FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 5274

FusionGeneSummary for CADPS_FHIT

check button Fusion gene summary
Fusion gene informationFusion gene name: CADPS_FHIT
Fusion gene ID: 5274
HgeneTgene
Gene symbol

CADPS

FHIT

Gene ID

8618

2272

Gene namecalcium dependent secretion activatorfragile histidine triad
SynonymsCADPS1|CAPS|CAPS1|UNC-31AP3Aase|FRA3B
Cytomap

3p14.2

3p14.2

Type of geneprotein-codingprotein-coding
Descriptioncalcium-dependent secretion activator 1CAPS-1Ca++-dependent secretion activatorCa2+ dependent secretion activatorCa2+-dependent activator protein for secretionCa2+-regulated cytoskeletal proteincalcium-dependent activator protein for secretion 1bis(5'-adenosyl)-triphosphataseAP3A hydrolasediadenosine 5',5'''-P1,P3-triphosphate hydrolasedinucleosidetriphosphatase
Modification date2018051920180519
UniProtAcc

Q9ULU8

P49789

Ensembl transtripts involved in fusion geneENST00000383710, ENST00000357948, 
ENST00000283269, ENST00000490353, 
ENST00000462768, 
ENST00000476844, 
ENST00000492590, ENST00000466788, 
ENST00000468189, ENST00000341848, 
Fusion gene scores* DoF score4 X 4 X 3=4817 X 7 X 10=1190
# samples 420
** MAII scorelog2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(20/1190*10)=-2.57288966842058
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CADPS [Title/Abstract] AND FHIT [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneFHIT

GO:0006163

purine nucleotide metabolic process

9323207


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-E9-A22E-01ACADPSchr3

62860264

-FHITchr3

59908140

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000383710ENST00000476844CADPSchr3

