FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 5284

FusionGeneSummary for CALCOCO2_WRAP53

check button Fusion gene summary
Fusion gene informationFusion gene name: CALCOCO2_WRAP53
Fusion gene ID: 5284
HgeneTgene
Gene symbol

CALCOCO2

WRAP53

Gene ID

10241

55135

Gene namecalcium binding and coiled-coil domain 2WD repeat containing antisense to TP53
SynonymsNDP52DKCB3|TCAB1|WDR79
Cytomap

17q21.32

17p13.1

Type of geneprotein-codingprotein-coding
Descriptioncalcium-binding and coiled-coil domain-containing protein 2antigen nuclear dot 52 kDa proteinnuclear domain 10 protein 52nuclear domain 10 protein NDP52nuclear dot protein 52telomerase Cajal body protein 1WD repeat-containing protein 79WD repeat-containing protein WRAP53WD40 protein Wrap53WD40 repeat-containing protein antisense to TP53WD40 repeat-containing protein encoding RNA antisense to p53
Modification date2018052220180519
UniProtAcc

Q13137

Q9BUR4

Ensembl transtripts involved in fusion geneENST00000258947, ENST00000509507, 
ENST00000448105, ENST00000416445, 
ENST00000508679, ENST00000510997, 
ENST00000431639, ENST00000316024, 
ENST00000457584, ENST00000396463, 
ENST00000534050, 
Fusion gene scores* DoF score4 X 3 X 3=369 X 4 X 5=180
# samples 49
** MAII scorelog2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(9/180*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CALCOCO2 [Title/Abstract] AND WRAP53 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCALCOCO2

GO:0034341

response to interferon-gamma

9230084

TgeneWRAP53

GO:0007004

telomere maintenance via telomerase

23685356

TgeneWRAP53

GO:0051973

positive regulation of telomerase activity

19179534|23685356


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-WK-A8XS-01ACALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000258947ENST00000431639CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000258947ENST00000316024CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000258947ENST00000457584CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000258947ENST00000396463CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000258947ENST00000534050CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000509507ENST00000431639CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000509507ENST00000316024CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000509507ENST00000457584CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000509507ENST00000396463CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000509507ENST00000534050CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000448105ENST00000431639CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000448105ENST00000316024CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000448105ENST00000457584CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000448105ENST00000396463CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000448105ENST00000534050CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000416445ENST00000431639CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000416445ENST00000316024CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000416445ENST00000457584CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000416445ENST00000396463CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000416445ENST00000534050CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000508679ENST00000431639CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000508679ENST00000316024CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000508679ENST00000457584CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000508679ENST00000396463CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
In-frameENST00000508679ENST00000534050CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
intron-3CDSENST00000510997ENST00000431639CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
intron-3CDSENST00000510997ENST00000316024CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
intron-3CDSENST00000510997ENST00000457584CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
intron-3CDSENST00000510997ENST00000396463CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+
intron-3CDSENST00000510997ENST00000534050CALCOCO2chr17

46933549

+WRAP53chr17

7604059

+

Top

FusionProtFeatures for CALCOCO2_WRAP53


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CALCOCO2

Q13137

WRAP53

Q9BUR4

Essential component of the telomerase holoenzymecomplex, a ribonucleoprotein complex essential for the replicationof chromosome termini that elongates telomeres in most eukaryotes.In the telomerase holoenzyme complex, it controls telomeraselocalization to Cajal body. Required for delivery of TERC totelomeres during S phase and for telomerase activity. Binds smallCajal body RNAs (scaRNAs). The mRNA encoding this protein plays acritical role in the regulation of p53 expression at the post-transcriptional level; it is involved both in maintaining basalp53 mRNA levels and in p53 induction upon DNA damage.{ECO:0000269|PubMed:19179534, ECO:0000269|PubMed:19250907}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000448105+1114137_349360471Coiled coilOntology_term=ECO:0000255
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000509507+1114137_349357468Coiled coilOntology_term=ECO:0000255
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000258947+1013133_136336447MotifCLIR
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000416445+912133_136294405MotifCLIR
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000448105+1114133_136360471MotifCLIR
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000508679+912133_136264375MotifCLIR
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000509507+1114133_136357468MotifCLIR
TgeneWRAP53chr17:46933549chr17:7604059ENST00000316024+210222_267214549RepeatNote=WD 2
TgeneWRAP53chr17:46933549chr17:7604059ENST00000316024+210272_313214549RepeatNote=WD 3
TgeneWRAP53chr17:46933549chr17:7604059ENST00000316024+210323_364214549RepeatNote=WD 4
TgeneWRAP53chr17:46933549chr17:7604059ENST00000316024+210365_405214549RepeatNote=WD 5
TgeneWRAP53chr17:46933549chr17:7604059ENST00000316024+210411_450214549RepeatNote=WD 6
TgeneWRAP53chr17:46933549chr17:7604059ENST00000396463+311222_267214549RepeatNote=WD 2
TgeneWRAP53chr17:46933549chr17:7604059ENST00000396463+311272_313214549RepeatNote=WD 3
TgeneWRAP53chr17:46933549chr17:7604059ENST00000396463+311323_364214549RepeatNote=WD 4
TgeneWRAP53chr17:46933549chr17:7604059ENST00000396463+311365_405214549RepeatNote=WD 5
TgeneWRAP53chr17:46933549chr17:7604059ENST00000396463+311411_450214549RepeatNote=WD 6
TgeneWRAP53chr17:46933549chr17:7604059ENST00000431639+311222_267214549RepeatNote=WD 2
TgeneWRAP53chr17:46933549chr17:7604059ENST00000431639+311272_313214549RepeatNote=WD 3
TgeneWRAP53chr17:46933549chr17:7604059ENST00000431639+311323_364214549RepeatNote=WD 4
TgeneWRAP53chr17:46933549chr17:7604059ENST00000431639+311365_405214549RepeatNote=WD 5
TgeneWRAP53chr17:46933549chr17:7604059ENST00000431639+311411_450214549RepeatNote=WD 6
TgeneWRAP53chr17:46933549chr17:7604059ENST00000457584+311222_267214549RepeatNote=WD 2
TgeneWRAP53chr17:46933549chr17:7604059ENST00000457584+311272_313214549RepeatNote=WD 3
TgeneWRAP53chr17:46933549chr17:7604059ENST00000457584+311323_364214549RepeatNote=WD 4
TgeneWRAP53chr17:46933549chr17:7604059ENST00000457584+311365_405214549RepeatNote=WD 5
TgeneWRAP53chr17:46933549chr17:7604059ENST00000457584+311411_450214549RepeatNote=WD 6

