FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 5215

FusionGeneSummary for CACNA2D3_DAP3

check button Fusion gene summary
Fusion gene informationFusion gene name: CACNA2D3_DAP3
Fusion gene ID: 5215
HgeneTgene
Gene symbol

CACNA2D3

DAP3

Gene ID

55799

58512

Gene namecalcium voltage-gated channel auxiliary subunit alpha2delta 3DLG associated protein 3
SynonymsHSA272268DAP3|SAPAP3
Cytomap

3p21.1-p14.3

1p34.3

Type of geneprotein-codingprotein-coding
Descriptionvoltage-dependent calcium channel subunit alpha-2/delta-3calcium channel alpha2-delta3 subunitcalcium channel, voltage-dependent, alpha 2/delta 3 subunitcalcium channel, voltage-dependent, alpha 2/delta subunit 3voltage-gated calcium channel subunit adisks large-associated protein 3DAP-3PSD-95/SAP90-binding protein 3SAP90/PSD-95-associated protein 3discs large homolog associated protein 3
Modification date2018052220180519
UniProtAcc

Q8IZS8

P51398

Ensembl transtripts involved in fusion geneENST00000415676, ENST00000288197, 
ENST00000474759, ENST00000490478, 
ENST00000478261, 
ENST00000471642, 
ENST00000368336, ENST00000343043, 
ENST00000496863, ENST00000535183, 
ENST00000421487, ENST00000465375, 
Fusion gene scores* DoF score7 X 7 X 5=2453 X 2 X 2=12
# samples 73
** MAII scorelog2(7/245*10)=-1.8073549220576
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/12*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: CACNA2D3 [Title/Abstract] AND DAP3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-20-1684-01ACACNA2D3chr3

54676268

+DAP3chr1

155707948

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000415676ENST00000471642CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
In-frameENST00000415676ENST00000368336CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
Frame-shitENST00000415676ENST00000343043CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
5CDS-intronENST00000415676ENST00000496863CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
5CDS-intronENST00000415676ENST00000535183CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
5CDS-intronENST00000415676ENST00000421487CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
5CDS-intronENST00000415676ENST00000465375CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
Frame-shitENST00000288197ENST00000471642CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
In-frameENST00000288197ENST00000368336CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
Frame-shitENST00000288197ENST00000343043CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
5CDS-intronENST00000288197ENST00000496863CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
5CDS-intronENST00000288197ENST00000535183CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
5CDS-intronENST00000288197ENST00000421487CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
5CDS-intronENST00000288197ENST00000465375CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
Frame-shitENST00000474759ENST00000471642CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
In-frameENST00000474759ENST00000368336CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
Frame-shitENST00000474759ENST00000343043CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
5CDS-intronENST00000474759ENST00000496863CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
5CDS-intronENST00000474759ENST00000535183CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
5CDS-intronENST00000474759ENST00000421487CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
5CDS-intronENST00000474759ENST00000465375CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
Frame-shitENST00000490478ENST00000471642CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
In-frameENST00000490478ENST00000368336CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
Frame-shitENST00000490478ENST00000343043CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
5CDS-intronENST00000490478ENST00000496863CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
5CDS-intronENST00000490478ENST00000535183CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
5CDS-intronENST00000490478ENST00000421487CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
5CDS-intronENST00000490478ENST00000465375CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
intron-3CDSENST00000478261ENST00000471642CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
intron-3CDSENST00000478261ENST00000368336CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
intron-3CDSENST00000478261ENST00000343043CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
intron-intronENST00000478261ENST00000496863CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
intron-intronENST00000478261ENST00000535183CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
intron-intronENST00000478261ENST00000421487CACNA2D3chr3

54676268

+DAP3chr1

155707948

+
intron-intronENST00000478261ENST00000465375CACNA2D3chr3

54676268

+DAP3chr1

155707948

+

Top

FusionProtFeatures for CACNA2D3_DAP3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CACNA2D3