62860264

-FHITchr3

59908140

-
In-frameENST00000383710ENST00000492590CADPSchr3

62860264

-FHITchr3

59908140

-
5CDS-5UTRENST00000383710ENST00000466788CADPSchr3

62860264

-FHITchr3

59908140

-
5CDS-5UTRENST00000383710ENST00000468189CADPSchr3

62860264

-FHITchr3

59908140

-
5CDS-5UTRENST00000383710ENST00000341848CADPSchr3

62860264

-FHITchr3

59908140

-
In-frameENST00000357948ENST00000476844CADPSchr3

62860264

-FHITchr3

59908140

-
In-frameENST00000357948ENST00000492590CADPSchr3

62860264

-FHITchr3

59908140

-
5CDS-5UTRENST00000357948ENST00000466788CADPSchr3

62860264

-FHITchr3

59908140

-
5CDS-5UTRENST00000357948ENST00000468189CADPSchr3

62860264

-FHITchr3

59908140

-
5CDS-5UTRENST00000357948ENST00000341848CADPSchr3

62860264

-FHITchr3

59908140

-
In-frameENST00000283269ENST00000476844CADPSchr3

62860264

-FHITchr3

59908140

-
In-frameENST00000283269ENST00000492590CADPSchr3

62860264

-FHITchr3

59908140

-
5CDS-5UTRENST00000283269ENST00000466788CADPSchr3

62860264

-FHITchr3

59908140

-
5CDS-5UTRENST00000283269ENST00000468189CADPSchr3

62860264

-FHITchr3

59908140

-
5CDS-5UTRENST00000283269ENST00000341848CADPSchr3

62860264

-FHITchr3

59908140

-
In-frameENST00000490353ENST00000476844CADPSchr3

62860264

-FHITchr3

59908140

-
In-frameENST00000490353ENST00000492590CADPSchr3

62860264

-FHITchr3

59908140

-
5CDS-5UTRENST00000490353ENST00000466788CADPSchr3

62860264

-FHITchr3

59908140

-
5CDS-5UTRENST00000490353ENST00000468189CADPSchr3

62860264

-FHITchr3

59908140

-
5CDS-5UTRENST00000490353ENST00000341848CADPSchr3

62860264

-FHITchr3

59908140

-
intron-3CDSENST00000462768ENST00000476844CADPSchr3

62860264

-FHITchr3

59908140

-
intron-3CDSENST00000462768ENST00000492590CADPSchr3

62860264

-FHITchr3

59908140

-
intron-5UTRENST00000462768ENST00000466788CADPSchr3

62860264

-FHITchr3

59908140

-
intron-5UTRENST00000462768ENST00000468189CADPSchr3

62860264

-FHITchr3

59908140

-
intron-5UTRENST00000462768ENST00000341848CADPSchr3

62860264

-FHITchr3

59908140

-

Top

FusionProtFeatures for CADPS_FHIT


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CADPS

Q9ULU8

FHIT

P49789

Calcium-binding protein involved in exocytosis ofvesicles filled with neurotransmitters and neuropeptides. Probablyacts upstream of fusion in the biogenesis or maintenance of maturesecretory vesicles. Regulates catecholamine loading of DCVs. Mayspecifically mediate the Ca(2+)-dependent exocytosis of largedense-core vesicles (DCVs) and other dense-core vesicles by actingas a PtdIns(4,5)P2-binding protein that acts at prefusion stepfollowing ATP-dependent priming and participates in DCVs-membranefusion. However, it may also participate in small clear synapticvesicles (SVs) exocytosis and it is unclear whether its functionis related to Ca(2+) triggering (By similarity). {ECO:0000250}. Cleaves P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A)to yield AMP and ADP. Can also hydrolyze P(1)-P(4)-bis(5'-adenosyl) tetraphosphate (Ap4A), but has extremely low activitywith ATP. Modulates transcriptional activation by CTNNB1 andthereby contributes to regulate the expression of genes essentialfor cell proliferation and survival, such as CCND1 and BIRC5.Plays a role in the induction of apoptosis via SRC and AKT1signaling pathways. Inhibits MDM2-mediated proteasomal degradationof p53/TP53 and thereby plays a role in p53/TP53-mediatedapoptosis. Induction of apoptosis depends on the ability of FHITto bind P(1)-P(3)-bis(5'-adenosyl) triphosphate or relatedcompounds, but does not require its catalytic activity, it may inpart come from the mitochondrial form, which sensitizes the low-affinity Ca(2+) transporters, enhancing mitochondrial calciumuptake. Functions as tumor suppressor.{ECO:0000269|PubMed:12574506, ECO:0000269|PubMed:15313915,ECO:0000269|PubMed:16407838, ECO:0000269|PubMed:18077326,ECO:0000269|PubMed:19622739, ECO:0000269|PubMed:8794732,ECO:0000269|PubMed:9323207}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneFHITchr3:62860264chr3:59908140ENST00000341848-2594_9893148MotifHistidine triad motif
TgeneFHITchr3:62860264chr3:59908140ENST00000468189-6994_9893148MotifHistidine triad motif
TgeneFHITchr3:62860264chr3:59908140ENST00000476844-61094_9893214MotifHistidine triad motif
TgeneFHITchr3:62860264chr3:59908140ENST00000492590-61094_9893205MotifHistidine triad motif

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCADPSchr3:62860264chr3:59908140ENST00000283269-128400_4811471315DomainNote=C2
HgeneCADPSchr3:62860264chr3:59908140ENST00000283269-128521_6241471315DomainPH
HgeneCADPSchr3:62860264chr3:59908140ENST00000283269-128931_11111471315DomainMHD1
HgeneCADPSchr3:62860264chr3:59908140ENST00000357948-127400_4811471275DomainNote=C2
HgeneCADPSchr3:62860264chr3:59908140ENST00000357948-127521_6241471275DomainPH
HgeneCADPSchr3:62860264chr3:59908140ENST00000357948-127931_11111471275DomainMHD1
HgeneCADPSchr3:62860264chr3:59908140ENST00000383710-130400_4811471354DomainNote=C2
HgeneCADPSchr3:62860264chr3:59908140ENST00000383710-130521_6241471354DomainPH
HgeneCADPSchr3:62860264chr3:59908140ENST00000383710-130931_11111471354DomainMHD1
HgeneCADPSchr3:62860264chr3:59908140ENST00000490353-17400_481147458DomainNote=C2
HgeneCADPSchr3:62860264chr3:59908140ENST00000490353-17521_624147458DomainPH
HgeneCADPSchr3:62860264chr3:59908140ENST00000490353-17931_1111147458DomainMHD1
HgeneCADPSchr3:62860264chr3:59908140ENST00000283269-1281177_13531471315RegionMediates targeting and association with DCVs
HgeneCADPSchr3:62860264chr3:59908140ENST00000357948-1271177_13531471275RegionMediates targeting and association with DCVs
HgeneCADPSchr3:62860264chr3:59908140ENST00000383710-1301177_13531471354RegionMediates targeting and association with DCVs
HgeneCADPSchr3:62860264chr3:59908140ENST00000490353-171177_1353147458RegionMediates targeting and association with DCVs
TgeneFHITchr3:62860264chr3:59908140ENST00000341848-252_10993148DomainHIT
TgeneFHITchr3:62860264chr3:59908140ENST00000468189-692_10993148DomainHIT
TgeneFHITchr3:62860264chr3:59908140ENST00000476844-6102_10993214DomainHIT
TgeneFHITchr3:62860264chr3:59908140ENST00000492590-6102_10993205DomainHIT
TgeneFHITchr3:62860264chr3:59908140ENST00000341848-2589_9293148Nucleotide bindingSubstrate
TgeneFHITchr3:62860264chr3:59908140ENST00000468189-6989_9293148Nucleotide bindingSubstrate
TgeneFHITchr3:62860264chr3:59908140ENST00000476844-61089_9293214Nucleotide bindingSubstrate
TgeneFHITchr3:62860264chr3:59908140ENST00000492590-61089_9293205Nucleotide bindingSubstrate


Top

FusionGeneSequence for CADPS_FHIT


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CADPS_ENST00000383710_chr3_62860264_-_FHIT_ENST00000476844_chr3_59908140_-_202aa
MLDPSSSEEESDEIVEEESGKEVLGSAPSGARLSPSRTSEGSAGSAGLGGGGAGAGAGVGAGGGGGSGASSGGGAGGLQPSSRAGGGRPS
SPSPSVVSEKEKEELERLQKEEEERKKRLQLTVFVMRCIAYPFNAKQPTDMARRQQKHVHVHVLPRKAGDFHRNDSITEELQKHDKEDFP

>In-frame_CADPS_ENST00000383710_chr3_62860264_-_FHIT_ENST00000492590_chr3_59908140_-_202aa
MLDPSSSEEESDEIVEEESGKEVLGSAPSGARLSPSRTSEGSAGSAGLGGGGAGAGAGVGAGGGGGSGASSGGGAGGLQPSSRAGGGRPS
SPSPSVVSEKEKEELERLQKEEEERKKRLQLTVFVMRCIAYPFNAKQPTDMARRQQKHVHVHVLPRKAGDFHRNDSITEELQKHDKEDFP

>In-frame_CADPS_ENST00000357948_chr3_62860264_-_FHIT_ENST00000476844_chr3_59908140_-_202aa
MLDPSSSEEESDEIVEEESGKEVLGSAPSGARLSPSRTSEGSAGSAGLGGGGAGAGAGVGAGGGGGSGASSGGGAGGLQPSSRAGGGRPS
SPSPSVVSEKEKEELERLQKEEEERKKRLQLTVFVMRCIAYPFNAKQPTDMARRQQKHVHVHVLPRKAGDFHRNDSITEELQKHDKEDFP

