACAGTTGTTGGTGAACAAATAAGCAAAGTCATCATCACA
AAAACTGATGTGGATTCTGATTCTTGGAGTGAAATTCGGGAAGACGATGAAGCCTTTGAGGCTCGTGTGAAAGAGGAAGAACAAAAGATA
TTTGGTTTGATGGTAGACAGACAATCACAGGGTACCACCCCTGACACCACTCCTGCTAGGACCCCAACTGAAGAGGGGACCCCAACAAGT
GAGCAAAACCCATTTCTGTTTCAGGAAGGAAAATTGTTTGAAATGACCCGAAGTGGTGCCATTGATATGACCAAAAGGTCCTATGCAGAT
GAAAGTTTTCACTTTTTCCAAATTGGTCAAGAATCCAGGGAAGAGACTCTCTCTGAAGATGTGAAAGAAGGGGCTACTGGGGCTGATCCC
CTACCGCTGGAGACATCAGCTGAATCACTAGCACTTTCAGAATCAAAAGAAACAGTGGATGATGAGGCAGACTTACTTCCAGATGACGTG
AGTGAGGAAGTAGAGGAAATACCTGCTTCGGATGCTCAACTTAACTCCCAAATGGGGATTTCAGCCTCCACTGAAACACCTACAAAAGAA
GCTGTTAGTGTAGGGACCAAGGACCTCCCCACCGTGCAAACGGGTGATATACCTCCTCTCTCTGGTGTAAAGCAGATATCCTGCCCCGAC
TCTTCTGAACCAGCTGTACAAGTCCAGTTAGATTTTTCCACACTCACCAGGTCTGTTTATTCAGATAGGGGTGATGATTCTCCCGATTCT
TCCCCAGAAGAACAGAAATCAGTAATCGAGATTCCTACTGCACCCATGGAGAATGTGCCTTTTACTGAAAGCAAATCCAAAATTCCTGTA
AGGACTATGCCCACTTCCACCCCAGCACCTCCATCTGCAGAGTATGAGAGTTCAGTTTCTGAAGATTTTCTATCCAGTGTAGATGAGGAA
AATAAGGCGGATGAAGCAAAACCAAAGTCCAAACTCCCTGTCAAAGTACCCCTCCAAAGAGTTGAACAGCAGCTCTCAGATCTAGACACC
TCTGTCCAGAAGACAGTGGCTCCTCAGGGACAGGACATGGCAAGCATCGCACCAGATAATAGAAGCAAATCTGAATCTGATGCTAGTTCT
TTGGATTCAAAGACCAAATGCCCAGTAAAAACCCGAAGTTACACTGAGACAGAAACAGAGAGCAGAGAGAGGGCCGAGGAACTTGAGTTA
GAATCAGAAGAAGGGGCCACAAGACCAAAGATACTTACATCCCGATTGCCAGTTAAGAGCAGAAGCACTACATCTTCCTGCAGGGGGGGC
ACGAGCCCCACAAAAGAAAGTAAGGAGCATTTCTTTGACCTTTACAGAAATTCCATAGAATTCTTTGAGGAGATTAGTGATGAGGCTTCC
AAATTAGTGGATAGGCTGACACAGTCAGAGAGGGAGCAGGAAATAGTTTCAGACGATGAAAGTAGTAGTGCCCTGGAAGTATCAGTAATT
GAAAATCTGCCACCTGTTGAGACCGAGCACTCAGTTCCTGAGGACATCTTTGACACAAGGCCCATTTGGGATGAGTCTATTGAGACTCTG
ATTGAACGCATCCCTGATGAAAATGGCCATGACCATGCTGAAGATCCACAGGATGAGCAGGAACGGATCGAGGAAAGGCTGGCTTATATT
GCTGATCACCTTGGCTTCAGCTGGACAGAATTAGCAAGAGAACTGGATTTCACTGAGGAGCAAATTCATCAAATTCGAATTGAAAATCCC
AACTCTCTTCAAGACCAGAGTCATGCACTGTTGAAGTACTGGCTAGAGAGGGATGGGAAACATGCTACAGATACCAACCTCGTTGAATGT
CTCACCAAGATCAACCGAATGGATATTGTTCATCTCATGGAGACCAACACAGAACCTCTCCAGGAGCGCATCAGTCATAGTTATGCAGAA
ATTGAACAGACCATTACACTGGATCATAGTGAAGGGTTCTCGGTACTTCAAGAGGAGTTATGCACTGCACAGCACAAGCAGAAAGAGGAG
CAAGCTGTTTCTAAAGAAAGTGAGACCTGCGATCACCCTCCTATCGTCTCAGAGGAAGACATTTCTGTTGGTTATTCCACTTTTCAGGAT
GGCGTCCCCAAAACTGAGGGGGACAGCTCAGCAACAGCACTCTTTCCCCAAACTCACAAGGAGCAAGTTCAACAGGATTTCTCAGGGAAA
ATGCAAGACCTGCCTGAAGAGTCATCTCTGGAATATCAGCAGGAATATTTTGTGACAACTCCAGGAACAGAAACATCAGAGACTCAGAAG
GCTATGATAGTACCCAGCTCTCCCAGCAAGACACCTGAGGAAGTTAGCACCCCTGCAGAGGAGGAGAAGCTGTACCTCCAGACCCCAACA
TCCAGCGAGCGGGGAGGCTCTCCCATCATACAAGAACCCGAAGAGCCCTCAGAGCACAGAGAGGAGAGCTCTCCGCGGAAAACCAGCCTC
GTAATAGTGGAGTCTGCCGATAACCAGCCTGAGACCTGTGAAAGACTCGATGAAGATGCAGCTTTTGAAAAGGGAGACGATATGCCTGAA
ATACCCCCAGAAACAGTCACAGAAGAAGAATACATTGATGAGCATGGACACACCGTGGTAAAGAAGGTTACTAGGAAAATCATTAGGCGG
TATGTATCCTCTGAAGGCACAGAGAAAGAAGAGATTATGGTGCAGGGAATGCCACAGGAACCTGTCAACATCGAGGAAGGGGATGGCTAT