Q8IZS8

DAP3

P51398

The alpha-2/delta subunit of voltage-dependent calciumchannels regulates calcium current density andactivation/inactivation kinetics of the calcium channel. Acts as aregulatory subunit for P/Q-type calcium channel (CACNA1A), N-type(CACNA1B), L-type (CACNA1C OR CACNA1D) but not T-type (CACNA1G)(By similarity). {ECO:0000250}. Involved in mediating interferon-gamma-induced celldeath.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CACNA2D3_DAP3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CACNA2D3_ENST00000415676_chr3_54676268_+_DAP3_ENST00000368336_chr1_155707948_+_417aa
MAGPGSPRRASRGASALLAAALLYAALGDVVRSEQQIPLSVVKLWASAFGGEIKSIAAKYSGSQLLQKKYKETEKDVAIEEIDGLQLVKK
LAKNMEEMFHKKSEAVRRLVEAAEEAHLKHEFDADLQTEYFNAVLINERDKDGNFLELGKEFILAPNDHFNNLPVNISLSDVQVPTNMYN
KDPAIVNGVTWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQTPGIKWEPDENGVIAFDCRNRKWYIQAATSPKDVVILVDVSGSMKGL
RLTIAKQTVSSILDTLGDDDFFNIIATNEELHTVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNILSDFNHTGQGSI

>In-frame_CACNA2D3_ENST00000288197_chr3_54676268_+_DAP3_ENST00000368336_chr1_155707948_+_417aa
MAGPGSPRRASRGASALLAAALLYAALGDVVRSEQQIPLSVVKLWASAFGGEIKSIAAKYSGSQLLQKKYKETEKDVAIEEIDGLQLVKK
LAKNMEEMFHKKSEAVRRLVEAAEEAHLKHEFDADLQTEYFNAVLINERDKDGNFLELGKEFILAPNDHFNNLPVNISLSDVQVPTNMYN
KDPAIVNGVTWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQTPGIKWEPDENGVIAFDCRNRKWYIQAATSPKDVVILVDVSGSMKGL
RLTIAKQTVSSILDTLGDDDFFNIIATNEELHTVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNILSDFNHTGQGSI

>In-frame_CACNA2D3_ENST00000474759_chr3_54676268_+_DAP3_ENST00000368336_chr1_155707948_+_417aa
MAGPGSPRRASRGASALLAAALLYAALGDVVRSEQQIPLSVVKLWASAFGGEIKSIAAKYSGSQLLQKKYKETEKDVAIEEIDGLQLVKK
LAKNMEEMFHKKSEAVRRLVEAAEEAHLKHEFDADLQTEYFNAVLINERDKDGNFLELGKEFILAPNDHFNNLPVNISLSDVQVPTNMYN
KDPAIVNGVTWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQTPGIKWEPDENGVIAFDCRNRKWYIQAATSPKDVVILVDVSGSMKGL
RLTIAKQTVSSILDTLGDDDFFNIIATNEELHTVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNILSDFNHTGQGSI

>In-frame_CACNA2D3_ENST00000490478_chr3_54676268_+_DAP3_ENST00000368336_chr1_155707948_+_323aa
MEEMFHKKSEAVRRLVEAAEEAHLKHEFDADLQTEYFNAVLINERDKDGNFLELGKEFILAPNDHFNNLPVNISLSDVQVPTNMYNKDPA
IVNGVTWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQTPGIKWEPDENGVIAFDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTI
AKQTVSSILDTLGDDDFFNIIATNEELHTVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNILSDFNHTGQGSICSQA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CACNA2D3_ENST00000415676_chr3_54676268_+_DAP3_ENST00000368336_chr1_155707948_+_1253nt
ATGGCCGGGCCGGGCTCGCCGCGCCGCGCGTCCCGGGGGGCCTCGGCGCTTCTCGCTGCCGCGCTTCTCTACGCCGCGCTGGGGGACGTG
GTGCGCTCGGAGCAGCAGATACCGCTCTCCGTGGTGAAGCTCTGGGCCTCGGCTTTTGGTGGGGAGATAAAATCCATTGCTGCTAAGTAC
TCCGGTTCCCAGCTTCTGCAAAAGAAATACAAAGAGTATGAGAAAGACGTTGCCATAGAAGAAATTGATGGCCTCCAACTGGTAAAGAAG
CTGGCAAAGAACATGGAAGAGATGTTTCACAAGAAGTCTGAGGCCGTCAGGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACAT
GAATTTGATGCAGACTTACAGTATGAATACTTCAATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAG
GAATTCATCTTAGCCCCAAATGACCATTTTAATAATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAAC
AAAGACCCTGCAATTGTCAATGGGGTTTATTGGTCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATA
TGGCAGTACTTTGGAAGTGCAAAGGGCTTTTTTAGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGAC
TGCAGGAACCGAAAATGGTACATCCAGGCAGCAACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTC
CGTCTGACTATCGCGAAGCAAACAGTCTCATCCATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAG
CTTCACTATGTGGAACCTTGCCTGAATGGAACTTTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTT
TTCGCCAAAGGAATTGGAATGTTGGATATAGCTCTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATC
TGCAGTCAGGCCATCATGCTCATAACTGATGGGGCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGCTC

>In-frame_CACNA2D3_ENST00000288197_chr3_54676268_+_DAP3_ENST00000368336_chr1_155707948_+_1253nt
ATGGCCGGGCCGGGCTCGCCGCGCCGCGCGTCCCGGGGGGCCTCGGCGCTTCTCGCTGCCGCGCTTCTCTACGCCGCGCTGGGGGACGTG
GTGCGCTCGGAGCAGCAGATACCGCTCTCCGTGGTGAAGCTCTGGGCCTCGGCTTTTGGTGGGGAGATAAAATCCATTGCTGCTAAGTAC
TCCGGTTCCCAGCTTCTGCAAAAGAAATACAAAGAGTATGAGAAAGACGTTGCCATAGAAGAAATTGATGGCCTCCAACTGGTAAAGAAG
CTGGCAAAGAACATGGAAGAGATGTTTCACAAGAAGTCTGAGGCCGTCAGGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACAT
GAATTTGATGCAGACTTACAGTATGAATACTTCAATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAG
GAATTCATCTTAGCCCCAAATGACCATTTTAATAATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAAC
AAAGACCCTGCAATTGTCAATGGGGTTTATTGGTCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATA
TGGCAGTACTTTGGAAGTGCAAAGGGCTTTTTTAGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGAC
TGCAGGAACCGAAAATGGTACATCCAGGCAGCAACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTC
CGTCTGACTATCGCGAAGCAAACAGTCTCATCCATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAG
CTTCACTATGTGGAACCTTGCCTGAATGGAACTTTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTT
TTCGCCAAAGGAATTGGAATGTTGGATATAGCTCTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATC
TGCAGTCAGGCCATCATGCTCATAACTGATGGGGCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGCTC

>In-frame_CACNA2D3_ENST00000474759_chr3_54676268_+_DAP3_ENST00000368336_chr1_155707948_+_1253nt
ATGGCCGGGCCGGGCTCGCCGCGCCGCGCGTCCCGGGGGGCCTCGGCGCTTCTCGCTGCCGCGCTTCTCTACGCCGCGCTGGGGGACGTG
GTGCGCTCGGAGCAGCAGATACCGCTCTCCGTGGTGAAGCTCTGGGCCTCGGCTTTTGGTGGGGAGATAAAATCCATTGCTGCTAAGTAC
TCCGGTTCCCAGCTTCTGCAAAAGAAATACAAAGAGTATGAGAAAGACGTTGCCATAGAAGAAATTGATGGCCTCCAACTGGTAAAGAAG
CTGGCAAAGAACATGGAAGAGATGTTTCACAAGAAGTCTGAGGCCGTCAGGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACAT
GAATTTGATGCAGACTTACAGTATGAATACTTCAATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAG
GAATTCATCTTAGCCCCAAATGACCATTTTAATAATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAAC
AAAGACCCTGCAATTGTCAATGGGGTTTATTGGTCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATA
TGGCAGTACTTTGGAAGTGCAAAGGGCTTTTTTAGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGAC
TGCAGGAACCGAAAATGGTACATCCAGGCAGCAACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTC
CGTCTGACTATCGCGAAGCAAACAGTCTCATCCATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAG
CTTCACTATGTGGAACCTTGCCTGAATGGAACTTTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTT
TTCGCCAAAGGAATTGGAATGTTGGATATAGCTCTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATC
TGCAGTCAGGCCATCATGCTCATAACTGATGGGGCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGCTC

>In-frame_CACNA2D3_ENST00000490478_chr3_54676268_+_DAP3_ENST00000368336_chr1_155707948_+_971nt
ATGGAAGAGATGTTTCACAAGAAGTCTGAGGCCGTCAGGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGATGCA
GACTTACAGTATGAATACTTCAATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTA
GCCCCAAATGACCATTTTAATAATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCCTGCA
ATTGTCAATGGGGTTTATTGGTCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTT
GGAAGTGCAAAGGGCTTTTTTAGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAACCGA
AAATGGTACATCCAGGCAGCAACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATC
GCGAAGCAAACAGTCTCATCCATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTATGTG
GAACCTTGCCTGAATGGAACTTTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGA
ATTGGAATGTTGGATATAGCTCTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCAGGCC
ATCATGCTCATAACTGATGGGGCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGCTCCTACAGAAGAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_CACNA2D3_ENST00000415676_chr3_54676268_+_DAP3_ENST00000368336_chr1_155707948_+_2139nt
CACCCGCTCCTTTTTCTGCTCCCCAAGTGAGCCGGGCGCTCGCCCACCGCCCGCTCCGCGCAGCTCCCCGCGGCCGCTCTCGTCGCCGCC
GCAGCGGGCGCGTCGGAGGGAGCCCAGCATGGCCGGGCCGGGCTCGCCGCGCCGCGCGTCCCGGGGGGCCTCGGCGCTTCTCGCTGCCGC
GCTTCTCTACGCCGCGCTGGGGGACGTGGTGCGCTCGGAGCAGCAGATACCGCTCTCCGTGGTGAAGCTCTGGGCCTCGGCTTTTGGTGG
GGAGATAAAATCCATTGCTGCTAAGTACTCCGGTTCCCAGCTTCTGCAAAAGAAATACAAAGAGTATGAGAAAGACGTTGCCATAGAAGA
AATTGATGGCCTCCAACTGGTAAAGAAGCTGGCAAAGAACATGGAAGAGATGTTTCACAAGAAGTCTGAGGCCGTCAGGCGTCTGGTGGA
GGCTGCAGAAGAAGCACACCTGAAACATGAATTTGATGCAGACTTACAGTATGAATACTTCAATGCTGTGCTGATAAATGAAAGGGACAA
AGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCAAATGACCATTTTAATAATTTGCCTGTGAACATCAGTCTAAGTGA
CGTCCAAGTACCAACGAACATGTACAACAAAGACCCTGCAATTGTCAATGGGGTTTATTGGTCTGAATCTCTAAACAAAGTTTTTGTAGA
TAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGTGCAAAGGGCTTTTTTAGGCAGTATCCGGGGATTAAATGGGAACC
AGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAACCGAAAATGGTACATCCAGGCAGCAACTTCTCCGAAAGACGTGGTCATTTTAGT
TGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAGCAAACAGTCTCATCCATTTTGGATACACTTGGGGATGATGACTT
CTTCAACATAATTGCTTATAATGAGGAGCTTCACTATGTGGAACCTTGCCTGAATGGAACTTTGGTGCAAGCCGACAGGACAAACAAAGA
GCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGAATGTTGGATATAGCTCTGAATGAGGCCTTCAACATTCTGAGTGA
TTTCAACCACACGGGACAAGGAAGTATCTGCAGTCAGGCCATCATGCTCATAACTGATGGGGCGGTGGACACCTATGATACAATCTTTGC
AAAATACAATTGGCCAGATCGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAG
CGGCACTGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGACATCTGCTTTATGCTGGACCCAGTAAGATGAGGAAG
TCGGGCAGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAGGACTGCAGTTGGCTCTGGACCTGCATTAAAATGGGT
TTCACTGTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATCAGTTTATTGGATGTGGTTTTTCACATTTAAGATAAT
TATGGCTCTTTTCCTAAAAAATAAAATATCTTTCTAAAGTGTTGTGTTAGATTAATAATATGGAAGGAGTCTTTAGATTGGCCAAATTGC
ATTTCTCTGATATTCCTCTTGTTGCAGGTCAGAAGAGATCAATTCTACAGAAATTTCCAGTGGTTCTGTTGAGGCTTTATGGAATTCAGC
ATGTCAAAATTCACAGCTGGCTGGGCACAGTGGCTCATGCCTGTAATCCCAGCACTTTGGAAGCCCAAGGCGGGCAGACTGCTTGAGTTC
AGGAGTTTGCAACCAGCCTGGGCAACATGGTGAAAACCTGTCTCTACTAAAAATACAAAAATTAGCCGGGCACGGTGGCATGCGCCTGTA
ATCCAAGCTACTTGGGAGGCTGAGGCAGGAGAATTGCTTCAACTTGGGAGGCGGATGTTGCAGTGAGCCAAAATTGCACCACTGCACTCC