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000258947+1013137_349336447Coiled coilOntology_term=ECO:0000255
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000416445+912137_349294405Coiled coilOntology_term=ECO:0000255
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000508679+912137_349264375Coiled coilOntology_term=ECO:0000255
TgeneWRAP53chr17:46933549chr17:7604059ENST00000316024+2108_57214549Compositional biasNote=Pro-rich
TgeneWRAP53chr17:46933549chr17:7604059ENST00000396463+3118_57214549Compositional biasNote=Pro-rich
TgeneWRAP53chr17:46933549chr17:7604059ENST00000431639+3118_57214549Compositional biasNote=Pro-rich
TgeneWRAP53chr17:46933549chr17:7604059ENST00000457584+3118_57214549Compositional biasNote=Pro-rich
TgeneWRAP53chr17:46933549chr17:7604059ENST00000316024+210167_206214549RepeatNote=WD 1
TgeneWRAP53chr17:46933549chr17:7604059ENST00000396463+311167_206214549RepeatNote=WD 1
TgeneWRAP53chr17:46933549chr17:7604059ENST00000431639+311167_206214549RepeatNote=WD 1
TgeneWRAP53chr17:46933549chr17:7604059ENST00000457584+311167_206214549RepeatNote=WD 1


Top

FusionGeneSequence for CALCOCO2_WRAP53


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CALCOCO2_ENST00000258947_chr17_46933549_+_WRAP53_ENST00000431639_chr17_7604059_+_671aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRVGWKTTRETYTFMWVTLPIDLNNKSAKQQE
VQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKK
QEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFL
SLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDVPVLRMVEGDTITDYCWTSLMSSA
QPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGII
SCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIY
FDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTESGDEGEELGLPLLSTRHV

>In-frame_CALCOCO2_ENST00000258947_chr17_46933549_+_WRAP53_ENST00000316024_chr17_7604059_+_671aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRVGWKTTRETYTFMWVTLPIDLNNKSAKQQE
VQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKK
QEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFL
SLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDVPVLRMVEGDTITDYCWTSLMSSA
QPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGII
SCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIY
FDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTESGDEGEELGLPLLSTRHV

>In-frame_CALCOCO2_ENST00000258947_chr17_46933549_+_WRAP53_ENST00000457584_chr17_7604059_+_671aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRVGWKTTRETYTFMWVTLPIDLNNKSAKQQE
VQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKK
QEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFL
SLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDVPVLRMVEGDTITDYCWTSLMSSA
QPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGII
SCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIY
FDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTESGDEGEELGLPLLSTRHV

>In-frame_CALCOCO2_ENST00000258947_chr17_46933549_+_WRAP53_ENST00000396463_chr17_7604059_+_671aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRVGWKTTRETYTFMWVTLPIDLNNKSAKQQE
VQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKK
QEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFL
SLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDVPVLRMVEGDTITDYCWTSLMSSA
QPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGII
SCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIY
FDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTESGDEGEELGLPLLSTRHV

>In-frame_CALCOCO2_ENST00000258947_chr17_46933549_+_WRAP53_ENST00000534050_chr17_7604059_+_671aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRVGWKTTRETYTFMWVTLPIDLNNKSAKQQE
VQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKK
QEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFL
SLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDVPVLRMVEGDTITDYCWTSLMSSA
QPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGII
SCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIY
FDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTESGDEGEELGLPLLSTRHV

>In-frame_CALCOCO2_ENST00000509507_chr17_46933549_+_WRAP53_ENST00000431639_chr17_7604059_+_692aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRCSLNQTIQLLITPDTGSIWHQVGWKTTRET
YTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQEL
KDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQ
GDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDVPV
LRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFSTAR
PGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDL
RQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPE

>In-frame_CALCOCO2_ENST00000509507_chr17_46933549_+_WRAP53_ENST00000316024_chr17_7604059_+_692aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRCSLNQTIQLLITPDTGSIWHQVGWKTTRET
YTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQEL
KDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQ
GDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDVPV
LRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFSTAR
PGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDL
RQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPE

>In-frame_CALCOCO2_ENST00000509507_chr17_46933549_+_WRAP53_ENST00000457584_chr17_7604059_+_692aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRCSLNQTIQLLITPDTGSIWHQVGWKTTRET
YTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQEL
KDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQ
GDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDVPV
LRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFSTAR
PGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDL
RQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPE

>In-frame_CALCOCO2_ENST00000509507_chr17_46933549_+_WRAP53_ENST00000396463_chr17_7604059_+_692aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRCSLNQTIQLLITPDTGSIWHQVGWKTTRET
YTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQEL
KDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQ
GDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDVPV
LRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFSTAR
PGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDL
RQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPE

>In-frame_CALCOCO2_ENST00000509507_chr17_46933549_+_WRAP53_ENST00000534050_chr17_7604059_+_692aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRCSLNQTIQLLITPDTGSIWHQVGWKTTRET
YTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQEL
KDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQ
GDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDVPV
LRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFSTAR
PGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDL
RQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPE

>In-frame_CALCOCO2_ENST00000448105_chr17_46933549_+_WRAP53_ENST00000431639_chr17_7604059_+_695aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRAFKCFQDKLEQELLKWRSQGQKLQVGWKTT
RETYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKEN
QELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEK
LVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGEND
VPVLRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFS
TARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLC
WDLRQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRV

>In-frame_CALCOCO2_ENST00000448105_chr17_46933549_+_WRAP53_ENST00000316024_chr17_7604059_+_695aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRAFKCFQDKLEQELLKWRSQGQKLQVGWKTT
RETYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKEN
QELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEK
LVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGEND
VPVLRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFS
TARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLC
WDLRQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRV

>In-frame_CALCOCO2_ENST00000448105_chr17_46933549_+_WRAP53_ENST00000457584_chr17_7604059_+_695aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRAFKCFQDKLEQELLKWRSQGQKLQVGWKTT
RETYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKEN
QELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEK
LVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGEND
VPVLRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFS
TARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLC
WDLRQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRV

>In-frame_CALCOCO2_ENST00000448105_chr17_46933549_+_WRAP53_ENST00000396463_chr17_7604059_+_695aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRAFKCFQDKLEQELLKWRSQGQKLQVGWKTT
RETYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKEN
QELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEK
LVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGEND
VPVLRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFS
TARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLC
WDLRQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRV

>In-frame_CALCOCO2_ENST00000448105_chr17_46933549_+_WRAP53_ENST00000534050_chr17_7604059_+_695aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRAFKCFQDKLEQELLKWRSQGQKLQVGWKTT
RETYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKEN
QELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEK
LVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGEND
VPVLRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFS
TARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLC
WDLRQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRV

>In-frame_CALCOCO2_ENST00000416445_chr17_46933549_+_WRAP53_ENST00000431639_chr17_7604059_+_629aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRVGWKTTRETYTFMWVTLPIDLNNKSAKQQE
VQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSE
NEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSK
RLSENEIICNALQRQKERLEGENDVPVLRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAA
HSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGI
THLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQ

>In-frame_CALCOCO2_ENST00000416445_chr17_46933549_+_WRAP53_ENST00000316024_chr17_7604059_+_629aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRVGWKTTRETYTFMWVTLPIDLNNKSAKQQE
VQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSE
NEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSK
RLSENEIICNALQRQKERLEGENDVPVLRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAA
HSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGI
THLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQ

>In-frame_CALCOCO2_ENST00000416445_chr17_46933549_+_WRAP53_ENST00000457584_chr17_7604059_+_629aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRVGWKTTRETYTFMWVTLPIDLNNKSAKQQE
VQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSE
NEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSK
RLSENEIICNALQRQKERLEGENDVPVLRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAA
HSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGI
THLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQ

>In-frame_CALCOCO2_ENST00000416445_chr17_46933549_+_WRAP53_ENST00000396463_chr17_7604059_+_629aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRVGWKTTRETYTFMWVTLPIDLNNKSAKQQE
VQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSE
NEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSK
RLSENEIICNALQRQKERLEGENDVPVLRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAA
HSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGI
THLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQ

>In-frame_CALCOCO2_ENST00000416445_chr17_46933549_+_WRAP53_ENST00000534050_chr17_7604059_+_629aa
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHTTFTQHFIPRRKDWIGIFRVGWKTTRETYTFMWVTLPIDLNNKSAKQQE
VQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSE
NEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSK
RLSENEIICNALQRQKERLEGENDVPVLRMVEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAA
HSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGI
THLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQ

>In-frame_CALCOCO2_ENST00000508679_chr17_46933549_+_WRAP53_ENST00000431639_chr17_7604059_+_599aa
MWVTLPIDLNNKSAKQQEVQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDS
CISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQ
DKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDVPVLRM
VEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFSTARPGR
DCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQS
GYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTE

>In-frame_CALCOCO2_ENST00000508679_chr17_46933549_+_WRAP53_ENST00000316024_chr17_7604059_+_599aa
MWVTLPIDLNNKSAKQQEVQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDS
CISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQ
DKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDVPVLRM
VEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFSTARPGR
DCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQS
GYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTE

>In-frame_CALCOCO2_ENST00000508679_chr17_46933549_+_WRAP53_ENST00000457584_chr17_7604059_+_599aa
MWVTLPIDLNNKSAKQQEVQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDS
CISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQ
DKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDVPVLRM
VEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFSTARPGR
DCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQS
GYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTE

>In-frame_CALCOCO2_ENST00000508679_chr17_46933549_+_WRAP53_ENST00000396463_chr17_7604059_+_599aa
MWVTLPIDLNNKSAKQQEVQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDS
CISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQ
DKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDVPVLRM
VEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFSTARPGR
DCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQS
GYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTE

>In-frame_CALCOCO2_ENST00000508679_chr17_46933549_+_WRAP53_ENST00000534050_chr17_7604059_+_599aa
MWVTLPIDLNNKSAKQQEVQFKAYYLPKDDETYQFCTVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDS
CISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDTWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQ
DKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDVPVLRM
VEGDTITDYCWTSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGFNRTVRVFSTARPGR
DCEVRATFAKKQGQSGIISCIAFSPAQPLTACGSYGRSLGLTAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQS
GYPLWSLGREVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CALCOCO2_ENST00000258947_chr17_46933549_+_WRAP53_ENST00000431639_chr17_7604059_+_2013nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
GTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAA
GTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGT
ATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAG
GAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAG
CAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTT
CAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAA
GAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTC
AGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAA
CAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGA
TTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCC
CAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTT
CGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGG
ACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATC
TCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCC
CCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAG
GATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTAC
TTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGAT
GGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACT
GCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTC
CACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGA

>In-frame_CALCOCO2_ENST00000258947_chr17_46933549_+_WRAP53_ENST00000316024_chr17_7604059_+_2013nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
GTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAA
GTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGT
ATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAG
GAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAG
CAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTT
CAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAA
GAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTC
AGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAA
CAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGA
TTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCC
CAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTT
CGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGG
ACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATC
TCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCC
CCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAG
GATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTAC
TTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGAT
GGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACT
GCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTC
CACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGA

>In-frame_CALCOCO2_ENST00000258947_chr17_46933549_+_WRAP53_ENST00000457584_chr17_7604059_+_2013nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
GTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAA
GTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGT
ATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAG
GAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAG
CAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTT
CAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAA
GAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTC
AGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAA
CAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGA
TTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCC
CAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTT
CGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGG
ACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATC
TCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCC
CCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAG
GATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTAC
TTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGAT
GGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACT
GCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTC
CACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGA

>In-frame_CALCOCO2_ENST00000258947_chr17_46933549_+_WRAP53_ENST00000396463_chr17_7604059_+_2013nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
GTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAA
GTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGT
ATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAG
GAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAG
CAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTT
CAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAA
GAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTC
AGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAA
CAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGA
TTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCC
CAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTT
CGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGG
ACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATC
TCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCC
CCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAG
GATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTAC
TTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGAT
GGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACT
GCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTC
CACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGA

>In-frame_CALCOCO2_ENST00000258947_chr17_46933549_+_WRAP53_ENST00000534050_chr17_7604059_+_2013nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
GTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAA
GTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGT
ATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAG
GAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAG
CAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTT
CAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAA
GAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTC
AGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAA
CAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGA
TTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCC
CAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTT
CGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGG
ACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATC
TCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCC
CCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAG
GATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTAC
TTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGAT
GGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACT
GCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTC
CACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGA

>In-frame_CALCOCO2_ENST00000509507_chr17_46933549_+_WRAP53_ENST00000431639_chr17_7604059_+_2076nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
TGTAGTCTTAATCAGACTATTCAACTCCTCATCACCCCAGACACTGGTAGTATCTGGCACCAGGTGGGGTGGAAGACAACCCGTGAGTAT
TACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCC
AAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAAT
GAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTG
AAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGC
ATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATG
TCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAG
GGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAG
AAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGAC
CTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTC
CTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGC
AGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTG
ACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGG
CCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAG
CCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAA
GGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTC
CGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTC
CTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTT
CTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAG
CCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGG
TGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTGGGTGAGCTG

>In-frame_CALCOCO2_ENST00000509507_chr17_46933549_+_WRAP53_ENST00000316024_chr17_7604059_+_2076nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
TGTAGTCTTAATCAGACTATTCAACTCCTCATCACCCCAGACACTGGTAGTATCTGGCACCAGGTGGGGTGGAAGACAACCCGTGAGTAT
TACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCC
AAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAAT
GAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTG
AAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGC
ATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATG
TCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAG
GGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAG
AAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGAC
CTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTC
CTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGC
AGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTG
ACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGG
CCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAG
CCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAA
GGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTC
CGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTC
CTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTT
CTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAG
CCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGG
TGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTGGGTGAGCTG

>In-frame_CALCOCO2_ENST00000509507_chr17_46933549_+_WRAP53_ENST00000457584_chr17_7604059_+_2076nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
TGTAGTCTTAATCAGACTATTCAACTCCTCATCACCCCAGACACTGGTAGTATCTGGCACCAGGTGGGGTGGAAGACAACCCGTGAGTAT
TACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCC
AAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAAT
GAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTG
AAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGC
ATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATG
TCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAG
GGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAG
AAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGAC
CTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTC
CTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGC
AGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTG
ACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGG
CCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAG
CCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAA
GGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTC
CGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTC
CTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTT
CTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAG
CCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGG
TGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTGGGTGAGCTG

>In-frame_CALCOCO2_ENST00000509507_chr17_46933549_+_WRAP53_ENST00000396463_chr17_7604059_+_2076nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
TGTAGTCTTAATCAGACTATTCAACTCCTCATCACCCCAGACACTGGTAGTATCTGGCACCAGGTGGGGTGGAAGACAACCCGTGAGTAT
TACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCC
AAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAAT
GAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTG
AAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGC
ATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATG
TCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAG
GGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAG
AAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGAC
CTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTC
CTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGC
AGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTG
ACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGG
CCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAG
CCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAA
GGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTC
CGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTC
CTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTT
CTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAG
CCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGG
TGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTGGGTGAGCTG

>In-frame_CALCOCO2_ENST00000509507_chr17_46933549_+_WRAP53_ENST00000534050_chr17_7604059_+_2076nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
TGTAGTCTTAATCAGACTATTCAACTCCTCATCACCCCAGACACTGGTAGTATCTGGCACCAGGTGGGGTGGAAGACAACCCGTGAGTAT
TACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCC
AAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAAT
GAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTG
AAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGC
ATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATG
TCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAG
GGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAG
AAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGAC
CTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTC
CTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGC
AGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTG
ACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGG
CCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAG
CCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAA
GGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTC
CGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTC
CTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTT
CTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAG
CCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGG
TGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTGGGTGAGCTG

>In-frame_CALCOCO2_ENST00000448105_chr17_46933549_+_WRAP53_ENST00000431639_chr17_7604059_+_2085nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
GCATTTAAATGTTTCCAAGACAAATTGGAACAAGAACTACTCAAATGGAGGAGCCAAGGACAGAAATTGCAGGTGGGGTGGAAGACAACC
CGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTAC
TACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGT
CCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAAC
CAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACC
CTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAAC
CAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAG
CTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGG
AAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAA
AACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGAT
GTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTAC
GTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTG
GATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCC
ACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGC
CCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGA
GGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGC
TGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACC
GGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTG
TTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTG
TTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTT
CAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTG

>In-frame_CALCOCO2_ENST00000448105_chr17_46933549_+_WRAP53_ENST00000316024_chr17_7604059_+_2085nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
GCATTTAAATGTTTCCAAGACAAATTGGAACAAGAACTACTCAAATGGAGGAGCCAAGGACAGAAATTGCAGGTGGGGTGGAAGACAACC
CGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTAC
TACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGT
CCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAAC
CAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACC
CTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAAC
CAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAG
CTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGG
AAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAA
AACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGAT
GTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTAC
GTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTG
GATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCC
ACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGC
CCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGA
GGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGC
TGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACC
GGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTG
TTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTG
TTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTT
CAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTG

>In-frame_CALCOCO2_ENST00000448105_chr17_46933549_+_WRAP53_ENST00000457584_chr17_7604059_+_2085nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
GCATTTAAATGTTTCCAAGACAAATTGGAACAAGAACTACTCAAATGGAGGAGCCAAGGACAGAAATTGCAGGTGGGGTGGAAGACAACC
CGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTAC
TACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGT
CCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAAC
CAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACC
CTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAAC
CAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAG
CTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGG
AAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAA
AACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGAT
GTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTAC
GTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTG
GATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCC
ACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGC
CCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGA
GGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGC
TGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACC
GGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTG
TTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTG
TTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTT
CAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTG

>In-frame_CALCOCO2_ENST00000448105_chr17_46933549_+_WRAP53_ENST00000396463_chr17_7604059_+_2085nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
GCATTTAAATGTTTCCAAGACAAATTGGAACAAGAACTACTCAAATGGAGGAGCCAAGGACAGAAATTGCAGGTGGGGTGGAAGACAACC
CGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTAC
TACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGT
CCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAAC
CAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACC
CTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAAC
CAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAG
CTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGG
AAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAA
AACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGAT
GTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTAC
GTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTG
GATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCC
ACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGC
CCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGA
GGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGC
TGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACC
GGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTG
TTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTG
TTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTT
CAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTG

>In-frame_CALCOCO2_ENST00000448105_chr17_46933549_+_WRAP53_ENST00000534050_chr17_7604059_+_2085nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
GCATTTAAATGTTTCCAAGACAAATTGGAACAAGAACTACTCAAATGGAGGAGCCAAGGACAGAAATTGCAGGTGGGGTGGAAGACAACC
CGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTAC
TACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGT
CCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAAC
CAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACC
CTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAAC
CAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAG
CTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGG
AAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAA
AACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGAT
GTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTAC
GTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTG
GATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCC
ACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGC
CCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGA
GGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGC
TGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACC
GGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTG
TTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTG
TTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTT
CAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTG

>In-frame_CALCOCO2_ENST00000416445_chr17_46933549_+_WRAP53_ENST00000431639_chr17_7604059_+_1887nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
GTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAA
GTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGT
ATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAG
AAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAA
AATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAA
GATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTC
GAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAA
AGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATG
GTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGG
GAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCC
CATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGA
GACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTAT
GCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATC
ACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCT
GGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGT
GGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAG
AAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAG
AGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGG

>In-frame_CALCOCO2_ENST00000416445_chr17_46933549_+_WRAP53_ENST00000316024_chr17_7604059_+_1887nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
GTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAA
GTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGT
ATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAG
AAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAA
AATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAA
GATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTC
GAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAA
AGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATG
GTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGG
GAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCC
CATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGA
GACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTAT
GCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATC
ACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCT
GGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGT
GGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAG
AAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAG
AGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGG

>In-frame_CALCOCO2_ENST00000416445_chr17_46933549_+_WRAP53_ENST00000457584_chr17_7604059_+_1887nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
GTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAA
GTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGT
ATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAG
AAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAA
AATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAA
GATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTC
GAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAA
AGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATG
GTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGG
GAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCC
CATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGA
GACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTAT
GCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATC
ACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCT
GGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGT
GGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAG
AAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAG
AGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGG

>In-frame_CALCOCO2_ENST00000416445_chr17_46933549_+_WRAP53_ENST00000396463_chr17_7604059_+_1887nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
GTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAA
GTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGT
ATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAG
AAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAA
AATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAA
GATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTC
GAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAA
AGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATG
GTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGG
GAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCC
CATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGA
GACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTAT
GCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATC
ACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCT
GGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGT
GGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAG
AAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAG
AGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGG

>In-frame_CALCOCO2_ENST00000416445_chr17_46933549_+_WRAP53_ENST00000534050_chr17_7604059_+_1887nt
ATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAG
TTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGA
GTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAA
GTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGT
ATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAG
AAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAA
AATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAA
GATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTC
GAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAA
AGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATG
GTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGG
GAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCC
CATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGA
GACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTAT
GCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATC
ACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCT
GGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGT
GGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAG
AAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAG
AGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGG

>In-frame_CALCOCO2_ENST00000508679_chr17_46933549_+_WRAP53_ENST00000431639_chr17_7604059_+_1797nt
ATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGAT
GAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGAC
ATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGC
TGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAG
AAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAA
AATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAA
GATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTC
GAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAA
AGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATG
GTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGG
GAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCC
CATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGA
GACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTAT
GCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATC
ACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCT
GGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGT
GGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAG
AAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAG
AGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGG

>In-frame_CALCOCO2_ENST00000508679_chr17_46933549_+_WRAP53_ENST00000316024_chr17_7604059_+_1797nt
ATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGAT
GAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGAC
ATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGC
TGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAG
AAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAA
AATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAA
GATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTC
GAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAA
AGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATG
GTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGG
GAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCC
CATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGA
GACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTAT
GCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATC
ACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCT
GGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGT
GGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAG
AAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAG
AGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGG

>In-frame_CALCOCO2_ENST00000508679_chr17_46933549_+_WRAP53_ENST00000457584_chr17_7604059_+_1797nt
ATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGAT
GAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGAC
ATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGC
TGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAG
AAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAA
AATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAA
GATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTC
GAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAA
AGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATG
GTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGG
GAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCC
CATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGA
GACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTAT
GCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATC
ACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCT
GGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGT
GGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAG
AAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAG
AGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGG

>In-frame_CALCOCO2_ENST00000508679_chr17_46933549_+_WRAP53_ENST00000396463_chr17_7604059_+_1797nt
ATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGAT
GAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGAC
ATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGC
TGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAG
AAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAA
AATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAA
GATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTC
GAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAA
AGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATG
GTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGG
GAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCC
CATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGA
GACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTAT
GCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATC
ACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCT
GGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGT
GGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAG
AAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAG
AGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGG

>In-frame_CALCOCO2_ENST00000508679_chr17_46933549_+_WRAP53_ENST00000534050_chr17_7604059_+_1797nt
ATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGAT
GAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGAC
ATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGC
TGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAG
AAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAA
AATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAA
GATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTC
GAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAA
AGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATG
GTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGG
GAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCC
CATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGA
GACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTAT
GCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATC
ACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCT
GGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGT
GGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAG
AAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAG
AGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_CALCOCO2_ENST00000258947_chr17_46933549_+_WRAP53_ENST00000431639_chr17_7604059_+_2130nt
CAGGCGGGACGGGCTCTCCCTTGGGTGCTTAGCCCCGCCCCCGTCCCACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCT
GGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACA
GTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTG
GCATCTTTAGAGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTA
AACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCC
GGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGC
AGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGC
TCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGA
CAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGC
TGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACC
ACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAA
TGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGAC
AGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGA
TGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCC
GGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTG
GCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGA
GCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGG
ATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAG
GAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATC
AGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGC
CTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTC
TCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCA
CGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGA

>In-frame_CALCOCO2_ENST00000258947_chr17_46933549_+_WRAP53_ENST00000316024_chr17_7604059_+_2130nt
CAGGCGGGACGGGCTCTCCCTTGGGTGCTTAGCCCCGCCCCCGTCCCACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCT
GGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACA
GTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTG
GCATCTTTAGAGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTA
AACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCC
GGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGC
AGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGC
TCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGA
CAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGC
TGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACC
ACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAA
TGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGAC
AGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGA
TGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCC
GGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTG
GCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGA
GCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGG
ATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAG
GAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATC
AGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGC
CTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTC
TCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCA
CGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGA

>In-frame_CALCOCO2_ENST00000258947_chr17_46933549_+_WRAP53_ENST00000457584_chr17_7604059_+_2130nt
CAGGCGGGACGGGCTCTCCCTTGGGTGCTTAGCCCCGCCCCCGTCCCACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCT
GGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACA
GTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTG
GCATCTTTAGAGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTA
AACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCC
GGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGC
AGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGC
TCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGA
CAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGC
TGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACC
ACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAA
TGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGAC
AGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGA
TGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCC
GGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTG
GCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGA
GCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGG
ATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAG
GAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATC
AGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGC
CTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTC
TCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCA
CGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGA

>In-frame_CALCOCO2_ENST00000258947_chr17_46933549_+_WRAP53_ENST00000396463_chr17_7604059_+_2130nt
CAGGCGGGACGGGCTCTCCCTTGGGTGCTTAGCCCCGCCCCCGTCCCACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCT
GGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACA
GTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTG
GCATCTTTAGAGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTA
AACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCC
GGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGC
AGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGC
TCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGA
CAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGC
TGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACC
ACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAA
TGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGAC
AGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGA
TGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCC
GGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTG
GCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGA
GCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGG
ATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAG
GAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATC
AGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGC
CTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTC
TCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCA
CGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGA

>In-frame_CALCOCO2_ENST00000258947_chr17_46933549_+_WRAP53_ENST00000534050_chr17_7604059_+_2130nt
CAGGCGGGACGGGCTCTCCCTTGGGTGCTTAGCCCCGCCCCCGTCCCACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCT
GGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCCACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACA
GTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACATGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTG
GCATCTTTAGAGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTA
AACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCC
GGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACTCAGGGAGAGGTGGAAGAGATTGAGC
AGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAGCAGAACTCAGACATGCAGGCTGAGC
TCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTATTGGGAGA
CAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAGGCCCAGC
TGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAAAATGACC
ACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACTACTGCAA
TGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTGCAGAGAC
AGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTATTCTCTGA
TGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGAGAGCTCC
GGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTG
GCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAGGGCCAGA
GCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTATGCCTGGG
ATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTCTTCTCAG
GAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACCACCAATC
AGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACGGACGGGC
CTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGCCTGCCTC
TCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCA
CGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAGGGCGAGA

>In-frame_CALCOCO2_ENST00000509507_chr17_46933549_+_WRAP53_ENST00000431639_chr17_7604059_+_2155nt
CCCCGTCCCACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCC
ACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACA
TGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGATGTAGTCTTAATCAGACTATTCAACTC
CTCATCACCCCAGACACTGGTAGTATCTGGCACCAGGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCC
ATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGC
TATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACT
CAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAG
CAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTG
AAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATC
AGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTA
GAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAA
ATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAA
ATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATC
TATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATC
TGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCC
CCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCC
ACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGC
CGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCAT
CCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCC
CTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCT
GTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGC
GTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAG
GAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGC

>In-frame_CALCOCO2_ENST00000509507_chr17_46933549_+_WRAP53_ENST00000316024_chr17_7604059_+_2155nt
CCCCGTCCCACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCC
ACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACA
TGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGATGTAGTCTTAATCAGACTATTCAACTC
CTCATCACCCCAGACACTGGTAGTATCTGGCACCAGGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCC
ATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGC
TATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACT
CAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAG
CAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTG
AAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATC
AGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTA
GAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAA
ATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAA
ATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATC
TATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATC
TGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCC
CCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCC
ACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGC
CGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCAT
CCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCC
CTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCT
GTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGC
GTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAG
GAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGC

>In-frame_CALCOCO2_ENST00000509507_chr17_46933549_+_WRAP53_ENST00000457584_chr17_7604059_+_2155nt
CCCCGTCCCACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCC
ACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACA
TGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGATGTAGTCTTAATCAGACTATTCAACTC
CTCATCACCCCAGACACTGGTAGTATCTGGCACCAGGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCC
ATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGC
TATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACT
CAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAG
CAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTG
AAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATC
AGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTA
GAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAA
ATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAA
ATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATC
TATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATC
TGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCC
CCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCC
ACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGC
CGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCAT
CCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCC
CTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCT
GTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGC
GTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAG
GAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGC

>In-frame_CALCOCO2_ENST00000509507_chr17_46933549_+_WRAP53_ENST00000396463_chr17_7604059_+_2155nt
CCCCGTCCCACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCC
ACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACA
TGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGATGTAGTCTTAATCAGACTATTCAACTC
CTCATCACCCCAGACACTGGTAGTATCTGGCACCAGGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCC
ATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGC
TATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACT
CAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAG
CAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTG
AAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATC
AGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTA
GAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAA
ATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAA
ATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATC
TATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATC
TGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCC
CCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCC
ACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGC
CGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCAT
CCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCC
CTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCT
GTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGC
GTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAG
GAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGC

>In-frame_CALCOCO2_ENST00000509507_chr17_46933549_+_WRAP53_ENST00000534050_chr17_7604059_+_2155nt
CCCCGTCCCACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCC
ACATCAGCTGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACA
TGTCATTATACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGATGTAGTCTTAATCAGACTATTCAACTC
CTCATCACCCCAGACACTGGTAGTATCTGGCACCAGGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCCC
ATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTGC
TATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCACT
CAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAAG
CAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTG
AAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATC
AGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTA
GAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAA
ATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAA
ATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATC
TATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATC
TGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCC
CCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCC
ACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGC
CGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCAT
CCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCC
CTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCT
GTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGC
GTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAG
GAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGC

>In-frame_CALCOCO2_ENST00000448105_chr17_46933549_+_WRAP53_ENST00000431639_chr17_7604059_+_2156nt
CACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCCACATCAGC
TGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACATGTCATTA
TACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGAGCATTTAAATGTTTCCAAGACAAATTGGAACAAGA
ACTACTCAAATGGAGGAGCCAAGGACAGAAATTGCAGGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCC
CATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTG
CTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCAC
TCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAA
GCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGT
GAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAAT
CAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTT
AGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCA
AATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGA
AATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCAT
CTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATAT
CTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTC
CCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGC
CACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGG
CCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCA
TCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTC
CCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGC
TGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGG
CGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGA
GGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAG

>In-frame_CALCOCO2_ENST00000448105_chr17_46933549_+_WRAP53_ENST00000316024_chr17_7604059_+_2156nt
CACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCCACATCAGC
TGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACATGTCATTA
TACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGAGCATTTAAATGTTTCCAAGACAAATTGGAACAAGA
ACTACTCAAATGGAGGAGCCAAGGACAGAAATTGCAGGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCC
CATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTG
CTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCAC
TCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAA
GCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGT
GAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAAT
CAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTT
AGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCA
AATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGA
AATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCAT
CTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATAT
CTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTC
CCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGC
CACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGG
CCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCA
TCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTC
CCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGC
TGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGG
CGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGA
GGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAG

>In-frame_CALCOCO2_ENST00000448105_chr17_46933549_+_WRAP53_ENST00000457584_chr17_7604059_+_2156nt
CACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCCACATCAGC
TGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACATGTCATTA
TACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGAGCATTTAAATGTTTCCAAGACAAATTGGAACAAGA
ACTACTCAAATGGAGGAGCCAAGGACAGAAATTGCAGGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCC
CATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTG
CTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCAC
TCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAA
GCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGT
GAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAAT
CAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTT
AGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCA
AATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGA
AATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCAT
CTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATAT
CTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTC
CCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGC
CACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGG
CCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCA
TCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTC
CCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGC
TGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGG
CGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGA
GGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAG

>In-frame_CALCOCO2_ENST00000448105_chr17_46933549_+_WRAP53_ENST00000396463_chr17_7604059_+_2156nt
CACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCCACATCAGC
TGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACATGTCATTA
TACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGAGCATTTAAATGTTTCCAAGACAAATTGGAACAAGA
ACTACTCAAATGGAGGAGCCAAGGACAGAAATTGCAGGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCC
CATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTG
CTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCAC
TCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAA
GCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGT
GAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAAT
CAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTT
AGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCA
AATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGA
AATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCAT
CTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATAT
CTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTC
CCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGC
CACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGG
CCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCA
TCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTC
CCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGC
TGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGG
CGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGA
GGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAG

>In-frame_CALCOCO2_ENST00000448105_chr17_46933549_+_WRAP53_ENST00000534050_chr17_7604059_+_2156nt
CACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCCACATCAGC
TGTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACATGTCATTA
TACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGAGCATTTAAATGTTTCCAAGACAAATTGGAACAAGA
ACTACTCAAATGGAGGAGCCAAGGACAGAAATTGCAGGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTACTTTGCC
CATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACCAGTTCTG
CTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTGTTACCAC
TCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCCTCCAGAA
GCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGT
GAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAAT
CAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTT
AGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCA
AATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGA
AATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCAT
CTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATAT
CTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTC
CCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGC
CACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGG
CCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCA
TCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTC
CCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGC
TGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGG
CGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGA
GGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAG

>In-frame_CALCOCO2_ENST00000416445_chr17_46933549_+_WRAP53_ENST00000431639_chr17_7604059_+_1957nt
ACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCCACATCAGCT
GTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACATGTCATTAT
ACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGAGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTC
ATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGAT
GAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGAC
ATCCTGGTTGTTACCACTCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTAT
TGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAG
GCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAA
AATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACT
ACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTG
CAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTAT
TCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGA
GAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTC
TTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAG
GGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTAT
GCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTC
TTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACC
ACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACG
GACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGC
CTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTG
CTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAG

>In-frame_CALCOCO2_ENST00000416445_chr17_46933549_+_WRAP53_ENST00000316024_chr17_7604059_+_1957nt
ACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCCACATCAGCT
GTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACATGTCATTAT
ACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGAGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTC
ATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGAT
GAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGAC
ATCCTGGTTGTTACCACTCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTAT
TGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAG
GCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAA
AATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACT
ACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTG
CAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTAT
TCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGA
GAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTC
TTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAG
GGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTAT
GCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTC
TTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACC
ACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACG
GACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGC
CTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTG
CTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAG

>In-frame_CALCOCO2_ENST00000416445_chr17_46933549_+_WRAP53_ENST00000457584_chr17_7604059_+_1957nt
ACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCCACATCAGCT
GTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACATGTCATTAT
ACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGAGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTC
ATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGAT
GAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGAC
ATCCTGGTTGTTACCACTCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTAT
TGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAG
GCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAA
AATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACT
ACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTG
CAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTAT
TCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGA
GAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTC
TTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAG
GGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTAT
GCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTC
TTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACC
ACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACG
GACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGC
CTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTG
CTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAG

>In-frame_CALCOCO2_ENST00000416445_chr17_46933549_+_WRAP53_ENST00000396463_chr17_7604059_+_1957nt
ACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCCACATCAGCT
GTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACATGTCATTAT
ACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGAGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTC
ATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGAT
GAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGAC
ATCCTGGTTGTTACCACTCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTAT
TGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAG
GCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAA
AATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACT
ACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTG
CAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTAT
TCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGA
GAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTC
TTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAG
GGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTAT
GCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTC
TTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACC
ACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACG
GACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGC
CTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTG
CTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAG

>In-frame_CALCOCO2_ENST00000416445_chr17_46933549_+_WRAP53_ENST00000534050_chr17_7604059_+_1957nt
ACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGACCCCTACCATGGAGGAGACCATCAAAGATCCCCCCACATCAGCT
GTCTTGCTGGATCACTGTCATTTCTCTCAGGTCATCTTTAACAGTGTGGAGAAGTTCTACATCCCTGGAGGGGACGTCACATGTCATTAT
ACCTTCACCCAGCATTTCATCCCTCGTCGAAAGGATTGGATTGGCATCTTTAGAGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTC
ATGTGGGTTACTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGAT
GAGTATTACCAGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGAC
ATCCTGGTTGTTACCACTCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAACTGAAAGTGAAAGAACAGAAGGACTAT
TGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGATGGGAATCAGAGTGGATCAGCTTCAG
GCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAGAGCAGTTAGAGCAGCTGAAAAAGGAA
AATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAGTGGAGCAAATGAAGCAGAATGAAACT
ACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTGAGAACGAAATTATATGTAATGCTCTG
CAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTGATACCATCTATGATTACTGCTGGTAT
TCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGATTCATATCTGGGACGCATTCACTGGA
GAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCTGCTTCTCCCCGGATGGCTCCCAGCTC
TTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGGTCCGAGCCACATTTGCAAAAAAGCAG
GGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTACGGCCGCTCCCTGGGTCTGTAT
GCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCTGCTTTCATCCCGATGGCAACCGCTTC
TTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCACTGTGGTCCCTGGGTCGAGAGGTGACC
ACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGAGCGGGGCTGTCTCTGTGTGGGACACG
GACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCACCAATGGCGTGAGCCTGCACCCTAGC
CTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACGAAGGAGAGGAGCTGGGCCTTCCCTTG
CTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAGACTCCAGCATCCCTGATGATCACCAG

>In-frame_CALCOCO2_ENST00000508679_chr17_46933549_+_WRAP53_ENST00000431639_chr17_7604059_+_1893nt
ACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTA
CTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACC
AGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTG
TTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCC
TCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAAC
TGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGA
TGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAG
AGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAG
TGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTG
AGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTG
ATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGA
TTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCT
GCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGG
TCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCT
CCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCT
GCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCAC
TGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGA
GCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCA
CCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACG
AAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAG
ACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTGGGTGAGCTGATATAAAAAGGTTTTTATG

>In-frame_CALCOCO2_ENST00000508679_chr17_46933549_+_WRAP53_ENST00000316024_chr17_7604059_+_1893nt
ACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTA
CTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACC
AGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTG
TTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCC
TCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAAC
TGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGA
TGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAG
AGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAG
TGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTG
AGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTG
ATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGA
TTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCT
GCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGG
TCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCT
CCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCT
GCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCAC
TGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGA
GCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCA
CCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACG
AAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAG
ACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTGGGTGAGCTGATATAAAAAGGTTTTTATG

>In-frame_CALCOCO2_ENST00000508679_chr17_46933549_+_WRAP53_ENST00000457584_chr17_7604059_+_1893nt
ACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTA
CTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACC
AGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTG
TTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCC
TCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAAC
TGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGA
TGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAG
AGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAG
TGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTG
AGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTG
ATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGA
TTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCT
GCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGG
TCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCT
CCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCT
GCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCAC
TGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGA
GCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCA
CCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACG
AAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAG
ACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTGGGTGAGCTGATATAAAAAGGTTTTTATG

>In-frame_CALCOCO2_ENST00000508679_chr17_46933549_+_WRAP53_ENST00000396463_chr17_7604059_+_1893nt
ACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTA
CTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACC
AGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTG
TTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCC
TCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAAC
TGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGA
TGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAG
AGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAG
TGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTG
AGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTG
ATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGA
TTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCT
GCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGG
TCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCT
CCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCT
GCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCAC
TGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGA
GCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCA
CCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACG
AAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAG
ACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTGGGTGAGCTGATATAAAAAGGTTTTTATG

