FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 5181

FusionGeneSummary for CACNA1C_PIAS4

check button Fusion gene summary
Fusion gene informationFusion gene name: CACNA1C_PIAS4
Fusion gene ID: 5181
HgeneTgene
Gene symbol

CACNA1C

PIAS4

Gene ID

775

51588

Gene namecalcium voltage-gated channel subunit alpha1 Cprotein inhibitor of activated STAT 4
SynonymsCACH2|CACN2|CACNL1A1|CCHL1A1|CaV1.2|LQT8|TSPIAS-gamma|PIASY|Piasg|ZMIZ6
Cytomap

12p13.33

19p13.3

Type of geneprotein-codingprotein-coding
Descriptionvoltage-dependent L-type calcium channel subunit alpha-1CDHPR, alpha-1 subunitcalcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac musclecalcium channel, cardic dihydropyridine-sensitive, alpha-1 subunitcalcium channel, voltage-dependent, E3 SUMO-protein ligase PIAS4RING-type E3 ubiquitin transferase PIAS4protein inhibitor of activated STAT protein 4protein inhibitor of activated STAT protein PIASyprotein inhibitor of activated STAT protein gammazinc finger, MIZ-type containing 6
Modification date2018052320180522
UniProtAcc

Q13936

Q8N2W9

Ensembl transtripts involved in fusion geneENST00000335762, ENST00000399655, 
ENST00000480911, ENST00000399644, 
ENST00000344100, ENST00000399638, 
ENST00000399629, ENST00000399597, 
ENST00000327702, ENST00000399621, 
ENST00000399649, ENST00000399637, 
ENST00000402845, ENST00000399591, 
ENST00000399641, ENST00000347598, 
ENST00000399606, ENST00000399595, 
ENST00000399601, ENST00000399603, 
ENST00000399634, ENST00000399617, 
ENST00000406454, ENST00000491104, 
ENST00000262971, ENST00000596144, 
Fusion gene scores* DoF score13 X 10 X 7=9104 X 4 X 4=64
# samples 124
** MAII scorelog2(12/910*10)=-2.92283213947754
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CACNA1C [Title/Abstract] AND PIAS4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCACNA1C

GO:0007204

positive regulation of cytosolic calcium ion concentration

12130699

HgeneCACNA1C

GO:0061577

calcium ion transmembrane transport via high voltage-gated calcium channel

15454078

HgeneCACNA1C

GO:0070588

calcium ion transmembrane transport

15454078

TgenePIAS4

GO:0016925

protein sumoylation

18579533

TgenePIAS4

GO:0033235

positive regulation of protein sumoylation

17696781|21965678

TgenePIAS4

GO:0045892

negative regulation of transcription, DNA-templated

11248056


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPCPGTCGA-RW-A68B-01ACACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000335762ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000335762ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000399655ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000399655ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000480911ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000480911ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000399644ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000399644ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000344100ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000344100ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000399638ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000399638ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000399629ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000399629ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000399597ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000399597ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000327702ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000327702ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000399621ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000399621ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000399649ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000399649ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000399637ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000399637ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000402845ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000402845ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000399591ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000399591ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000399641ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000399641ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000347598ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000347598ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000399606ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000399606ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000399595ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000399595ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000399601ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000399601ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000399603ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000399603ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000399634ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000399634ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000399617ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000399617ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
In-frameENST00000406454ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
5CDS-intronENST00000406454ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
intron-3CDSENST00000491104ENST00000262971CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+
intron-intronENST00000491104ENST00000596144CACNA1Cchr12

2162777

+PIAS4chr19

4033098

+

Top

FusionProtFeatures for CACNA1C_PIAS4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CACNA1C