>In-frame_CAMK2D_ENST00000394524_chr4_114430794_-_ANK2_ENST00000264366_chr4_114302613_+_999nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTCAACGTTCTACTGTTGCTTCCATGATGCACAGACAGGAGACTGTAGACTGCTTGAAGAAATTTAATGCTAGAAGAAAACTA
AAGGGTGCCATCTTGACAACTATGCTGGCTACAAGGAATTTCTCAGCAGCCAAGAGTTTGTTGAAGAAACCAGATGGAGTAAAGGACAAC

>In-frame_CAMK2D_ENST00000394524_chr4_114430794_-_ANK2_ENST00000510275_chr4_114302613_+_999nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTCAACGTTCTACTGTTGCTTCCATGATGCACAGACAGGAGACTGTAGACTGCTTGAAGAAATTTAATGCTAGAAGAAAACTA
AAGGGTGCCATCTTGACAACTATGCTGGCTACAAGGAATTTCTCAGCAGCCAAGAGTTTGTTGAAGAAACCAGATGGAGTAAAGGACAAC

>In-frame_CAMK2D_ENST00000454265_chr4_114430794_-_ANK2_ENST00000506722_chr4_114302613_+_999nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTCAACGTTCTACTGTTGCTTCCATGATGCACAGACAGGAGACTGTAGACTGCTTGAAGAAATTTAATGCTAGAAGAAAACTA
AAGGGTGCCATCTTGACAACTATGCTGGCTACAAGGAATTTCTCAGCAGCCAAGAGTTTGTTGAAGAAACCAGATGGAGTAAAGGACAAC

>In-frame_CAMK2D_ENST00000454265_chr4_114430794_-_ANK2_ENST00000394537_chr4_114302613_+_999nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTCAACGTTCTACTGTTGCTTCCATGATGCACAGACAGGAGACTGTAGACTGCTTGAAGAAATTTAATGCTAGAAGAAAACTA
AAGGGTGCCATCTTGACAACTATGCTGGCTACAAGGAATTTCTCAGCAGCCAAGAGTTTGTTGAAGAAACCAGATGGAGTAAAGGACAAC

>In-frame_CAMK2D_ENST00000454265_chr4_114430794_-_ANK2_ENST00000509550_chr4_114302613_+_999nt
ATGGCTTCGACCACAACCTGCACCAGGTTCACGGACGAGTATCAGCTTTTCGAGGAGCTTGGAAAGGGGGCATTCTCAGTGGTGAGAAGA
TGTATGAAAATTCCTACTGGACAAGAATATGCTGCCAAAATTATCAACACCAAAAAGCTTTCTGCTAGGGATCATCAGAAACTAGAAAGA
GAAGCTAGAATCTGCCGTCTTTTGAAGCACCCTAATATTGTGCGACTTCATGATAGCATATCAGAAGAGGGCTTTCACTACTTGGTGTTT
GATTTAGTTACTGGAGGTGAACTGTTTGAAGACATAGTGGCAAGAGAATACTACAGTGAAGCTGATGCCAGTCATTGTATACAGCAGATT
CTAGAAAGTGTTAATCATTGTCACCTAAATGGCATAGTTCACAGGGACCTGAAGCCTGAGAATTTGCTTTTAGCTAGCAAATCCAAGGGA
GCAGCTGTGAAATTGGCAGACTTTGGCTTAGCCATAGAAGTTCAAGGGGACCAGCAGGCGTGGTTTGGTTTTGCTGGCACACCTGGATAT
CTTTCTCCAGAAGTTTTACGTAAAGATCCTTATGGAAAGCCAGTGGATATGTGGGCATGTGGTGTCATTCTCTATATTCTACTTGTGGGG
TATCCACCCTTCTGGGATGAAGACCAACACAGACTCTATCAGCAGATCAAGGCTGGAGCTTATGATTTTCCATCACCAGAATGGGACACG
GTGACTCCTGAAGCCAAAGACCTCATCAATAAAATGCTTACTATCAACCCTGCCAAACGCATCACAGCCTCAGAGGCACTGAAGCACCCA
TGGATCTGTCAACGTTCTACTGTTGCTTCCATGATGCACAGACAGGAGACTGTAGACTGCTTGAAGAAATTTAATGCTAGAAGAAAACTA
AAGGGTGCCATCTTGACAACTATGCTGGCTACAAGGAATTTCTCAGCAGCCAAGAGTTTGTTGAAGAAACCAGATGGAGTAAAGGACAAC

>In-frame_CAMK2D_ENST00000394526_chr4_114430794_-_ANK2_ENST00000506722_chr4_114302613_+_999nt
ATGGCTTCGACCACAACCTGCACCA