>In-frame_CALCOCO2_ENST00000508679_chr17_46933549_+_WRAP53_ENST00000534050_chr17_7604059_+_1893nt
ACTCTGCCCTGTTGCTGTCGCGCCGCTGCTGGTTGCTGTCCCTGGTGGGGTGGAAGACAACCCGTGAGTATTACACCTTCATGTGGGTTA
CTTTGCCCATTGACCTAAACAACAAATCAGCTAAACAGCAGGAAGTCCAATTCAAAGCTTACTACCTGCCCAAGGATGATGAGTATTACC
AGTTCTGCTATGTGGATGAGGATGGTGTGGTCCGGGGAGCAAGTATTCCTTTCCAATTCCGTCCAGAAAATGAGGAAGACATCCTGGTTG
TTACCACTCAGGGAGAGGTGGAAGAGATTGAGCAGCACAACAAGGAGCTTTGCAAAGAAAACCAGGAGCTGAAGGACAGCTGTATCAGCC
TCCAGAAGCAGAACTCAGACATGCAGGCTGAGCTCCAAAAGAAGCAGGAGGAGCTAGAAACCCTACAGAGCATCAATAAGAAGTTGGAAC
TGAAAGTGAAAGAACAGAAGGACTATTGGGAGACAGAGCTGCTTCAACTGAAAGAACAAAACCAGAAGATGTCCTCAGAAAATGAGAAGA
TGGGAATCAGAGTGGATCAGCTTCAGGCCCAGCTGTCAACTCAAGAGAAAGAAATGGAGAAGCTTGTTCAGGGAGATCAAGATAAGACAG
AGCAGTTAGAGCAGCTGAAAAAGGAAAATGACCACCTCTTTCTCAGTTTAACTGAACAGAGGAAGGACCAGAAGAAGCTCGAGCAGACAG
TGGAGCAAATGAAGCAGAATGAAACTACTGCAATGAAGAAACAACAGGAATTAATGGATGAAAACTTTGACCTGTCAAAAAGACTGAGTG
AGAACGAAATTATATGTAATGCTCTGCAGAGACAGAAAGAGAGATTGGAAGGAGAAAATGATGTCCCTGTCCTTCGAATGGTGGAAGGTG
ATACCATCTATGATTACTGCTGGTATTCTCTGATGTCCTCAGCCCAGCCAGACACCTCCTACGTGGCCAGCAGCAGCCGGGAGAACCCGA
TTCATATCTGGGACGCATTCACTGGAGAGCTCCGGGCTTCCTTTCGCGCCTACAACCACCTGGATGAGCTGACGGCAGCCCATTCGCTCT
GCTTCTCCCCGGATGGCTCCCAGCTCTTCTGTGGCTTCAACCGGACTGTGCGTGTTTTTTCCACGGCCCGGCCTGGCCGAGACTGCGAGG
TCCGAGCCACATTTGCAAAAAAGCAGGGCCAGAGCGGCATCATCTCCTGCATAGCCTTCAGCCCAGCCCAGCCCCTCTATGCCTGTGGCT
CCTACGGCCGCTCCCTGGGTCTGTATGCCTGGGATGATGGCTCCCCTCTCGCCTTGCTGGGAGGGCACCAAGGGGGCATCACCCACCTCT
GCTTTCATCCCGATGGCAACCGCTTCTTCTCAGGAGCCCGCAAGGATGCTGAGCTCCTGTGCTGGGATCTCCGGCAGTCTGGTTACCCAC
TGTGGTCCCTGGGTCGAGAGGTGACCACCAATCAGCGCATCTACTTCGATCTGGACCCGACCGGGCAGTTCCTAGTGAGTGGCAGCACGA
GCGGGGCTGTCTCTGTGTGGGACACGGACGGGCCTGGCAATGATGGGAAGCCGGAGCCCGTGTTGAGTTTTCTGCCCCAGAAGGACTGCA
CCAATGGCGTGAGCCTGCACCCTAGCCTGCCTCTCCTGGCCACTGCCTCCGGTCAGCGTGTGTTTCCTGAGCCCACAGAGAGTGGGGACG
AAGGAGAGGAGCTGGGCCTTCCCTTGCTCTCCACGCGCCACGTCCACCTTGAATGTCGGCTTCAGCTCTGGTGGTGTGGGGGGGCGCCAG
ACTCCAGCATCCCTGATGATCACCAGGGCGAGAAAGGGCAGGGAGGAACGGAGGGAGGTGTGGGTGAGCTGATATAAAAAGGTTTTTATG


Top

FusionGenePPI for CALCOCO2_WRAP53


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CALCOCO2TP53RK, LGALS8, FBF1, ZC2HC1C, CCDC185, LNX1, PIAS4, CCDC33, PSMA1, PTBP1, RABL6, CPNE7, ZNF101, LSM4, SHC1, GABARAPL2, VPS72, ZNF451, DBNDD2, ZNF638, FBXL18, ZNF205, FXR2, MCM10, POLI, PTBP2, AP5B1, KAT7, PCGF1, TCL1A, SMARCD1, TCEB3B, ABLIM1, CALCOCO2, ENKD1, ZNF426, C20orf195, SRI, FASTK, TRAF2, ZNF408, DAZAP2, RHPN1, APEX2, GABARAPL1, FAM107A, KANSL1, TAB3, TBK1, IKBKE, TBKBP1, MAP1LC3A, FMR1, MAVS, PRRC2A, KIAA1407, MTPAP, AZI2, TRAF4, MYO6, TAX1BP1, UBC, GEMIN4, IQCB1, RNF11, MAP1LC3C, DICER1, PARK2, SQSTM1, RPA2, ORC5, TRAF6, IKBKG, GIT2, RB1CC1, ADSL, ARNT2, MVP, NDN, PRKAB2, AES, CCNH, DCX, DDX6, DOCK2, HOXB9, LMO2, SMCP, MOS, MXI1, PFDN5, PHF1, RPL9, RPS27A, SDCBP, SNRPB, UBB, VARS, ARHGEF5, AKAP17A, NAA10, LMO4, STK16, TBRG4, FAM189A2, LITAF, EEF1E1, RIN1, AMMECR1, FARS2, MID2, DUSP12, BAHD1, PEG10, PSME4, FAM168A, PRPF31, ZNF337, NFU1, DCTN4, SLC15A3, ZNF581, HDAC7, CHCHD3, MAGOHB, FAM90A1, TBC1D22B, LIMS2, EXOSC5, CBX8, GATAD2B, KLHL42, FKBPL, TEKT3, METTL17, RBM15, DUSP26, LENG1, FAM161A, BEX2, RTN4IP1, ARHGEF39, LMF2, LONRF1, DDIT4L, GLYCTK, CWF19L2, ZNF564, PAPD4, PPP1R18, SPATA24, BCL6B, RTP5, CEP57L1, UBAC2, PEF1, RNF2, NRBF2, SULT1A2, BBOX1, CDK7, LDLRAD4, TTC23L, HLX, MAP1LC3B, GABARAP, U2AF2, ATG5, C1orf106, CHRDL1, SYNC, CEP55, BCAP29, HDAC11, RAB35, UBE2AWRAP53PRPF4, PTGES3, XPC, WAPAL, SNRPC, USP11, TNPO1, RBBP7, GAR1, FAM43A, MDC1, RNF8, H2AFX, HNRNPU, ZFHX3, CCT6A, DKC1, MYBPH, NDUFV3, TCP1, CCT3, STK24, CCT7, CCT4, CCT2, CCT8, CCT5, PRPF38B, PTPN1, RAP1B, RXRB, POLG2, CNTROB, MRPL14, KIAA1683, LYPD4, CRYL1, ARHGAP25, FAM46A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000258947+1013371_381336447LGALS8
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000416445+912371_381294405LGALS8
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000448105+1114371_381360471LGALS8
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000508679+912371_381264375LGALS8
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000509507+1114371_381357468LGALS8
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000258947+1013395_446336447MYO6
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000416445+912395_446294405MYO6
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000448105+1114395_446360471MYO6
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000508679+912395_446264375MYO6
HgeneCALCOCO2chr17:46933549chr17:7604059ENST00000509507+1114395_446357468MYO6


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CALCOCO2_WRAP53


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CALCOCO2_WRAP53


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneWRAP53C3151442DYSKERATOSIS CONGENITA, AUTOSOMAL RECESSIVE, 31UNIPROT