Q13936

PIAS4

Q8N2W9

Functions as an E3-type small ubiquitin-like modifier(SUMO) ligase, stabilizing the interaction between UBE2I and thesubstrate, and as a SUMO-tethering factor. Plays a crucial role asa transcriptional coregulation in various cellular pathways,including the STAT pathway, the p53/TP53 pathway, the Wnt pathwayand the steroid hormone signaling pathway. Involved in genesilencing. Mediates sumoylation of CEBPA, PARK7, HERC2, MYB, TCF4and RNF168. In Wnt signaling, represses LEF1 and enhances TCF4transcriptional activities through promoting their sumoylations.Enhances the sumoylation of MTA1 and may participate in itsparalog-selective sumoylation. {ECO:0000269|PubMed:12511558,ECO:0000269|PubMed:12631292, ECO:0000269|PubMed:12727872,ECO:0000269|PubMed:15831457, ECO:0000269|PubMed:15976810,ECO:0000269|PubMed:21965678, ECO:0000269|PubMed:22508508}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePIAS4chr12:2162777chr19:4033098ENST00000262971+611464_492302511Compositional biasNote=Asp/Glu-rich (acidic)
TgenePIAS4chr12:2162777chr19:4033098ENST00000262971+611311_388302511Zinc fingerSP-RING-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481553_1564162174Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471553_1564162180Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491553_1564162187Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461553_1564162147Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461553_1564162147Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471553_1564162139Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471553_1564162139Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471553_1564162139Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481553_1564162159Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481553_1564162174Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471553_1564162158Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471553_1564162156Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471553_1564162158Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481553_1564162167Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471553_1564162139Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471553_1564162139Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461553_1564162145Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471553_1564162139Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471553_1564162158Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481167_1173162174Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1482084_2087162174Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148654_660162174Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148768_774162174Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471167_1173162180Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1472084_2087162180Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147654_660162180Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147768_774162180Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491167_1173162187Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1492084_2087162187Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149654_660162187Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149768_774162187Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461167_1173162147Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1462084_2087162147Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146654_660162147Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146768_774162147Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461167_1173162147Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1462084_2087162147Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146654_660162147Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146768_774162147Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471167_1173162139Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1472084_2087162139Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147654_660162139Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147768_774162139Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471167_1173162139Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1472084_2087162139Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147654_660162139Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147768_774162139Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471167_1173162139Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1472084_2087162139Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147654_660162139Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147768_774162139Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481167_1173162159Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1482084_2087162159Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148654_660162159Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148768_774162159Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481167_1173162174Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1482084_2087162174Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148654_660162174Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148768_774162174Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471167_1173162158Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1472084_2087162158Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147654_660162158Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147768_774162158Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471167_1173162156Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1472084_2087162156Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147654_660162156Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147768_774162156Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471167_1173162158Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1472084_2087162158Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147654_660162158Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147768_774162158Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481167_1173162167Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1482084_2087162167Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148654_660162167Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148768_774162167Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471167_1173162139Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1472084_2087162139Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147654_660162139Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147768_774162139Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471167_1173162139Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1472084_2087162139Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147654_660162139Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147768_774162139Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461167_1173162145Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1462084_2087162145Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146654_660162145Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146768_774162145Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471167_1173162139Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1472084_2087162139Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147654_660162139Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147768_774162139Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471167_1173162158Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1472084_2087162158Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147654_660162158Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147768_774162158Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481122_1142162174IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481453_1471162174IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148351_372162174IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148694_715162174IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471122_1142162180IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471453_1471162180IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147351_372162180IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147694_715162180IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491122_1142162187IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491453_1471162187IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149351_372162187IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149694_715162187IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461122_1142162147IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461453_1471162147IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146351_372162147IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146694_715162147IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461122_1142162147IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461453_1471162147IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146351_372162147IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146694_715162147IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471122_1142162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471453_1471162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147351_372162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147694_715162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471122_1142162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471453_1471162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147351_372162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147694_715162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471122_1142162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471453_1471162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147351_372162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147694_715162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481122_1142162159IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481453_1471162159IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148351_372162159IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148694_715162159IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481122_1142162174IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481453_1471162174IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148351_372162174IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148694_715162174IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471122_1142162158IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471453_1471162158IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147351_372162158IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147694_715162158IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471122_1142162156IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471453_1471162156IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147351_372162156IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147694_715162156IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471122_1142162158IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471453_1471162158IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147351_372162158IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147694_715162158IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481122_1142162167IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481453_1471162167IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148351_372162167IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148694_715162167IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471122_1142162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471453_1471162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147351_372162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147694_715162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471122_1142162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471453_1471162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147351_372162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147694_715162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461122_1142162145IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461453_1471162145IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146351_372162145IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146694_715162145IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471122_1142162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471453_1471162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147351_372162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147694_715162139IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471122_1142162158IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471453_1471162158IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147351_372162158IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147694_715162158IntramembranePore-forming
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481133_1136162174MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481462_1465162174MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148361_364162174MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148704_707162174MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471133_1136162180MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471462_1465162180MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147361_364162180MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147704_707162180MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491133_1136162187MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491462_1465162187MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149361_364162187MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149704_707162187MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461133_1136162147MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461462_1465162147MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146361_364162147MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146704_707162147MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461133_1136162147MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461462_1465162147MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146361_364162147MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146704_707162147MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471133_1136162139MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471462_1465162139MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147361_364162139MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147704_707162139MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471133_1136162139MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471462_1465162139MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147361_364162139MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147704_707162139MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471133_1136162139MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471462_1465162139MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147361_364162139MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147704_707162139MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481133_1136162159MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481462_1465162159MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148361_364162159MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148704_707162159MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481133_1136162174MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481462_1465162174MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148361_364162174MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148704_707162174MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471133_1136162158MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471462_1465162158MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147361_364162158MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147704_707162158MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471133_1136162156MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471462_1465162156MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147361_364162156MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147704_707162156MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471133_1136162158MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471462_1465162158MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147361_364162158MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147704_707162158MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481133_1136162167MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481462_1465162167MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148361_364162167MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148704_707162167MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471133_1136162139MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471462_1465162139MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147361_364162139MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147704_707162139MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471133_1136162139MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471462_1465162139MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147361_364162139MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147704_707162139MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461133_1136162145MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461462_1465162145MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146361_364162145MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146704_707162145MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471133_1136162139MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471462_1465162139MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147361_364162139MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147704_707162139MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471133_1136162158MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471462_1465162158MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147361_364162158MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147704_707162158MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481109_1198162174RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481478_1546162174RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481492_1534162174RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481665_1685162174RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481699_1718162174RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+14847_68162174RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471109_1198162180RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471478_1546162180RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471492_1534162180RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471665_1685162180RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471699_1718162180RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+14747_68162180RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491109_1198162187RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491478_1546162187RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491492_1534162187RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491665_1685162187RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491699_1718162187RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+14947_68162187RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461109_1198162147RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461478_1546162147RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461492_1534162147RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461665_1685162147RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461699_1718162147RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+14647_68162147RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461109_1198162147RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461478_1546162147RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461492_1534162147RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461665_1685162147RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461699_1718162147RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+14647_68162147RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471109_1198162139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471478_1546162139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471492_1534162139RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471665_1685162139RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471699_1718162139RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+14747_68162139RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471109_1198162139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471478_1546162139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471492_1534162139RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471665_1685162139RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471699_1718162139RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+14747_68162139RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471109_1198162139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471478_1546162139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471492_1534162139RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471665_1685162139RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471699_1718162139RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+14747_68162139RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481109_1198162159RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481478_1546162159RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481492_1534162159RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481665_1685162159RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481699_1718162159RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+14847_68162159RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481109_1198162174RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481478_1546162174RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481492_1534162174RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481665_1685162174RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481699_1718162174RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+14847_68162174RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471109_1198162158RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471478_1546162158RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471492_1534162158RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471665_1685162158RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471699_1718162158RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+14747_68162158RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471109_1198162156RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471478_1546162156RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471492_1534162156RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471665_1685162156RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471699_1718162156RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+14747_68162156RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471109_1198162158RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471478_1546162158RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471492_1534162158RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471665_1685162158RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471699_1718162158RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+14747_68162158RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481109_1198162167RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481478_1546162167RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481492_1534162167RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481665_1685162167RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481699_1718162167RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+14847_68162167RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471109_1198162139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471478_1546162139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471492_1534162139RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471665_1685162139RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471699_1718162139RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+14747_68162139RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471109_1198162139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471478_1546162139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471492_1534162139RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471665_1685162139RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471699_1718162139RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+14747_68162139RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461109_1198162145RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461478_1546162145RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461492_1534162145RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461665_1685162145RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461699_1718162145RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+14647_68162145RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471109_1198162139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471478_1546162139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471492_1534162139RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471665_1685162139RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471699_1718162139RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+14747_68162139RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471109_1198162158RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471478_1546162158RegionDihydropyridine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471492_1534162158RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471665_1685162158RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471699_1718162158RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+14747_68162158RegionCalmodulin-binding
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148111_408162174RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481226_1527162174RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148510_756162174RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148887_1189162174RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147111_408162180RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471226_1527162180RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147510_756162180RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147887_1189162180RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149111_408162187RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491226_1527162187RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149510_756162187RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149887_1189162187RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146111_408162147RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461226_1527162147RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146510_756162147RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146887_1189162147RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146111_408162147RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461226_1527162147RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146510_756162147RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146887_1189162147RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147111_408162139RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471226_1527162139RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147510_756162139RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147887_1189162139RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147111_408162139RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471226_1527162139RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147510_756162139RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147887_1189162139RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147111_408162139RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471226_1527162139RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147510_756162139RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147887_1189162139RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148111_408162159RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481226_1527162159RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148510_756162159RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148887_1189162159RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148111_408162174RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481226_1527162174RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148510_756162174RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148887_1189162174RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147111_408162158RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471226_1527162158RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147510_756162158RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147887_1189162158RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147111_408162156RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471226_1527162156RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147510_756162156RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147887_1189162156RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147111_408162158RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471226_1527162158RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147510_756162158RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147887_1189162158RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148111_408162167RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481226_1527162167RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148510_756162167RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148887_1189162167RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147111_408162139RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471226_1527162139RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147510_756162139RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147887_1189162139RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147111_408162139RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471226_1527162139RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147510_756162139RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147887_1189162139RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146111_408162145RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461226_1527162145RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146510_756162145RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146887_1189162145RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147111_408162139RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471226_1527162139RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147510_756162139RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147887_1189162139RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147111_408162158RepeatNote=I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471226_1527162158RepeatNote=IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147510_756162158RepeatNote=II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147887_1189162158RepeatNote=III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481007_1013162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481033_1051162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481072_1121162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481143_1159162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481182_1239162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481262_1269162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481292_1301162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481322_1372162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481392_1409162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481431_1452162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148144_158162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481472_1499162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481525_2221162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148180_188162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481_124162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148210_232162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148252_268162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148291_350162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148373_380162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148402_524162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148544_554162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148576_586162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148607_615162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148635_653162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148674_693162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148716_725162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148746_900162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148920_931162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148953_987162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471007_1013162180Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471033_1051162180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471072_1121162180Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471143_1159162180Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471182_1239162180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471262_1269162180Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471292_1301162180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471322_1372162180Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471392_1409162180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471431_1452162180Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147144_158162180Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471472_1499162180Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471525_2221162180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147180_188162180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471_124162180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147210_232162180Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147252_268162180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147291_350162180Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147373_380162180Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147402_524162180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147544_554162180Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147576_586162180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147607_615162180Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147635_653162180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147674_693162180Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147716_725162180Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147746_900162180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147920_931162180Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147953_987162180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491007_1013162187Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491033_1051162187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491072_1121162187Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491143_1159162187Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491182_1239162187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491262_1269162187Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491292_1301162187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491322_1372162187Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491392_1409162187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491431_1452162187Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149144_158162187Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491472_1499162187Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491525_2221162187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149180_188162187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491_124162187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149210_232162187Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149252_268162187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149291_350162187Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149373_380162187Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149402_524162187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149544_554162187Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149576_586162187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149607_615162187Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149635_653162187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149674_693162187Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149716_725162187Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149746_900162187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149920_931162187Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149953_987162187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461007_1013162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461033_1051162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461072_1121162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461143_1159162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461182_1239162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461262_1269162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461292_1301162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461322_1372162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461392_1409162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461431_1452162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146144_158162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461472_1499162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461525_2221162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146180_188162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461_124162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146210_232162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146252_268162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146291_350162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146373_380162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146402_524162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146544_554162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146576_586162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146607_615162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146635_653162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146674_693162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146716_725162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146746_900162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146920_931162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146953_987162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461007_1013162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461033_1051162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461072_1121162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461143_1159162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461182_1239162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461262_1269162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461292_1301162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461322_1372162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461392_1409162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461431_1452162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146144_158162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461472_1499162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461525_2221162