>In-frame_CADPS_ENST00000357948_chr3_62860264_-_FHIT_ENST00000492590_chr3_59908140_-_202aa
MLDPSSSEEESDEIVEEESGKEVLGSAPSGARLSPSRTSEGSAGSAGLGGGGAGAGAGVGAGGGGGSGASSGGGAGGLQPSSRAGGGRPS
SPSPSVVSEKEKEELERLQKEEEERKKRLQLTVFVMRCIAYPFNAKQPTDMARRQQKHVHVHVLPRKAGDFHRNDSITEELQKHDKEDFP

>In-frame_CADPS_ENST00000283269_chr3_62860264_-_FHIT_ENST00000476844_chr3_59908140_-_202aa
MLDPSSSEEESDEIVEEESGKEVLGSAPSGARLSPSRTSEGSAGSAGLGGGGAGAGAGVGAGGGGGSGASSGGGAGGLQPSSRAGGGRPS
SPSPSVVSEKEKEELERLQKEEEERKKRLQLTVFVMRCIAYPFNAKQPTDMARRQQKHVHVHVLPRKAGDFHRNDSITEELQKHDKEDFP

>In-frame_CADPS_ENST00000283269_chr3_62860264_-_FHIT_ENST00000492590_chr3_59908140_-_202aa
MLDPSSSEEESDEIVEEESGKEVLGSAPSGARLSPSRTSEGSAGSAGLGGGGAGAGAGVGAGGGGGSGASSGGGAGGLQPSSRAGGGRPS
SPSPSVVSEKEKEELERLQKEEEERKKRLQLTVFVMRCIAYPFNAKQPTDMARRQQKHVHVHVLPRKAGDFHRNDSITEELQKHDKEDFP

>In-frame_CADPS_ENST00000490353_chr3_62860264_-_FHIT_ENST00000476844_chr3_59908140_-_202aa
MLDPSSSEEESDEIVEEESGKEVLGSAPSGARLSPSRTSEGSAGSAGLGGGGAGAGAGVGAGGGGGSGASSGGGAGGLQPSSRAGGGRPS
SPSPSVVSEKEKEELERLQKEEEERKKRLQLTVFVMRCIAYPFNAKQPTDMARRQQKHVHVHVLPRKAGDFHRNDSITEELQKHDKEDFP

>In-frame_CADPS_ENST00000490353_chr3_62860264_-_FHIT_ENST00000492590_chr3_59908140_-_202aa
MLDPSSSEEESDEIVEEESGKEVLGSAPSGARLSPSRTSEGSAGSAGLGGGGAGAGAGVGAGGGGGSGASSGGGAGGLQPSSRAGGGRPS
SPSPSVVSEKEKEELERLQKEEEERKKRLQLTVFVMRCIAYPFNAKQPTDMARRQQKHVHVHVLPRKAGDFHRNDSITEELQKHDKEDFP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CADPS_ENST00000383710_chr3_62860264_-_FHIT_ENST00000476844_chr3_59908140_-_606nt
ATGCTGGACCCTTCGTCCAGCGAAGAAGAATCGGATGAGATCGTGGAGGAGGAGAGCGGCAAGGAGGTGCTCGGCTCGGCCCCGTCCGGC
GCGCGCCTGTCTCCCAGCCGTACCAGCGAGGGCTCGGCCGGCAGCGCCGGGCTGGGGGGCGGCGGCGCCGGCGCCGGAGCCGGGGTGGGT
GCAGGCGGCGGCGGGGGCAGCGGCGCGAGCAGCGGCGGCGGGGCCGGGGGGCTGCAACCCAGCAGCCGCGCTGGCGGCGGCCGGCCCTCC
AGCCCCAGCCCGTCGGTGGTGAGCGAGAAGGAGAAGGAAGAGTTGGAGCGGCTGCAGAAAGAGGAGGAGGAGAGGAAGAAGAGGCTGCAG
CTGTATGTGTTCGTGATGCGCTGCATCGCCTACCCCTTTAATGCCAAGCAGCCCACCGACATGGCTCGCCGGCAGCAGAAGCACGTTCAC
GTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCT

>In-frame_CADPS_ENST00000383710_chr3_62860264_-_FHIT_ENST00000492590_chr3_59908140_-_606nt
ATGCTGGACCCTTCGTCCAGCGAAGAAGAATCGGATGAGATCGTGGAGGAGGAGAGCGGCAAGGAGGTGCTCGGCTCGGCCCCGTCCGGC
GCGCGCCTGTCTCCCAGCCGTACCAGCGAGGGCTCGGCCGGCAGCGCCGGGCTGGGGGGCGGCGGCGCCGGCGCCGGAGCCGGGGTGGGT
GCAGGCGGCGGCGGGGGCAGCGGCGCGAGCAGCGGCGGCGGGGCCGGGGGGCTGCAACCCAGCAGCCGCGCTGGCGGCGGCCGGCCCTCC
AGCCCCAGCCCGTCGGTGGTGAGCGAGAAGGAGAAGGAAGAGTTGGAGCGGCTGCAGAAAGAGGAGGAGGAGAGGAAGAAGAGGCTGCAG
CTGTATGTGTTCGTGATGCGCTGCATCGCCTACCCCTTTAATGCCAAGCAGCCCACCGACATGGCTCGCCGGCAGCAGAAGCACGTTCAC
GTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCT

>In-frame_CADPS_ENST00000357948_chr3_62860264_-_FHIT_ENST00000476844_chr3_59908140_-_606nt
ATGCTGGACCCTTCGTCCAGCGAAGAAGAATCGGATGAGATCGTGGAGGAGGAGAGCGGCAAGGAGGTGCTCGGCTCGGCCCCGTCCGGC
GCGCGCCTGTCTCCCAGCCGTACCAGCGAGGGCTCGGCCGGCAGCGCCGGGCTGGGGGGCGGCGGCGCCGGCGCCGGAGCCGGGGTGGGT
GCAGGCGGCGGCGGGGGCAGCGGCGCGAGCAGCGGCGGCGGGGCCGGGGGGCTGCAACCCAGCAGCCGCGCTGGCGGCGGCCGGCCCTCC
AGCCCCAGCCCGTCGGTGGTGAGCGAGAAGGAGAAGGAAGAGTTGGAGCGGCTGCAGAAAGAGGAGGAGGAGAGGAAGAAGAGGCTGCAG
CTGTATGTGTTCGTGATGCGCTGCATCGCCTACCCCTTTAATGCCAAGCAGCCCACCGACATGGCTCGCCGGCAGCAGAAGCACGTTCAC
GTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCT

>In-frame_CADPS_ENST00000357948_chr3_62860264_-_FHIT_ENST00000492590_chr3_59908140_-_606nt
ATGCTGGACCCTTCGTCCAGCGAAGAAGAATCGGATGAGATCGTGGAGGAGGAGAGCGGCAAGGAGGTGCTCGGCTCGGCCCCGTCCGGC
GCGCGCCTGTCTCCCAGCCGTACCAGCGAGGGCTCGGCCGGCAGCGCCGGGCTGGGGGGCGGCGGCGCCGGCGCCGGAGCCGGGGTGGGT
GCAGGCGGCGGCGGGGGCAGCGGCGCGAGCAGCGGCGGCGGGGCCGGGGGGCTGCAACCCAGCAGCCGCGCTGGCGGCGGCCGGCCCTCC
AGCCCCAGCCCGTCGGTGGTGAGCGAGAAGGAGAAGGAAGAGTTGGAGCGGCTGCAGAAAGAGGAGGAGGAGAGGAAGAAGAGGCTGCAG
CTGTATGTGTTCGTGATGCGCTGCATCGCCTACCCCTTTAATGCCAAGCAGCCCACCGACATGGCTCGCCGGCAGCAGAAGCACGTTCAC
GTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCT

>In-frame_CADPS_ENST00000283269_chr3_62860264_-_FHIT_ENST00000476844_chr3_59908140_-_606nt
ATGCTGGACCCTTCGTCCAGCGAAGAAGAATCGGATGAGATCGTGGAGGAGGAGAGCGGCAAGGAGGTGCTCGGCTCGGCCCCGTCCGGC
GCGCGCCTGTCTCCCAGCCGTACCAGCGAGGGCTCGGCCGGCAGCGCCGGGCTGGGGGGCGGCGGCGCCGGCGCCGGAGCCGGGGTGGGT
GCAGGCGGCGGCGGGGGCAGCGGCGCGAGCAGCGGCGGCGGGGCCGGGGGGCTGCAACCCAGCAGCCGCGCTGGCGGCGGCCGGCCCTCC
AGCCCCAGCCCGTCGGTGGTGAGCGAGAAGGAGAAGGAAGAGTTGGAGCGGCTGCAGAAAGAGGAGGAGGAGAGGAAGAAGAGGCTGCAG
CTGTATGTGTTCGTGATGCGCTGCATCGCCTACCCCTTTAATGCCAAGCAGCCCACCGACATGGCTCGCCGGCAGCAGAAGCACGTTCAC
GTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCT

>In-frame_CADPS_ENST00000283269_chr3_62860264_-_FHIT_ENST00000492590_chr3_59908140_-_606nt
ATGCTGGACCCTTCGTCCAGCGAAGAAGAATCGGATGAGATCGTGGAGGAGGAGAGCGGCAAGGAGGTGCTCGGCTCGGCCCCGTCCGGC
GCGCGCCTGTCTCCCAGCCGTACCAGCGAGGGCTCGGCCGGCAGCGCCGGGCTGGGGGGCGGCGGCGCCGGCGCCGGAGCCGGGGTGGGT
GCAGGCGGCGGCGGGGGCAGCGGCGCGAGCAGCGGCGGCGGGGCCGGGGGGCTGCAACCCAGCAGCCGCGCTGGCGGCGGCCGGCCCTCC
AGCCCCAGCCCGTCGGTGGTGAGCGAGAAGGAGAAGGAAGAGTTGGAGCGGCTGCAGAAAGAGGAGGAGGAGAGGAAGAAGAGGCTGCAG
CTGTATGTGTTCGTGATGCGCTGCATCGCCTACCCCTTTAATGCCAAGCAGCCCACCGACATGGCTCGCCGGCAGCAGAAGCACGTTCAC
GTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCT

>In-frame_CADPS_ENST00000490353_chr3_62860264_-_FHIT_ENST00000476844_chr3_59908140_-_606nt
ATGCTGGACCCTTCGTCCAGCGAAGAAGAATCGGATGAGATCGTGGAGGAGGAGAGCGGCAAGGAGGTGCTCGGCTCGGCCCCGTCCGGC
GCGCGCCTGTCTCCCAGCCGTACCAGCGAGGGCTCGGCCGGCAGCGCCGGGCTGGGGGGCGGCGGCGCCGGCGCCGGAGCCGGGGTGGGT
GCAGGCGGCGGCGGGGGCAGCGGCGCGAGCAGCGGCGGCGGGGCCGGGGGGCTGCAACCCAGCAGCCGCGCTGGCGGCGGCCGGCCCTCC
AGCCCCAGCCCGTCGGTGGTGAGCGAGAAGGAGAAGGAAGAGTTGGAGCGGCTGCAGAAAGAGGAGGAGGAGAGGAAGAAGAGGCTGCAG
CTGTATGTGTTCGTGATGCGCTGCATCGCCTACCCCTTTAATGCCAAGCAGCCCACCGACATGGCTCGCCGGCAGCAGAAGCACGTTCAC
GTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCT

>In-frame_CADPS_ENST00000490353_chr3_62860264_-_FHIT_ENST00000492590_chr3_59908140_-_606nt
ATGCTGGACCCTTCGTCCAGCGAAGAAGAATCGGATGAGATCGTGGAGGAGGAGAGCGGCAAGGAGGTGCTCGGCTCGGCCCCGTCCGGC
GCGCGCCTGTCTCCCAGCCGTACCAGCGAGGGCTCGGCCGGCAGCGCCGGGCTGGGGGGCGGCGGCGCCGGCGCCGGAGCCGGGGTGGGT
GCAGGCGGCGGCGGGGGCAGCGGCGCGAGCAGCGGCGGCGGGGCCGGGGGGCTGCAACCCAGCAGCCGCGCTGGCGGCGGCCGGCCCTCC
AGCCCCAGCCCGTCGGTGGTGAGCGAGAAGGAGAAGGAAGAGTTGGAGCGGCTGCAGAAAGAGGAGGAGGAGAGGAAGAAGAGGCTGCAG
CTGTATGTGTTCGTGATGCGCTGCATCGCCTACCCCTTTAATGCCAAGCAGCCCACCGACATGGCTCGCCGGCAGCAGAAGCACGTTCAC
GTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_CADPS_ENST00000383710_chr3_62860264_-_FHIT_ENST00000476844_chr3_59908140_-_1220nt
ACAGCTTGCAACACTCGGCATCTTTTCTGGAGGCGCCTCCTTCAGCAGCCGCAGATGGCATCCGGCTGCGGGCTCGGGGCTCGCAATTGA
TTCTCCCCCTTGCCCACCTCGAGTCCACGGACGCACCTCTCCCTTCCCCTCCTCCCTTCGCGCTTCTGGGTCTGAGCCCAGCTCGCGACC
GCCGGGCAGAGGATCAGTCGCGGCGGCCGAGGCTGAGCAGCAGCGCTCTCGCTCCCTGACCTGGGGAGAAGCGCCCACCCGGGAGAGCTG
ATCCCCGGCTGCCTCCAGCGCCCCCCACCTTTTGCACTCCAAGCCGGGGGCTCCAGAGACCCCGCTCCCCAGGCGCCACTATGCTGGACC
CTTCGTCCAGCGAAGAAGAATCGGATGAGATCGTGGAGGAGGAGAGCGGCAAGGAGGTGCTCGGCTCGGCCCCGTCCGGCGCGCGCCTGT
CTCCCAGCCGTACCAGCGAGGGCTCGGCCGGCAGCGCCGGGCTGGGGGGCGGCGGCGCCGGCGCCGGAGCCGGGGTGGGTGCAGGCGGCG
GCGGGGGCAGCGGCGCGAGCAGCGGCGGCGGGGCCGGGGGGCTGCAACCCAGCAGCCGCGCTGGCGGCGGCCGGCCCTCCAGCCCCAGCC
CGTCGGTGGTGAGCGAGAAGGAGAAGGAAGAGTTGGAGCGGCTGCAGAAAGAGGAGGAGGAGAGGAAGAAGAGGCTGCAGCTGTATGTGT
TCGTGATGCGCTGCATCGCCTACCCCTTTAATGCCAAGCAGCCCACCGACATGGCTCGCCGGCAGCAGAAGCACGTTCACGTCCATGTTC
TTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCTGCCTCTTGGA
GATCAGAGGAGGAAATGGCAGCAGAAGCCGCAGCTCTGCGGGTCTACTTTCAGTGACACAGATCCTGAATTCCAGCAAAAGAGCTATTGC
CAACCAGTTTGAAGACCGCCCCCCGCCTCTCCCCAAGAGGAACTGAATCAGCATGAAAATGCAGTTTCTTCATCTCACCATCCTGTATTC
TTCAACCAGTGATCCCCCACCTCGGTCACTCCAACTCCCTTAAAATACCTAGACCTAAACGGCTCAGACAGGCAGATTTGAGGTTTCCCC

>In-frame_CADPS_ENST00000383710_chr3_62860264_-_FHIT_ENST00000492590_chr3_59908140_-_1231nt
ACAGCTTGCAACACTCGGCATCTTTTCTGGAGGCGCCTCCTTCAGCAGCCGCAGATGGCATCCGGCTGCGGGCTCGGGGCTCGCAATTGA
TTCTCCCCCTTGCCCACCTCGAGTCCACGGACGCACCTCTCCCTTCCCCTCCTCCCTTCGCGCTTCTGGGTCTGAGCCCAGCTCGCGACC
GCCGGGCAGAGGATCAGTCGCGGCGGCCGAGGCTGAGCAGCAGCGCTCTCGCTCCCTGACCTGGGGAGAAGCGCCCACCCGGGAGAGCTG
ATCCCCGGCTGCCTCCAGCGCCCCCCACCTTTTGCACTCCAAGCCGGGGGCTCCAGAGACCCCGCTCCCCAGGCGCCACTATGCTGGACC
CTTCGTCCAGCGAAGAAGAATCGGATGAGATCGTGGAGGAGGAGAGCGGCAAGGAGGTGCTCGGCTCGGCCCCGTCCGGCGCGCGCCTGT
CTCCCAGCCGTACCAGCGAGGGCTCGGCCGGCAGCGCCGGGCTGGGGGGCGGCGGCGCCGGCGCCGGAGCCGGGGTGGGTGCAGGCGGCG
GCGGGGGCAGCGGCGCGAGCAGCGGCGGCGGGGCCGGGGGGCTGCAACCCAGCAGCCGCGCTGGCGGCGGCCGGCCCTCCAGCCCCAGCC
CGTCGGTGGTGAGCGAGAAGGAGAAGGAAGAGTTGGAGCGGCTGCAGAAAGAGGAGGAGGAGAGGAAGAAGAGGCTGCAGCTGTATGTGT
TCGTGATGCGCTGCATCGCCTACCCCTTTAATGCCAAGCAGCCCACCGACATGGCTCGCCGGCAGCAGAAGCACGTTCACGTCCATGTTC
TTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCTGCCTCTTGGA
GATCAGAGGAGGAAATGGCAGCAGAAGCCGCAGCTCTGCGGGTCTACTTTCAGTGACACAGATGTTTTTCAGATCCTGAATTCCAGCAAA
AGAGCTATTGCCAACCAGTTTGAAGACCGCCCCCCGCCTCTCCCCAAGAGGAACTGAATCAGCATGAAAATGCAGTTTCTTCATCTCACC
ATCCTGTATTCTTCAACCAGTGATCCCCCACCTCGGTCACTCCAACTCCCTTAAAATACCTAGACCTAAACGGCTCAGACAGGCAGATTT