>In-frame_CACNA2D3_ENST00000288197_chr3_54676268_+_DAP3_ENST00000368336_chr1_155707948_+_2069nt
CGGCCGCTCTCGTCGCCGCCGCAGCGGGCGCGTCGGAGGGAGCCCAGCATGGCCGGGCCGGGCTCGCCGCGCCGCGCGTCCCGGGGGGCC
TCGGCGCTTCTCGCTGCCGCGCTTCTCTACGCCGCGCTGGGGGACGTGGTGCGCTCGGAGCAGCAGATACCGCTCTCCGTGGTGAAGCTC
TGGGCCTCGGCTTTTGGTGGGGAGATAAAATCCATTGCTGCTAAGTACTCCGGTTCCCAGCTTCTGCAAAAGAAATACAAAGAGTATGAG
AAAGACGTTGCCATAGAAGAAATTGATGGCCTCCAACTGGTAAAGAAGCTGGCAAAGAACATGGAAGAGATGTTTCACAAGAAGTCTGAG
GCCGTCAGGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGATGCAGACTTACAGTATGAATACTTCAATGCTGTG
CTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCAAATGACCATTTTAATAATTTGCCT
GTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCCTGCAATTGTCAATGGGGTTTATTGGTCTGAATCT
CTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGTGCAAAGGGCTTTTTTAGGCAGTAT
CCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAACCGAAAATGGTACATCCAGGCAGCAACTTCTCCG
AAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAGCAAACAGTCTCATCCATTTTGGAT
ACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTATGTGGAACCTTGCCTGAATGGAACTTTGGTGCAA
GCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGAATGTTGGATATAGCTCTGAATGAG
GCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCAGGCCATCATGCTCATAACTGATGGGGCGGTGGAC
ACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACG
CGAACCCCTCGCTGCTGGAGCGGCACTGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGACATCTGCTTTATGCTG
GACCCAGTAAGATGAGGAAGTCGGGCAGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAGGACTGCAGTTGGCTCT
GGACCTGCATTAAAATGGGTTTCACTGTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATCAGTTTATTGGATGTGG
TTTTTCACATTTAAGATAATTATGGCTCTTTTCCTAAAAAATAAAATATCTTTCTAAAGTGTTGTGTTAGATTAATAATATGGAAGGAGT
CTTTAGATTGGCCAAATTGCATTTCTCTGATATTCCTCTTGTTGCAGGTCAGAAGAGATCAATTCTACAGAAATTTCCAGTGGTTCTGTT
GAGGCTTTATGGAATTCAGCATGTCAAAATTCACAGCTGGCTGGGCACAGTGGCTCATGCCTGTAATCCCAGCACTTTGGAAGCCCAAGG
CGGGCAGACTGCTTGAGTTCAGGAGTTTGCAACCAGCCTGGGCAACATGGTGAAAACCTGTCTCTACTAAAAATACAAAAATTAGCCGGG
CACGGTGGCATGCGCCTGTAATCCAAGCTACTTGGGAGGCTGAGGCAGGAGAATTGCTTCAACTTGGGAGGCGGATGTTGCAGTGAGCCA

>In-frame_CACNA2D3_ENST00000474759_chr3_54676268_+_DAP3_ENST00000368336_chr1_155707948_+_2069nt
CGGCCGCTCTCGTCGCCGCCGCAGCGGGCGCGTCGGAGGGAGCCCAGCATGGCCGGGCCGGGCTCGCCGCGCCGCGCGTCCCGGGGGGCC
TCGGCGCTTCTCGCTGCCGCGCTTCTCTACGCCGCGCTGGGGGACGTGGTGCGCTCGGAGCAGCAGATACCGCTCTCCGTGGTGAAGCTC
TGGGCCTCGGCTTTTGGTGGGGAGATAAAATCCATTGCTGCTAAGTACTCCGGTTCCCAGCTTCTGCAAAAGAAATACAAAGAGTATGAG
AAAGACGTTGCCATAGAAGAAATTGATGGCCTCCAACTGGTAAAGAAGCTGGCAAAGAACATGGAAGAGATGTTTCACAAGAAGTCTGAG
GCCGTCAGGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGATGCAGACTTACAGTATGAATACTTCAATGCTGTG
CTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCAAATGACCATTTTAATAATTTGCCT
GTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCCTGCAATTGTCAATGGGGTTTATTGGTCTGAATCT
CTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGTGCAAAGGGCTTTTTTAGGCAGTAT
CCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAACCGAAAATGGTACATCCAGGCAGCAACTTCTCCG
AAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAGCAAACAGTCTCATCCATTTTGGAT
ACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTATGTGGAACCTTGCCTGAATGGAACTTTGGTGCAA
GCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGAATGTTGGATATAGCTCTGAATGAG
GCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCAGGCCATCATGCTCATAACTGATGGGGCGGTGGAC
ACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACG
CGAACCCCTCGCTGCTGGAGCGGCACTGTGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGACATCTGCTTTATGCTG
GACCCAGTAAGATGAGGAAGTCGGGCAGTACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAGGACTGCAGTTGGCTCT
GGACCTGCATTAAAATGGGTTTCACTGTGAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATCAGTTTATTGGATGTGG
TTTTTCACATTTAAGATAATTATGGCTCTTTTCCTAAAAAATAAAATATCTTTCTAAAGTGTTGTGTTAGATTAATAATATGGAAGGAGT
CTTTAGATTGGCCAAATTGCATTTCTCTGATATTCCTCTTGTTGCAGGTCAGAAGAGATCAATTCTACAGAAATTTCCAGTGGTTCTGTT
GAGGCTTTATGGAATTCAGCATGTCAAAATTCACAGCTGGCTGGGCACAGTGGCTCATGCCTGTAATCCCAGCACTTTGGAAGCCCAAGG
CGGGCAGACTGCTTGAGTTCAGGAGTTTGCAACCAGCCTGGGCAACATGGTGAAAACCTGTCTCTACTAAAAATACAAAAATTAGCCGGG
CACGGTGGCATGCGCCTGTAATCCAAGCTACTTGGGAGGCTGAGGCAGGAGAATTGCTTCAACTTGGGAGGCGGATGTTGCAGTGAGCCA

>In-frame_CACNA2D3_ENST00000490478_chr3_54676268_+_DAP3_ENST00000368336_chr1_155707948_+_1951nt
GTTGACTGTGACACGGGTGTTACATATCTTCCTGTGCCCCTTCTCCCTGTAGGGTGAAGCTCTGGGCCTCGGCTTTTGGTGGGGAGATAA
AATCCATTGCTGCTAAGTACTCCGGTTCCCAGCTTCTGCAAAAGAAATACAAAGAGTATGAGAAAGACGTTGCCATAGAAGAAATTGATG
GCCTCCAACTGGTAAAGAAGCTGGCAAAGAACATGGAAGAGATGTTTCACAAGAAGTCTGAGGCCGTCAGGCGTCTGGTGGAGGCTGCAG
AAGAAGCACACCTGAAACATGAATTTGATGCAGACTTACAGTATGAATACTTCAATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGA
ATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCAAATGACCATTTTAATAATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAG
TACCAACGAACATGTACAACAAAGACCCTGCAATTGTCAATGGGGTTTATTGGTCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTG
ACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGTGCAAAGGGCTTTTTTAGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGA
ATGGAGTCATTGCCTTCGACTGCAGGAACCGAAAATGGTACATCCAGGCAGCAACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCA
GTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAGCAAACAGTCTCATCCATTTTGGATACACTTGGGGATGATGACTTCTTCAACA
TAATTGCTTATAATGAGGAGCTTCACTATGTGGAACCTTGCCTGAATGGAACTTTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCA
GGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGAATGTTGGATATAGCTCTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACC
ACACGGGACAAGGAAGTATCTGCAGTCAGGCCATCATGCTCATAACTGATGGGGCGGTGGACACCTATGATACAATCTTTGCAAAATACA
ATTGGCCAGATCGAAAGCTCCTACAGAAGAAGGGAAAAAAGAGCTGCTGTTCCTAAGTAACGCGAACCCCTCGCTGCTGGAGCGGCACTG
TGCCTACCTCTAAGCCAAGATCACAGCATGTGAGGAAGACAGTGGACATCTGCTTTATGCTGGACCCAGTAAGATGAGGAAGTCGGGCAG
TACACAGGAAGAGGAGCCAGGCCCTTGTACCTATGGGATTGGACAGGACTGCAGTTGGCTCTGGACCTGCATTAAAATGGGTTTCACTGT
GAATGCGTGACAATAAGATATTCCCTTGTTCCTAAAACTTTATATCAGTTTATTGGATGTGGTTTTTCACATTTAAGATAATTATGGCTC
TTTTCCTAAAAAATAAAATATCTTTCTAAAGTGTTGTGTTAGATTAATAATATGGAAGGAGTCTTTAGATTGGCCAAATTGCATTTCTCT
GATATTCCTCTTGTTGCAGGTCAGAAGAGATCAATTCTACAGAAATTTCCAGTGGTTCTGTTGAGGCTTTATGGAATTCAGCATGTCAAA
ATTCACAGCTGGCTGGGCACAGTGGCTCATGCCTGTAATCCCAGCACTTTGGAAGCCCAAGGCGGGCAGACTGCTTGAGTTCAGGAGTTT
GCAACCAGCCTGGGCAACATGGTGAAAACCTGTCTCTACTAAAAATACAAAAATTAGCCGGGCACGGTGGCATGCGCCTGTAATCCAAGC
TACTTGGGAGGCTGAGGCAGGAGAATTGCTTCAACTTGGGAGGCGGATGTTGCAGTGAGCCAAAATTGCACCACTGCACTCCAGCCTGGG


Top

FusionGenePPI for CACNA2D3_DAP3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CACNA2D3DAP3CNBP, NR3C1, PPARA, HSP90AA1, HIF1A, AHR, ESR1, ESR2, PGR, THRA, AR, DAP3, TNFRSF10A, TNFRSF25, FADD, UBC, ICT1, DYRK2, MRPS27, STOML2, COX5A, YME1L1, C1QBP, SOX2, TARDBP, PARK2, GRSF1, CEP250, HAUS2, VCP, FBXW11, BTRC, TRA2A, RPL6, ZC3H3, RPS8, TRMT10B, HNRNPA1, ZNF707, MRPS31, MRPS35, MRPS10, WDFY2, MTIF2, PNMA6A, MRPS5, NTRK1, PTCD3, MRPS18B, MRPS2, MRPS22, MRPS23, MRPS28, MRPS9, LYST, COL4A5, CSNK1D, MBNL1, PYCR1, HNRNPU, MAGEA1, AP3D1, POC1A, MRPS11, ZNF746, DUSP11, MRPS34, MRPS15, AURKAIP1, RRS1, ZBTB48, E4F1, BHLHA15, FGF8, ZNF331, U2AF2, ZNF324B, ZNF133, ZNF408, SNRNP70, CCDC59, GLTSCR2, RBM3, NCL, DLD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CACNA2D3_DAP3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneCACNA2D3Q8IZS8DB00381AmlodipineVoltage-dependent calcium channel subunit alpha-2/delta-3small moleculeapproved
HgeneCACNA2D3Q8IZS8DB06712NilvadipineVoltage-dependent calcium channel subunit alpha-2/delta-3small moleculeapproved|investigational

Top

RelatedDiseases for CACNA2D3_DAP3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneDAP3C1458155Mammary Neoplasms1CTD_human