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146180_188162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461_124162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146210_232162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146252_268162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146291_350162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146373_380162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146402_524162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146544_554162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146576_586162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146607_615162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146635_653162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146674_693162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146716_725162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146746_900162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146920_931162147Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146953_987162147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471007_1013162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471033_1051162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471072_1121162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471143_1159162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471182_1239162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471262_1269162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471292_1301162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471322_1372162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471392_1409162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471431_1452162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147144_158162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471472_1499162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471525_2221162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147180_188162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471_124162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147210_232162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147252_268162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147291_350162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147373_380162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147402_524162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147544_554162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147576_586162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147607_615162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147635_653162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147674_693162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147716_725162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147746_900162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147920_931162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147953_987162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471007_1013162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471033_1051162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471072_1121162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471143_1159162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471182_1239162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471262_1269162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471292_1301162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471322_1372162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471392_1409162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471431_1452162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147144_158162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471472_1499162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471525_2221162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147180_188162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471_124162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147210_232162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147252_268162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147291_350162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147373_380162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147402_524162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147544_554162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147576_586162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147607_615162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147635_653162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147674_693162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147716_725162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147746_900162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147920_931162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147953_987162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471007_1013162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471033_1051162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471072_1121162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471143_1159162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471182_1239162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471262_1269162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471292_1301162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471322_1372162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471392_1409162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471431_1452162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147144_158162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471472_1499162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471525_2221162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147180_188162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471_124162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147210_232162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147252_268162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147291_350162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147373_380162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147402_524162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147544_554162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147576_586162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147607_615162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147635_653162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147674_693162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147716_725162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147746_900162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147920_931162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147953_987162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481007_1013162159Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481033_1051162159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481072_1121162159Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481143_1159162159Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481182_1239162159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481262_1269162159Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481292_1301162159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481322_1372162159Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481392_1409162159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481431_1452162159Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148144_158162159Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481472_1499162159Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481525_2221162159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148180_188162159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481_124162159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148210_232162159Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148252_268162159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148291_350162159Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148373_380162159Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148402_524162159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148544_554162159Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148576_586162159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148607_615162159Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148635_653162159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148674_693162159Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148716_725162159Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148746_900162159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148920_931162159Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148953_987162159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481007_1013162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481033_1051162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481072_1121162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481143_1159162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481182_1239162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481262_1269162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481292_1301162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481322_1372162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481392_1409162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481431_1452162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148144_158162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481472_1499162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481525_2221162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148180_188162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481_124162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148210_232162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148252_268162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148291_350162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148373_380162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148402_524162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148544_554162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148576_586162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148607_615162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148635_653162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148674_693162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148716_725162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148746_900162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148920_931162174Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148953_987162174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471007_1013162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471033_1051162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471072_1121162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471143_1159162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471182_1239162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471262_1269162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471292_1301162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471322_1372162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471392_1409162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471431_1452162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147144_158162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471472_1499162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471525_2221162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147180_188162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471_124162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147210_232162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147252_268162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147291_350162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147373_380162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147402_524162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147544_554162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147576_586162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147607_615162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147635_653162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147674_693162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147716_725162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147746_900162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147920_931162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147953_987162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471007_1013162156Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471033_1051162156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471072_1121162156Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471143_1159162156Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471182_1239162156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471262_1269162156Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471292_1301162156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471322_1372162156Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471392_1409162156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471431_1452162156Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147144_158162156Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471472_1499162156Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471525_2221162156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147180_188162156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471_124162156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147210_232162156Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147252_268162156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147291_350162156Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147373_380162156Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147402_524162156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147544_554162156Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147576_586162156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147607_615162156Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147635_653162156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147674_693162156Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147716_725162156Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147746_900162156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147920_931162156Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147953_987162156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471007_1013162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471033_1051162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471072_1121162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471143_1159162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471182_1239162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471262_1269162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471292_1301162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471322_1372162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471392_1409162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471431_1452162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147144_158162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471472_1499162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471525_2221162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147180_188162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471_124162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147210_232162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147252_268162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147291_350162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147373_380162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147402_524162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147544_554162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147576_586162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147607_615162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147635_653162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147674_693162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147716_725162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147746_900162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147920_931162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147953_987162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481007_1013162167Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481033_1051162167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481072_1121162167Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481143_1159162167Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481182_1239162167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481262_1269162167Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481292_1301162167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481322_1372162167Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481392_1409162167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481431_1452162167Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148144_158162167Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481472_1499162167Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481525_2221162167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148180_188162167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481_124162167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148210_232162167Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148252_268162167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148291_350162167Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148373_380162167Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148402_524162167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148544_554162167Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148576_586162167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148607_615162167Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148635_653162167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148674_693162167Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148716_725162167Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148746_900162167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148920_931162167Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148953_987162167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471007_1013162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471033_1051162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471072_1121162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471143_1159162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471182_1239162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471262_1269162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471292_1301162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471322_1372162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471392_1409162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471431_1452162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147144_158162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471472_1499162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471525_2221162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147180_188162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471_124162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147210_232162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147252_268162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147291_350162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147373_380162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147402_524162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147544_554162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147576_586162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147607_615162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147635_653162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147674_693162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