>In-frame_CADPS_ENST00000357948_chr3_62860264_-_FHIT_ENST00000476844_chr3_59908140_-_1179nt
TCAGCAGCCGCAGATGGCATCCGGCTGCGGGCTCGGGGCTCGCAATTGATTCTCCCCCTTGCCCACCTCGAGTCCACGGACGCACCTCTC
CCTTCCCCTCCTCCCTTCGCGCTTCTGGGTCTGAGCCCAGCTCGCGACCGCCGGGCAGAGGATCAGTCGCGGCGGCCGAGGCTGAGCAGC
AGCGCTCTCGCTCCCTGACCTGGGGAGAAGCGCCCACCCGGGAGAGCTGATCCCCGGCTGCCTCCAGCGCCCCCCACCTTTTGCACTCCA
AGCCGGGGGCTCCAGAGACCCCGCTCCCCAGGCGCCACTATGCTGGACCCTTCGTCCAGCGAAGAAGAATCGGATGAGATCGTGGAGGAG
GAGAGCGGCAAGGAGGTGCTCGGCTCGGCCCCGTCCGGCGCGCGCCTGTCTCCCAGCCGTACCAGCGAGGGCTCGGCCGGCAGCGCCGGG
CTGGGGGGCGGCGGCGCCGGCGCCGGAGCCGGGGTGGGTGCAGGCGGCGGCGGGGGCAGCGGCGCGAGCAGCGGCGGCGGGGCCGGGGGG
CTGCAACCCAGCAGCCGCGCTGGCGGCGGCCGGCCCTCCAGCCCCAGCCCGTCGGTGGTGAGCGAGAAGGAGAAGGAAGAGTTGGAGCGG
CTGCAGAAAGAGGAGGAGGAGAGGAAGAAGAGGCTGCAGCTGTATGTGTTCGTGATGCGCTGCATCGCCTACCCCTTTAATGCCAAGCAG
CCCACCGACATGGCTCGCCGGCAGCAGAAGCACGTTCACGTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATC
TATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCTGCCTCTTGGAGATCAGAGGAGGAAATGGCAGCAGAAGCCGCAGCTCTGCGG
GTCTACTTTCAGTGACACAGATCCTGAATTCCAGCAAAAGAGCTATTGCCAACCAGTTTGAAGACCGCCCCCCGCCTCTCCCCAAGAGGA
ACTGAATCAGCATGAAAATGCAGTTTCTTCATCTCACCATCCTGTATTCTTCAACCAGTGATCCCCCACCTCGGTCACTCCAACTCCCTT
AAAATACCTAGACCTAAACGGCTCAGACAGGCAGATTTGAGGTTTCCCCCTGTCTCCTTATTCGGCAGCCTTATGATTAAACTTCCTTCT

>In-frame_CADPS_ENST00000357948_chr3_62860264_-_FHIT_ENST00000492590_chr3_59908140_-_1190nt
TCAGCAGCCGCAGATGGCATCCGGCTGCGGGCTCGGGGCTCGCAATTGATTCTCCCCCTTGCCCACCTCGAGTCCACGGACGCACCTCTC
CCTTCCCCTCCTCCCTTCGCGCTTCTGGGTCTGAGCCCAGCTCGCGACCGCCGGGCAGAGGATCAGTCGCGGCGGCCGAGGCTGAGCAGC
AGCGCTCTCGCTCCCTGACCTGGGGAGAAGCGCCCACCCGGGAGAGCTGATCCCCGGCTGCCTCCAGCGCCCCCCACCTTTTGCACTCCA
AGCCGGGGGCTCCAGAGACCCCGCTCCCCAGGCGCCACTATGCTGGACCCTTCGTCCAGCGAAGAAGAATCGGATGAGATCGTGGAGGAG
GAGAGCGGCAAGGAGGTGCTCGGCTCGGCCCCGTCCGGCGCGCGCCTGTCTCCCAGCCGTACCAGCGAGGGCTCGGCCGGCAGCGCCGGG
CTGGGGGGCGGCGGCGCCGGCGCCGGAGCCGGGGTGGGTGCAGGCGGCGGCGGGGGCAGCGGCGCGAGCAGCGGCGGCGGGGCCGGGGGG
CTGCAACCCAGCAGCCGCGCTGGCGGCGGCCGGCCCTCCAGCCCCAGCCCGTCGGTGGTGAGCGAGAAGGAGAAGGAAGAGTTGGAGCGG
CTGCAGAAAGAGGAGGAGGAGAGGAAGAAGAGGCTGCAGCTGTATGTGTTCGTGATGCGCTGCATCGCCTACCCCTTTAATGCCAAGCAG
CCCACCGACATGGCTCGCCGGCAGCAGAAGCACGTTCACGTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATC
TATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCTGCCTCTTGGAGATCAGAGGAGGAAATGGCAGCAGAAGCCGCAGCTCTGCGG
GTCTACTTTCAGTGACACAGATGTTTTTCAGATCCTGAATTCCAGCAAAAGAGCTATTGCCAACCAGTTTGAAGACCGCCCCCCGCCTCT
CCCCAAGAGGAACTGAATCAGCATGAAAATGCAGTTTCTTCATCTCACCATCCTGTATTCTTCAACCAGTGATCCCCCACCTCGGTCACT
CCAACTCCCTTAAAATACCTAGACCTAAACGGCTCAGACAGGCAGATTTGAGGTTTCCCCCTGTCTCCTTATTCGGCAGCCTTATGATTA

>In-frame_CADPS_ENST00000283269_chr3_62860264_-_FHIT_ENST00000476844_chr3_59908140_-_1082nt
CTCCTCCCTTCGCGCTTCTGGGTCTGAGCCCAGCTCGCGACCGCCGGGCAGAGGATCAGTCGCGGCGGCCGAGGCTGAGCAGCAGCGCTC
TCGCTCCCTGACCTGGGGAGAAGCGCCCACCCGGGAGAGCTGATCCCCGGCTGCCTCCAGCGCCCCCCACCTTTTGCACTCCAAGCCGGG
GGCTCCAGAGACCCCGCTCCCCAGGCGCCACTATGCTGGACCCTTCGTCCAGCGAAGAAGAATCGGATGAGATCGTGGAGGAGGAGAGCG
GCAAGGAGGTGCTCGGCTCGGCCCCGTCCGGCGCGCGCCTGTCTCCCAGCCGTACCAGCGAGGGCTCGGCCGGCAGCGCCGGGCTGGGGG
GCGGCGGCGCCGGCGCCGGAGCCGGGGTGGGTGCAGGCGGCGGCGGGGGCAGCGGCGCGAGCAGCGGCGGCGGGGCCGGGGGGCTGCAAC
CCAGCAGCCGCGCTGGCGGCGGCCGGCCCTCCAGCCCCAGCCCGTCGGTGGTGAGCGAGAAGGAGAAGGAAGAGTTGGAGCGGCTGCAGA
AAGAGGAGGAGGAGAGGAAGAAGAGGCTGCAGCTGTATGTGTTCGTGATGCGCTGCATCGCCTACCCCTTTAATGCCAAGCAGCCCACCG
ACATGGCTCGCCGGCAGCAGAAGCACGTTCACGTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGG
AGCTCCAGAAACATGACAAGGAGGACTTTCCTGCCTCTTGGAGATCAGAGGAGGAAATGGCAGCAGAAGCCGCAGCTCTGCGGGTCTACT
TTCAGTGACACAGATCCTGAATTCCAGCAAAAGAGCTATTGCCAACCAGTTTGAAGACCGCCCCCCGCCTCTCCCCAAGAGGAACTGAAT
CAGCATGAAAATGCAGTTTCTTCATCTCACCATCCTGTATTCTTCAACCAGTGATCCCCCACCTCGGTCACTCCAACTCCCTTAAAATAC
CTAGACCTAAACGGCTCAGACAGGCAGATTTGAGGTTTCCCCCTGTCTCCTTATTCGGCAGCCTTATGATTAAACTTCCTTCTCTGCTGC

>In-frame_CADPS_ENST00000283269_chr3_62860264_-_FHIT_ENST00000492590_chr3_59908140_-_1093nt
CTCCTCCCTTCGCGCTTCTGGGTCTGAGCCCAGCTCGCGACCGCCGGGCAGAGGATCAGTCGCGGCGGCCGAGGCTGAGCAGCAGCGCTC
TCGCTCCCTGACCTGGGGAGAAGCGCCCACCCGGGAGAGCTGATCCCCGGCTGCCTCCAGCGCCCCCCACCTTTTGCACTCCAAGCCGGG
GGCTCCAGAGACCCCGCTCCCCAGGCGCCACTATGCTGGACCCTTCGTCCAGCGAAGAAGAATCGGATGAGATCGTGGAGGAGGAGAGCG
GCAAGGAGGTGCTCGGCTCGGCCCCGTCCGGCGCGCGCCTGTCTCCCAGCCGTACCAGCGAGGGCTCGGCCGGCAGCGCCGGGCTGGGGG
GCGGCGGCGCCGGCGCCGGAGCCGGGGTGGGTGCAGGCGGCGGCGGGGGCAGCGGCGCGAGCAGCGGCGGCGGGGCCGGGGGGCTGCAAC
CCAGCAGCCGCGCTGGCGGCGGCCGGCCCTCCAGCCCCAGCCCGTCGGTGGTGAGCGAGAAGGAGAAGGAAGAGTTGGAGCGGCTGCAGA
AAGAGGAGGAGGAGAGGAAGAAGAGGCTGCAGCTGTATGTGTTCGTGATGCGCTGCATCGCCTACCCCTTTAATGCCAAGCAGCCCACCG
ACATGGCTCGCCGGCAGCAGAAGCACGTTCACGTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGG
AGCTCCAGAAACATGACAAGGAGGACTTTCCTGCCTCTTGGAGATCAGAGGAGGAAATGGCAGCAGAAGCCGCAGCTCTGCGGGTCTACT
TTCAGTGACACAGATGTTTTTCAGATCCTGAATTCCAGCAAAAGAGCTATTGCCAACCAGTTTGAAGACCGCCCCCCGCCTCTCCCCAAG
AGGAACTGAATCAGCATGAAAATGCAGTTTCTTCATCTCACCATCCTGTATTCTTCAACCAGTGATCCCCCACCTCGGTCACTCCAACTC
CCTTAAAATACCTAGACCTAAACGGCTCAGACAGGCAGATTTGAGGTTTCCCCCTGTCTCCTTATTCGGCAGCCTTATGATTAAACTTCC

>In-frame_CADPS_ENST00000490353_chr3_62860264_-_FHIT_ENST00000476844_chr3_59908140_-_870nt
ATGCTGGACCCTTCGTCCAGCGAAGAAGAATCGGATGAGATCGTGGAGGAGGAGAGCGGCAAGGAGGTGCTCGGCTCGGCCCCGTCCGGC
GCGCGCCTGTCTCCCAGCCGTACCAGCGAGGGCTCGGCCGGCAGCGCCGGGCTGGGGGGCGGCGGCGCCGGCGCCGGAGCCGGGGTGGGT
GCAGGCGGCGGCGGGGGCAGCGGCGCGAGCAGCGGCGGCGGGGCCGGGGGGCTGCAACCCAGCAGCCGCGCTGGCGGCGGCCGGCCCTCC
AGCCCCAGCCCGTCGGTGGTGAGCGAGAAGGAGAAGGAAGAGTTGGAGCGGCTGCAGAAAGAGGAGGAGGAGAGGAAGAAGAGGCTGCAG
CTGTATGTGTTCGTGATGCGCTGCATCGCCTACCCCTTTAATGCCAAGCAGCCCACCGACATGGCTCGCCGGCAGCAGAAGCACGTTCAC
GTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCT
GCCTCTTGGAGATCAGAGGAGGAAATGGCAGCAGAAGCCGCAGCTCTGCGGGTCTACTTTCAGTGACACAGATCCTGAATTCCAGCAAAA
GAGCTATTGCCAACCAGTTTGAAGACCGCCCCCCGCCTCTCCCCAAGAGGAACTGAATCAGCATGAAAATGCAGTTTCTTCATCTCACCA
TCCTGTATTCTTCAACCAGTGATCCCCCACCTCGGTCACTCCAACTCCCTTAAAATACCTAGACCTAAACGGCTCAGACAGGCAGATTTG

>In-frame_CADPS_ENST00000490353_chr3_62860264_-_FHIT_ENST00000492590_chr3_59908140_-_881nt
ATGCTGGACCCTTCGTCCAGCGAAGAAGAATCGGATGAGATCGTGGAGGAGGAGAGCGGCAAGGAGGTGCTCGGCTCGGCCCCGTCCGGC
GCGCGCCTGTCTCCCAGCCGTACCAGCGAGGGCTCGGCCGGCAGCGCCGGGCTGGGGGGCGGCGGCGCCGGCGCCGGAGCCGGGGTGGGT
GCAGGCGGCGGCGGGGGCAGCGGCGCGAGCAGCGGCGGCGGGGCCGGGGGGCTGCAACCCAGCAGCCGCGCTGGCGGCGGCCGGCCCTCC
AGCCCCAGCCCGTCGGTGGTGAGCGAGAAGGAGAAGGAAGAGTTGGAGCGGCTGCAGAAAGAGGAGGAGGAGAGGAAGAAGAGGCTGCAG
CTGTATGTGTTCGTGATGCGCTGCATCGCCTACCCCTTTAATGCCAAGCAGCCCACCGACATGGCTCGCCGGCAGCAGAAGCACGTTCAC
GTCCATGTTCTTCCCAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGAGGAGCTCCAGAAACATGACAAGGAGGACTTTCCT
GCCTCTTGGAGATCAGAGGAGGAAATGGCAGCAGAAGCCGCAGCTCTGCGGGTCTACTTTCAGTGACACAGATGTTTTTCAGATCCTGAA
TTCCAGCAAAAGAGCTATTGCCAACCAGTTTGAAGACCGCCCCCCGCCTCTCCCCAAGAGGAACTGAATCAGCATGAAAATGCAGTTTCT
TCATCTCACCATCCTGTATTCTTCAACCAGTGATCCCCCACCTCGGTCACTCCAACTCCCTTAAAATACCTAGACCTAAACGGCTCAGAC


Top

FusionGenePPI for CADPS_FHIT


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CADPSKIAA1549, SDCBP, TCL1A, C19orf66, FAM161A, ZNF572, FAM9B, TTLL10, C17orf67, CLIP1FHITFHIT, UBE2I, CTNNB1, LEF1, TRIM23, RAB40B, MDM2, REL, TP53, ARHGAP19, MTMR6, RABL2A, CHEK1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneCADPSchr3:62860264chr3:59908140ENST00000283269-128790_11291471315DRD2
HgeneCADPSchr3:62860264chr3:59908140ENST00000357948-127790_11291471275DRD2
HgeneCADPSchr3:62860264chr3:59908140ENST00000383710-130790_11291471354DRD2
HgeneCADPSchr3:62860264chr3:59908140ENST00000490353-17790_1129147458DRD2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CADPS_FHIT


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneCADPSQ9ULU8DB11093Calcium CitrateCalcium-dependent secretion activator 1small moleculeapproved
HgeneCADPSQ9ULU8DB11348Calcium PhosphateCalcium-dependent secretion activator 1small moleculeapproved
TgeneFHITP49789DB04173FructoseBis(5'-adenosyl)-triphosphatasesmall moleculeapproved|experimental

Top

RelatedDiseases for CADPS_FHIT


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneFHITC0024121Lung Neoplasms2CTD_human
TgeneFHITC0025500Mesothelioma2CTD_human
TgeneFHITC0007131Non-Small Cell Lung Carcinoma1CTD_human
TgeneFHITC0023903Liver neoplasms1CTD_human
TgeneFHITC0033578Prostatic Neoplasms1CTD_human
TgeneFHITC0036341Schizophrenia1PSYGENET
TgeneFHITC0038356Stomach Neoplasms1CTD_human
TgeneFHITC0042076Urologic Neoplasms1CTD_human
TgeneFHITC0236733Amphetamine-Related Disorders1CTD_human
TgeneFHITC0236969Substance-Related Disorders1CTD_human