147716_725162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147746_900162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147920_931162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147953_987162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471007_1013162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471033_1051162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471072_1121162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471143_1159162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471182_1239162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471262_1269162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471292_1301162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471322_1372162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471392_1409162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471431_1452162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147144_158162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471472_1499162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471525_2221162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147180_188162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471_124162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147210_232162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147252_268162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147291_350162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147373_380162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147402_524162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147544_554162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147576_586162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147607_615162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147635_653162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147674_693162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147716_725162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147746_900162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147920_931162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147953_987162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461007_1013162145Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461033_1051162145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461072_1121162145Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461143_1159162145Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461182_1239162145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461262_1269162145Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461292_1301162145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461322_1372162145Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461392_1409162145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461431_1452162145Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146144_158162145Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461472_1499162145Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461525_2221162145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146180_188162145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461_124162145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146210_232162145Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146252_268162145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146291_350162145Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146373_380162145Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146402_524162145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146544_554162145Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146576_586162145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146607_615162145Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146635_653162145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146674_693162145Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146716_725162145Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146746_900162145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146920_931162145Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146953_987162145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471007_1013162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471033_1051162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471072_1121162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471143_1159162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471182_1239162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471262_1269162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471292_1301162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471322_1372162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471392_1409162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471431_1452162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147144_158162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471472_1499162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471525_2221162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147180_188162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471_124162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147210_232162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147252_268162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147291_350162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147373_380162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147402_524162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147544_554162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147576_586162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147607_615162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147635_653162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147674_693162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147716_725162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147746_900162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147920_931162139Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147953_987162139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471007_1013162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471033_1051162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471072_1121162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471143_1159162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471182_1239162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471262_1269162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471292_1301162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471322_1372162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471392_1409162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471431_1452162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147144_158162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471472_1499162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471525_2221162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147180_188162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471_124162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147210_232162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147252_268162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147291_350162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147373_380162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147402_524162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147544_554162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147576_586162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147607_615162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147635_653162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147674_693162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147716_725162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147746_900162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147920_931162158Topological domainExtracellular
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147953_987162158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481014_1032162174TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481052_1071162174TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481160_1181162174TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481240_1261162174TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148125_143162174TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481270_1291162174TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481302_1321162174TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481373_1391162174TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481410_1430162174TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+1481500_1524162174TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148159_179162174TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148189_209162174TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148233_251162174TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148269_290162174TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148381_401162174TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148525_543162174TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148555_575162174TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148587_606162174TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148616_634162174TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148654_673162174TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148726_745162174TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148901_919162174TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148932_952162174TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000327702+148988_1006162174TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471014_1032162180TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471052_1071162180TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471160_1181162180TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471240_1261162180TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147125_143162180TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471270_1291162180TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471302_1321162180TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471373_1391162180TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471410_1430162180TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+1471500_1524162180TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147159_179162180TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147189_209162180TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147233_251162180TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147269_290162180TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147381_401162180TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147525_543162180TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147555_575162180TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147587_606162180TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147616_634162180TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147654_673162180TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147726_745162180TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147901_919162180TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147932_952162180TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000344100+147988_1006162180TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491014_1032162187TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491052_1071162187TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491160_1181162187TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491240_1261162187TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149125_143162187TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491270_1291162187TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491302_1321162187TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491373_1391162187TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491410_1430162187TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+1491500_1524162187TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149159_179162187TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149189_209162187TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149233_251162187TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149269_290162187TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149381_401162187TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149525_543162187TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149555_575162187TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149587_606162187TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149616_634162187TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149654_673162187TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149726_745162187TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149901_919162187TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149932_952162187TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000347598+149988_1006162187TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461014_1032162147TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461052_1071162147TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461160_1181162147TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461240_1261162147TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146125_143162147TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461270_1291162147TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461302_1321162147TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461373_1391162147TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461410_1430162147TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+1461500_1524162147TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146159_179162147TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146189_209162147TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146233_251162147TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146269_290162147TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146381_401162147TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146525_543162147TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146555_575162147TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146587_606162147TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146616_634162147TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146654_673162147TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146726_745162147TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146901_919162147TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146932_952162147TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399591+146988_1006162147TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461014_1032162147TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461052_1071162147TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461160_1181162147TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461240_1261162147TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146125_143162147TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461270_1291162147TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461302_1321162147TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461373_1391162147TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461410_1430162147TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+1461500_1524162147TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146159_179162147TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146189_209162147TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146233_251162147TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146269_290162147TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146381_401162147TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146525_543162147TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146555_575162147TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146587_606162147TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146616_634162147TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146654_673162147TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146726_745162147TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146901_919162147TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146932_952162147TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399595+146988_1006162147TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471014_1032162139TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471052_1071162139TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471160_1181162139TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471240_1261162139TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147125_143162139TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471270_1291162139TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471302_1321162139TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471373_1391162139TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471410_1430162139TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+1471500_1524162139TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147159_179162139TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147189_209162139TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147233_251162139TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147269_290162139TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147381_401162139TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147525_543162139TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147555_575162139TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147587_606162139TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147616_634162139TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147654_673162139TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147726_745162139TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147901_919162139TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147932_952162139TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399597+147988_1006162139TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471014_1032162139TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471052_1071162139TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471160_1181162139TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471240_1261162139TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147125_143162139TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471270_1291162139TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471302_1321162139TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471373_1391162139TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471410_1430162139TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+1471500_1524162139TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147159_179162139TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147189_209162139TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147233_251162139TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147269_290162139TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147381_401162139TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147525_543162139TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147555_575162139TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147587_606162139TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147616_634162139TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147654_673162139TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147726_745162139TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147901_919162139TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147932_952162139TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399601+147988_1006162139TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471014_1032162139TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471052_1071162139TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471160_1181162139TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471240_1261162139TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147125_143162139TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471270_1291162139TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471302_1321162139TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471373_1391162139TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471410_1430162139TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+1471500_1524162139TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147159_179162139TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147189_209162139TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147233_251162139TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147269_290162139TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147381_401162139TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147525_543162139TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147555_575162139TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147587_606162139TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147616_634162139TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147654_673162139TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147726_745162139TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147901_919162139TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147932_952162139TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399603+147988_1006162139TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481014_1032162159TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481052_1071162159TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481160_1181162159TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481240_1261162159TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148125_143162159TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481270_1291162159TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481302_1321162159TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481373_1391162159TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481410_1430162159TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+1481500_1524162159TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148159_179162159TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148189_209162159TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148233_251162159TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148269_290162159TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148381_401162159TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148525_543162159TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148555_575162159TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148587_606162159TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148616_634162159TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148654_673162159TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148726_745162159TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148901_919162159TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148932_952162159TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399606+148988_1006162159TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481014_1032162174TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481052_1071162174TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481160_1181162174TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481240_1261162174TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148125_143162174TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481270_1291162174TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481302_1321162174TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481373_1391162174TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481410_1430162174TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+1481500_1524162174TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148159_179162174TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148189_209162174TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148233_251162174TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148269_290162174TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148381_401162174TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148525_543162174TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148555_575162174TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148587_606162174TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148616_634162174TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148654_673162174TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148726_745162174TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148901_919162174TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148932_952162174TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399617+148988_1006162174TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471014_1032162158TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471052_1071162158TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471160_1181162158TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471240_1261162158TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147125_143162158TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471270_1291162158TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471302_1321162158TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471373_1391162158TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471410_1430162158TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+1471500_1524162158TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147159_179162158TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147189_209162158TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147233_251162158TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147269_290162158TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147381_401162158TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147525_543162158TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147555_575162158TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147587_606162158TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147616_634162158TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147654_673162158TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147726_745162158TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147901_919162158TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147932_952162158TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399621+147988_1006162158TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471014_1032162156TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471052_1071162156TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471160_1181162156TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471240_1261162156TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147125_143162156TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471270_1291162156TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471302_1321162156TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471373_1391162156TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471410_1430162156TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+1471500_1524162156TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147159_179162156TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147189_209162156TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147233_251162156TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147269_290162156TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147381_401162156TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147525_543162156TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147555_575162156TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147587_606162156TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147616_634162156TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147654_673162156TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147726_745162156TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147901_919162156TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147932_952162156TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399629+147988_1006162156TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471014_1032162158TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471052_1071162158TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471160_1181162158TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471240_1261162158TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147125_143162158TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471270_1291162158TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471302_1321162158TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471373_1391162158TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471410_1430162158TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+1471500_1524162158TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147159_179162158TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147189_209162158TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147233_251162158TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147269_290162158TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147381_401162158TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147525_543162158TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147555_575162158TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147587_606162158TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147616_634162158TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147654_673162158TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147726_745162158TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147901_919162158TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147932_952162158TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399637+147988_1006162158TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481014_1032162167TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481052_1071162167TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481160_1181162167TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481240_1261162167TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148125_143162167TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481270_1291162167TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481302_1321162167TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481373_1391162167TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481410_1430162167TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+1481500_1524162167TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148159_179162167TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148189_209162167TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148233_251162167TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148269_290162167TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148381_401162167TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148525_543162167TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148555_575162167TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148587_606162167TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148616_634162167TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148654_673162167TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148726_745162167TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148901_919162167TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148932_952162167TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399638+148988_1006162167TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471014_1032162139TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471052_1071162139TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471160_1181162139TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471240_1261162139TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147125_143162139TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471270_1291162139TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471302_1321162139TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471373_1391162139TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471410_1430162139TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+1471500_1524162139TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147159_179162139TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147189_209162139TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147233_251162139TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147269_290162139TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147381_401162139TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147525_543162139TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147555_575162139TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147587_606162139TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147616_634162139TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147654_673162139TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147726_745162139TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147901_919162139TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147932_952162139TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399641+147988_1006162139TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471014_1032162139TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471052_1071162139TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471160_1181162139TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471240_1261162139TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147125_143162139TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471270_1291162139TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471302_1321162139TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471373_1391162139TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471410_1430162139TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+1471500_1524162139TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147159_179162139TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147189_209162139TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147233_251162139TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147269_290162139TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147381_401162139TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147525_543162139TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147555_575162139TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147587_606162139TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147616_634162139TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147654_673162139TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147726_745162139TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147901_919162139TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147932_952162139TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399644+147988_1006162139TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461014_1032162145TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461052_1071162145TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461160_1181162145TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461240_1261162145TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146125_143162145TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461270_1291162145TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461302_1321162145TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461373_1391162145TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461410_1430162145TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+1461500_1524162145TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146159_179162145TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146189_209162145TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146233_251162145TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146269_290162145TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146381_401162145TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146525_543162145TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146555_575162145TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146587_606162145TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146616_634162145TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146654_673162145TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146726_745162145TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146901_919162145TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146932_952162145TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399649+146988_1006162145TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471014_1032162139TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471052_1071162139TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471160_1181162139TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471240_1261162139TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147125_143162139TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471270_1291162139TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471302_1321162139TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471373_1391162139TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471410_1430162139TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+1471500_1524162139TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147159_179162139TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147189_209162139TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147233_251162139TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147269_290162139TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147381_401162139TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147525_543162139TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147555_575162139TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147587_606162139TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147616_634162139TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147654_673162139TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147726_745162139TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147901_919162139TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147932_952162139TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000399655+147988_1006162139TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471014_1032162158TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471052_1071162158TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471160_1181162158TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471240_1261162158TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147125_143162158TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471270_1291162158TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471302_1321162158TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471373_1391162158TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471410_1430162158TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+1471500_1524162158TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147159_179162158TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147189_209162158TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147233_251162158TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147269_290162158TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147381_401162158TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147525_543162158TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147555_575162158TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147587_606162158TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147616_634162158TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147654_673162158TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147726_745162158TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147901_919162158TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147932_952162158TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2162777chr19:4033098ENST00000402845+147988_1006162158TransmembraneHelical%3B Name%3DS3 of repeat III
TgenePIAS4chr12:2162777chr19:4033098ENST00000262971+611119_279302511DomainPINIT
TgenePIAS4chr12:2162777chr19:4033098ENST00000262971+61112_46302511DomainSAP
TgenePIAS4chr12:2162777chr19:4033098ENST00000262971+61120_24302511MotifNote=LXXLL motif


Top

FusionGeneSequence for CACNA1C_PIAS4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CACNA1C_ENST00000335762_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000399655_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000480911_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000399644_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000344100_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000399638_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000399629_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000399597_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000327702_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000399621_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000399649_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000399637_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000402845_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000399591_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000399641_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000347598_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000399606_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000399595_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000399601_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000399603_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000399634_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000399617_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV

>In-frame_CACNA1C_ENST00000406454_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_225aa
MVNENTRMYIPEENHQVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQ
LIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CACNA1C_ENST00000335762_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000399655_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000480911_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000399644_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000344100_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000399638_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000399629_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000399597_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000327702_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000399621_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000399649_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000399637_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000402845_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000399591_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000399641_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000347598_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000399606_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000399595_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000399601_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000399603_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000399634_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000399617_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC

>In-frame_CACNA1C_ENST00000406454_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_675nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CACNA1C_ENST00000335762_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2451nt
GGAAGGGGCCCGGATGTACTGAGGATGCGTTACAGTTTCACTCGAGGAGGCAGTAGTGGAAAGGAGCAGTTTTTGGGGTTTGATGCCATA
ATGGGAATCAGGTAATCGTCGGCGGGGAAGAAGAAACGCTGCAGACCACGGCTTCCTCGAATCTTGCGCGAAAGCCGCCGGCCTCGGAGG
AGGGATTAATCCAGACCCGCCGGGGGGTGTTTTCACATTTCTTCCTCTTCGTGGCTGCTCCTCCTATTAAAACCATTTTTGGTCCATGGT
CAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCCACCAC
CGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAGTGCTT
CGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAGCTCAT
CATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCGATCCG
CGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCCAGCGT
CAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTGGACCT
CACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCCAAGCG
CCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGGGCACG
GGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGCTCCTG
GCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAACAAAAA
AGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGAGGGAC
CAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGACCCGG
GCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCTCGCCC
AGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGGGATGG
GTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTATTTTG
AAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTCTAGCC
AGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCCGCCGC
CACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGGGTTGA
TTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAGGACCA
GACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTGGGGGA
GCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCCTCACC
TGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTAGTCAG
GAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCTGCGCA
GCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGCAAATA

>In-frame_CACNA1C_ENST00000399655_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2451nt
GGAAGGGGCCCGGATGTACTGAGGATGCGTTACAGTTTCACTCGAGGAGGCAGTAGTGGAAAGGAGCAGTTTTTGGGGTTTGATGCCATA
ATGGGAATCAGGTAATCGTCGGCGGGGAAGAAGAAACGCTGCAGACCACGGCTTCCTCGAATCTTGCGCGAAAGCCGCCGGCCTCGGAGG
AGGGATTAATCCAGACCCGCCGGGGGGTGTTTTCACATTTCTTCCTCTTCGTGGCTGCTCCTCCTATTAAAACCATTTTTGGTCCATGGT
CAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCCACCAC
CGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAGTGCTT
CGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAGCTCAT
CATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCGATCCG
CGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCCAGCGT
CAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTGGACCT
CACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCCAAGCG
CCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGGGCACG
GGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGCTCCTG
GCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAACAAAAA
AGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGAGGGAC
CAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGACCCGG
GCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCTCGCCC
AGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGGGATGG
GTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTATTTTG
AAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTCTAGCC
AGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCCGCCGC
CACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGGGTTGA
TTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAGGACCA
GACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTGGGGGA
GCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCCTCACC
TGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTAGTCAG
GAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCTGCGCA
GCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGCAAATA

>In-frame_CACNA1C_ENST00000480911_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2211nt
CTCCTATTAAAACCATTTTTGGTCCATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCG
CCTTGATCCTGACAGCGAGATCGCCACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCG
GGCAGAGACCTGTGCCCACCTGCAGTGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTG
CGACAAGCCAGCCCCCTACGACCAGCTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTA
CCTGGTGGACGGCTCGTGGTGCCCGATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGA
CGCCAATGGGCTCCTGCCCGCCCCCAGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAA
TGGGAAGCCGGGCGCCGATGTGGTGGACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGA
CGAGGACGAAGAGGGGCCCCGGCCCAAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACT
TTCCTGGTGCTCACCACGCAGAGGGGCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTT
TTGTTTTTCCACCCTTTTGCCTGGCTCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAA
AAGATACAAAAAAGAAAAATGAAACAAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCG
AGCCGGGAAGGGGTAGTGGGCGGGAGGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCAC
GACCATTCCAGCCAGTGCGCGGGGACCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTT
TGCTTTTTCTCTGCAAATGCATCCTCGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGG
GCGGGGAGGGGCAGTAGGGTGGGGGGATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTAT
TTTTTGAAAGTGCAATAATTTGGTATTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGT
GTGGCGTGGGGGGGTCTCAGTTTTCTAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACA
GATGTCCACAGCTGCCGCCGCCGCCGCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACC
CCGGCCACCCCGGCTCTCGGTTTGGGTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCC
CCCGGGAGCCTCACTCTTCCAGCAGGACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGC
CCTTGGCCTCAGGGTCCAACAACTGGGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGA
CCGGGGCGCAGGCGGGGCACCGGCCTCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATT
TTCCTTTGTATAAACAGAACTCCTAGTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGT
CTCACTGCAGAGCCCGCAGCCCGCTGCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTC

>In-frame_CACNA1C_ENST00000399644_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000344100_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000399638_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000399629_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000399597_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000327702_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000399621_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000399649_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000399637_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000402845_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000399591_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000399641_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000347598_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000399606_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000399595_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000399601_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000399603_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000399634_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000399617_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC

>In-frame_CACNA1C_ENST00000406454_chr12_2162777_+_PIAS4_ENST00000262971_chr19_4033098_+_2186nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGTCAAGGAGAAGCTGCGCCTTGATCCTGACAGCGAGATCGCC
ACCACCGGTGTGCGGGTGTCCCTCATCTGTCCGCTGGTGAAGATGCGGCTCTCCGTGCCCTGCCGGGCAGAGACCTGTGCCCACCTGCAG
TGCTTCGACGCCGTCTTCTACCTGCAGATGAACGAGAAGAAGCCCACCTGGATGTGCCCCGTGTGCGACAAGCCAGCCCCCTACGACCAG
CTCATCATCGACGGGCTCCTCTCGAAGATCCTGAGCGAGTGTGAGGACGCCGACGAGATCGAGTACCTGGTGGACGGCTCGTGGTGCCCG
ATCCGCGCCGAAAAGGAGCGCAGCTGCAGCCCGCAGGGCGCCATCCTCGTGCTGGGCCCCTCGGACGCCAATGGGCTCCTGCCCGCCCCC
AGCGTCAACGGGAGCGGTGCCCTGGGCAGCACGGGTGGCGGCGGCCCGGTGGGCAGCATGGAGAATGGGAAGCCGGGCGCCGATGTGGTG
GACCTCACGCTGGACAGCTCATCGTCCTCGGAGGATGAGGAGGAGGAGGAAGAGGAGGAGGAAGACGAGGACGAAGAGGGGCCCCGGCCC
AAGCGCCGCTGCCCCTTCCAGAAGGGCCTGGTGCCGGCCTGCTGACCCCGGCCGCACACTCGACTTTCCTGGTGCTCACCACGCAGAGGG
GCACGGGCCAGCCTCGGGCGCAGAGGGAGGAGTGACCTTTCTTTTTCTTTTTATTGTCGTTCGTTTTGTTTTTCCACCCTTTTGCCTGGC
TCCTGGCACCTGTACCTCTGGACTCTCCTATCGGGGGATTAAAAAAAAAAGTAAAATGACAAAAAAAGATACAAAAAAGAAAAATGAAAC
AAAAAAGTCAAACTCTTAAAAACAAGGCCGGCCACCCACACAGCCGCCTCCCCGGCTGGAGTCCGAGCCGGGAAGGGGTAGTGGGCGGGA
GGGACCAGGACGCCGCCCCGCGCCCTCCCCTCCGGATGCCCCGCCGCCCGCCGCCCTCTGCCCACGACCATTCCAGCCAGTGCGCGGGGA
CCCGGGCGGCGGGCGGTGGGGCGCAGCCCCTCTCTGGCGACCACTTTGACGTTTGTCTCTTCCTTTGCTTTTTCTCTGCAAATGCATCCT
CGCCCAGAGACCCTCACGCGCCGAGCAGCGAGCGTTTTAGCCGAGAAGCCATGGAGTGGGTTGGGGCGGGGAGGGGCAGTAGGGTGGGGG
GATGGGTGGGCAGGATGGGGGTACAGTGGGCGGCTGGGGAGGGTTTAGCCACAGATGTGTTGTATTTTTTGAAAGTGCAATAATTTGGTA
TTTTGAAGACCCGGCGTGTGGTCAGGAACCCCCGGGGAAGGCGGGGGCCCAGGGTGCGGCACCGTGTGGCGTGGGGGGGTCTCAGTTTTC
TAGCCAGCTACCTCGGTAATTCCAATTCAGGTTAACTTCCCTACGGAACAGCACAGATGTCCACAGATGTCCACAGCTGCCGCCGCCGCC
GCCGCCACCATACCCCGGTCCTTGGGGCATGGGTTGCGGTCGCTTCCCAAGGGGCAGCAGGGACCCCGGCCACCCCGGCTCTCGGTTTGG
GTTGATTCCTCTCCTTTTTGCTCTTGGTTTTCCGACGGGTACGAGGCTGGCCCGGCACCCTGTCCCCCGGGAGCCTCACTCTTCCAGCAG
GACCAGACCAGGGGCCTCCTTCCTGTCCCCAGGCGTTCCCGGCCCCTCGCAGGCCCCACCCATGCCCTTGGCCTCAGGGTCCAACAACTG
GGGGAGCTACCAGGGCTCTGCCTTCAGGAGCCCACAGCTGGGCACCCCCCTTGCCCCGCAGGAGACCGGGGCGCAGGCGGGGCACCGGCC
TCACCTGGTTCTCCAACACCGCTGCCTGCGGTCTGTTTTGCTTTTGTCCTCCCCAGCCCAGAATTTTCCTTTGTATAAACAGAACTCCTA
GTCAGGAAGCAATATCATTTCAGGTCTAAAGAAAGGGACGTGCATCTGGCCGAGGGCAGTTCAGTCTCACTGCAGAGCCCGCAGCCCGCT
GCGCAGCTCGGCCCCTCCCGCCCGCACGGGCAGCTGAAGGCCGCTGTTTTCTAATATTTGTATTCTAATTTAATTGTTTTTAAAAAATGC


Top

FusionGenePPI for CACNA1C_PIAS4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CACNA1CPCBD1, CACNB3, CABP1, RYR2, SRI, HDAC4, SIRT1, VCP, DERL1, TRIM13, CUL1, CAND1, COPS5, CALM1, KCNE2PIAS4LEF1, SMAD7, CALCOCO2, SMAD6, SMAD2, SMAD3, SMAD4, AR, ETS1, ZMIZ2, TP53BP1, BRCA1, PARP1, TCF4, SMAD1, CEBPD, TRIM27, HDAC1, HDAC2, SATB1, TRIM32, TGM2, KNTC1, ZW10, PRKCZ, HERC2, MDC1, ELAVL1, VHL, IKBKG, ERBB4, HTT, SUMO2, TADA3, BARD1, TCERG1, CLK1, GADD45G, UBE2K, IMMT, CHD3, IMPDH2, KPNB1, MAGEH1, NEFL, MAP1LC3A, LRIF1, PRPF40A, PTN, SH3GL3, TP53, VIM, ZHX1, SERBP1, PLAG1, TICAM1, IRF3, IRF7, SKIL, ZNF512B, PDE4DIP, PHGDH, OPTN, IL15RA, PHF11, KRT18, FTH1, ALDOA, ESRRA, LAMP2, OAZ1, SERPINA5, UBE2I, BTAF1, PIAS2, HNRNPUL1, MPRIP, ACTN1, MECOM, SUMO1, PDE4A, PDE4D, HIC1, HNF4A, TOP2A, CA10, EIF5B, REV1, AREL1, FANCA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexon