FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 5178

FusionGeneSummary for CACNA1C_DERA

check button Fusion gene summary
Fusion gene informationFusion gene name: CACNA1C_DERA
Fusion gene ID: 5178
HgeneTgene
Gene symbol

CACNA1C

DERA

Gene ID

775

51071

Gene namecalcium voltage-gated channel subunit alpha1 Cdeoxyribose-phosphate aldolase
SynonymsCACH2|CACN2|CACNL1A1|CCHL1A1|CaV1.2|LQT8|TSCGI-26|DEOC
Cytomap

12p13.33

12p12.3

Type of geneprotein-codingprotein-coding
Descriptionvoltage-dependent L-type calcium channel subunit alpha-1CDHPR, alpha-1 subunitcalcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac musclecalcium channel, cardic dihydropyridine-sensitive, alpha-1 subunitcalcium channel, voltage-dependent, deoxyribose-phosphate aldolase2-deoxy-D-ribose 5-phosphate aldolase2-deoxyribose-5-phosphate aldolase homologdeoxyriboaldolasedeoxyribose-phosphate aldolase (putative)phosphodeoxyriboaldolaseputative deoxyribose-phosphate aldolase
Modification date2018052320180523
UniProtAcc

Q13936

Q9Y315

Ensembl transtripts involved in fusion geneENST00000335762, ENST00000399655, 
ENST00000480911, ENST00000399644, 
ENST00000344100, ENST00000399638, 
ENST00000399629, ENST00000399597, 
ENST00000327702, ENST00000399621, 
ENST00000399649, ENST00000399637, 
ENST00000402845, ENST00000399591, 
ENST00000399641, ENST00000347598, 
ENST00000399606, ENST00000399595, 
ENST00000399601, ENST00000399603, 
ENST00000399634, ENST00000399617, 
ENST00000406454, ENST00000491104, 
ENST00000428559, ENST00000532964, 
ENST00000526530, ENST00000532573, 
Fusion gene scores* DoF score13 X 10 X 7=9103 X 2 X 3=18
# samples 123
** MAII scorelog2(12/910*10)=-2.92283213947754
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: CACNA1C [Title/Abstract] AND DERA [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCACNA1C

GO:0007204

positive regulation of cytosolic calcium ion concentration

12130699

HgeneCACNA1C

GO:0061577

calcium ion transmembrane transport via high voltage-gated calcium channel

15454078

HgeneCACNA1C

GO:0070588

calcium ion transmembrane transport

15454078

TgeneDERA

GO:0046121

deoxyribonucleoside catabolic process

9226884


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-EE-A2MR-06ACACNA1Cchr12

2622150

+DERAchr12

16109870

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000335762ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000335762ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000335762ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000335762ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399655ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399655ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000399655ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000399655ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000480911ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000480911ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000480911ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000480911ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399644ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399644ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000399644ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000399644ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000344100ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000344100ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000344100ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000344100ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399638ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399638ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000399638ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000399638ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399629ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399629ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000399629ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000399629ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399597ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399597ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000399597ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000399597ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000327702ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000327702ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000327702ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000327702ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399621ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399621ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000399621ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000399621ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399649ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399649ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000399649ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000399649ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399637ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399637ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000399637ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000399637ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000402845ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000402845ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000402845ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000402845ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399591ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399591ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000399591ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000399591ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399641ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399641ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000399641ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000399641ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000347598ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000347598ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000347598ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000347598ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399606ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399606ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000399606ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000399606ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399595ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399595ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000399595ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000399595ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399601ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399601ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000399601ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000399601ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399603ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399603ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000399603ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000399603ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399634ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399634ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000399634ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000399634ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399617ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000399617ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000399617ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000399617ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000406454ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
In-frameENST00000406454ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-5UTRENST00000406454ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
5CDS-intronENST00000406454ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+
3UTR-3CDSENST00000491104ENST00000428559CACNA1Cchr12

2622150

+DERAchr12

16109870

+
3UTR-3CDSENST00000491104ENST00000532964CACNA1Cchr12

2622150

+DERAchr12

16109870

+
3UTR-5UTRENST00000491104ENST00000526530CACNA1Cchr12

2622150

+DERAchr12

16109870

+
3UTR-intronENST00000491104ENST00000532573CACNA1Cchr12

2622150

+DERAchr12

16109870

+

Top

FusionProtFeatures for CACNA1C_DERA


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CACNA1C

Q13936

DERA

Q9Y315

Catalyzes a reversible aldol reaction betweenacetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5-phosphate. Participates in stress granule (SG)assembly. May allow ATP production from extracellular deoxyinosinein conditions of energy deprivation.{ECO:0000269|PubMed:25229427}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948351_3724632174IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947351_3724632180IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949351_3724632187IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946351_3724632147IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946351_3724632147IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947351_3724632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947351_3724632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947351_3724632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948351_3724632159IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948351_3724632174IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947351_3724632158IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947351_3724632156IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947351_3724632158IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948351_3724632167IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947351_3724632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947351_3724632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946351_3724632145IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947351_3724632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947351_3724632158IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948361_3644632174MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947361_3644632180MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949361_3644632187MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946361_3644632147MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946361_3644632147MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947361_3644632139MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947361_3644632139MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947361_3644632139MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948361_3644632159MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948361_3644632174MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947361_3644632158MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947361_3644632156MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947361_3644632158MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948361_3644632167MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947361_3644632139MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947361_3644632139MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946361_3644632145MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947361_3644632139MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947361_3644632158MotifSelectivity filter of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+94847_684632174RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+94747_684632180RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+94947_684632187RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+94647_684632147RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+94647_684632147RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+94747_684632139RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+94747_684632139RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+94747_684632139RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+94847_684632159RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+94847_684632174RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+94747_684632158RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+94747_684632156RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+94747_684632158RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+94847_684632167RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+94747_684632139RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+94747_684632139RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+94647_684632145RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+94747_684632139RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+94747_684632158RegionCalmodulin-binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948111_4084632174RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947111_4084632180RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949111_4084632187RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946111_4084632147RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946111_4084632147RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947111_4084632139RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947111_4084632139RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947111_4084632139RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948111_4084632159RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948111_4084632174RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947111_4084632158RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947111_4084632156RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947111_4084632158RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948111_4084632167RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947111_4084632139RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947111_4084632139RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946111_4084632145RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947111_4084632139RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947111_4084632158RepeatNote=I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948144_1584632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948180_1884632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481_1244632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948210_2324632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948252_2684632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948291_3504632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948373_3804632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947144_1584632180Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947180_1884632180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471_1244632180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947210_2324632180Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947252_2684632180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947291_3504632180Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947373_3804632180Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949144_1584632187Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949180_1884632187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491_1244632187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949210_2324632187Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949252_2684632187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949291_3504632187Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949373_3804632187Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946144_1584632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946180_1884632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461_1244632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946210_2324632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946252_2684632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946291_3504632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946373_3804632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946144_1584632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946180_1884632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461_1244632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946210_2324632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946252_2684632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946291_3504632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946373_3804632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947144_1584632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947180_1884632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471_1244632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947210_2324632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947252_2684632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947291_3504632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947373_3804632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947144_1584632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947180_1884632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471_1244632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947210_2324632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947252_2684632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947291_3504632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947373_3804632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947144_1584632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947180_1884632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471_1244632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947210_2324632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947252_2684632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947291_3504632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947373_3804632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948144_1584632159Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948180_1884632159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481_1244632159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948210_2324632159Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948252_2684632159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948291_3504632159Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948373_3804632159Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948144_1584632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948180_1884632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481_1244632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948210_2324632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948252_2684632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948291_3504632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948373_3804632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947144_1584632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947180_1884632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471_1244632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947210_2324632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947252_2684632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947291_3504632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947373_3804632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947144_1584632156Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947180_1884632156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471_1244632156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947210_2324632156Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947252_2684632156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947291_3504632156Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947373_3804632156Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947144_1584632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947180_1884632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471_1244632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947210_2324632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947252_2684632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947291_3504632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947373_3804632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948144_1584632167Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948180_1884632167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481_1244632167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948210_2324632167Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948252_2684632167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948291_3504632167Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948373_3804632167Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947144_1584632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947180_1884632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471_1244632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947210_2324632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947252_2684632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947291_3504632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947373_3804632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947144_1584632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947180_1884632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471_1244632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947210_2324632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947252_2684632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947291_3504632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947373_3804632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946144_1584632145Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946180_1884632145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461_1244632145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946210_2324632145Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946252_2684632145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946291_3504632145Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946373_3804632145Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947144_1584632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947180_1884632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471_1244632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947210_2324632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947252_2684632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947291_3504632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947373_3804632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947144_1584632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947180_1884632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471_1244632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947210_2324632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947252_2684632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947291_3504632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947373_3804632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948125_1434632174TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948159_1794632174TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948189_2094632174TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948233_2514632174TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948269_2904632174TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948381_4014632174TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947125_1434632180TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947159_1794632180TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947189_2094632180TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947233_2514632180TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947269_2904632180TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947381_4014632180TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949125_1434632187TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949159_1794632187TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949189_2094632187TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949233_2514632187TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949269_2904632187TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949381_4014632187TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946125_1434632147TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946159_1794632147TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946189_2094632147TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946233_2514632147TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946269_2904632147TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946381_4014632147TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946125_1434632147TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946159_1794632147TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946189_2094632147TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946233_2514632147TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946269_2904632147TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946381_4014632147TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947125_1434632139TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947159_1794632139TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947189_2094632139TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947233_2514632139TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947269_2904632139TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947381_4014632139TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947125_1434632139TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947159_1794632139TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947189_2094632139TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947233_2514632139TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947269_2904632139TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947381_4014632139TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947125_1434632139TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947159_1794632139TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947189_2094632139TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947233_2514632139TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947269_2904632139TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947381_4014632139TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948125_1434632159TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948159_1794632159TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948189_2094632159TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948233_2514632159TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948269_2904632159TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948381_4014632159TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948125_1434632174TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948159_1794632174TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948189_2094632174TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948233_2514632174TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948269_2904632174TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948381_4014632174TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947125_1434632158TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947159_1794632158TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947189_2094632158TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947233_2514632158TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947269_2904632158TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947381_4014632158TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947125_1434632156TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947159_1794632156TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947189_2094632156TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947233_2514632156TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947269_2904632156TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947381_4014632156TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947125_1434632158TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947159_1794632158TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947189_2094632158TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947233_2514632158TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947269_2904632158TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947381_4014632158TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948125_1434632167TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948159_1794632167TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948189_2094632167TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948233_2514632167TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948269_2904632167TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948381_4014632167TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947125_1434632139TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947159_1794632139TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947189_2094632139TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947233_2514632139TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947269_2904632139TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947381_4014632139TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947125_1434632139TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947159_1794632139TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947189_2094632139TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947233_2514632139TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947269_2904632139TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947381_4014632139TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946125_1434632145TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946159_1794632145TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946189_2094632145TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946233_2514632145TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946269_2904632145TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946381_4014632145TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947125_1434632139TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947159_1794632139TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947189_2094632139TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947233_2514632139TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947269_2904632139TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947381_4014632139TransmembraneHelical%3B Name%3DS6 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947125_1434632158TransmembraneHelical%3B Name%3DS1 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947159_1794632158TransmembraneHelical%3B Name%3DS2 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947189_2094632158TransmembraneHelical%3B Name%3DS3 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947233_2514632158TransmembraneHelical%3B Name%3DS4 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947269_2904632158TransmembraneHelical%3B Name%3DS5 of repeat I
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947381_4014632158TransmembraneHelical%3B Name%3DS6 of repeat I

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481553_15644632174Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471553_15644632180Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491553_15644632187Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461553_15644632147Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461553_15644632147Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471553_15644632139Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471553_15644632139Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471553_15644632139Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481553_15644632159Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481553_15644632174Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471553_15644632158Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471553_15644632156Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471553_15644632158Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481553_15644632167Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471553_15644632139Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471553_15644632139Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461553_15644632145Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471553_15644632139Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471553_15644632158Calcium bindingOntology_term=ECO:0000250
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481167_11734632174Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9482084_20874632174Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948654_6604632174Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948768_7744632174Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471167_11734632180Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9472084_20874632180Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947654_6604632180Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947768_7744632180Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491167_11734632187Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9492084_20874632187Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949654_6604632187Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949768_7744632187Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461167_11734632147Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9462084_20874632147Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946654_6604632147Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946768_7744632147Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461167_11734632147Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9462084_20874632147Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946654_6604632147Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946768_7744632147Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471167_11734632139Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9472084_20874632139Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947654_6604632139Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947768_7744632139Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471167_11734632139Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9472084_20874632139Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947654_6604632139Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947768_7744632139Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471167_11734632139Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9472084_20874632139Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947654_6604632139Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947768_7744632139Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481167_11734632159Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9482084_20874632159Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948654_6604632159Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948768_7744632159Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481167_11734632174Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9482084_20874632174Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948654_6604632174Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948768_7744632174Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471167_11734632158Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9472084_20874632158Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947654_6604632158Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947768_7744632158Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471167_11734632156Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9472084_20874632156Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947654_6604632156Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947768_7744632156Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471167_11734632158Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9472084_20874632158Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947654_6604632158Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947768_7744632158Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481167_11734632167Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9482084_20874632167Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948654_6604632167Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948768_7744632167Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471167_11734632139Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9472084_20874632139Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947654_6604632139Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947768_7744632139Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471167_11734632139Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9472084_20874632139Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947654_6604632139Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947768_7744632139Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461167_11734632145Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9462084_20874632145Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946654_6604632145Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946768_7744632145Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471167_11734632139Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9472084_20874632139Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947654_6604632139Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947768_7744632139Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471167_11734632158Compositional biasNote=Poly-Ile
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9472084_20874632158Compositional biasNote=Poly-Gly
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947654_6604632158Compositional biasNote=Poly-Leu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947768_7744632158Compositional biasNote=Poly-Glu
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481122_11424632174IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481453_14714632174IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948694_7154632174IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471122_11424632180IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471453_14714632180IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947694_7154632180IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491122_11424632187IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491453_14714632187IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949694_7154632187IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461122_11424632147IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461453_14714632147IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946694_7154632147IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461122_11424632147IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461453_14714632147IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946694_7154632147IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471122_11424632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471453_14714632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947694_7154632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471122_11424632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471453_14714632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947694_7154632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471122_11424632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471453_14714632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947694_7154632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481122_11424632159IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481453_14714632159IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948694_7154632159IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481122_11424632174IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481453_14714632174IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948694_7154632174IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471122_11424632158IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471453_14714632158IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947694_7154632158IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471122_11424632156IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471453_14714632156IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947694_7154632156IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471122_11424632158IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471453_14714632158IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947694_7154632158IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481122_11424632167IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481453_14714632167IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948694_7154632167IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471122_11424632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471453_14714632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947694_7154632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471122_11424632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471453_14714632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947694_7154632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461122_11424632145IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461453_14714632145IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946694_7154632145IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471122_11424632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471453_14714632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947694_7154632139IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471122_11424632158IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471453_14714632158IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947694_7154632158IntramembranePore-forming
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481133_11364632174MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481462_14654632174MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948704_7074632174MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471133_11364632180MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471462_14654632180MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947704_7074632180MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491133_11364632187MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491462_14654632187MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949704_7074632187MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461133_11364632147MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461462_14654632147MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946704_7074632147MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461133_11364632147MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461462_14654632147MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946704_7074632147MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471133_11364632139MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471462_14654632139MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947704_7074632139MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471133_11364632139MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471462_14654632139MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947704_7074632139MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471133_11364632139MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471462_14654632139MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947704_7074632139MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481133_11364632159MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481462_14654632159MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948704_7074632159MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481133_11364632174MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481462_14654632174MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948704_7074632174MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471133_11364632158MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471462_14654632158MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947704_7074632158MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471133_11364632156MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471462_14654632156MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947704_7074632156MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471133_11364632158MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471462_14654632158MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947704_7074632158MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481133_11364632167MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481462_14654632167MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948704_7074632167MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471133_11364632139MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471462_14654632139MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947704_7074632139MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471133_11364632139MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471462_14654632139MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947704_7074632139MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461133_11364632145MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461462_14654632145MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946704_7074632145MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471133_11364632139MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471462_14654632139MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947704_7074632139MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471133_11364632158MotifSelectivity filter of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471462_14654632158MotifSelectivity filter of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947704_7074632158MotifSelectivity filter of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481109_11984632174RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481478_15464632174RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481492_15344632174RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481665_16854632174RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481699_17184632174RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471109_11984632180RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471478_15464632180RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471492_15344632180RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471665_16854632180RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471699_17184632180RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491109_11984632187RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491478_15464632187RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491492_15344632187RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491665_16854632187RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491699_17184632187RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461109_11984632147RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461478_15464632147RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461492_15344632147RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461665_16854632147RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461699_17184632147RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461109_11984632147RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461478_15464632147RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461492_15344632147RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461665_16854632147RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461699_17184632147RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471109_11984632139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471478_15464632139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471492_15344632139RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471665_16854632139RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471699_17184632139RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471109_11984632139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471478_15464632139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471492_15344632139RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471665_16854632139RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471699_17184632139RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471109_11984632139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471478_15464632139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471492_15344632139RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471665_16854632139RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471699_17184632139RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481109_11984632159RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481478_15464632159RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481492_15344632159RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481665_16854632159RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481699_17184632159RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481109_11984632174RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481478_15464632174RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481492_15344632174RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481665_16854632174RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481699_17184632174RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471109_11984632158RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471478_15464632158RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471492_15344632158RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471665_16854632158RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471699_17184632158RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471109_11984632156RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471478_15464632156RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471492_15344632156RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471665_16854632156RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471699_17184632156RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471109_11984632158RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471478_15464632158RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471492_15344632158RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471665_16854632158RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471699_17184632158RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481109_11984632167RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481478_15464632167RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481492_15344632167RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481665_16854632167RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481699_17184632167RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471109_11984632139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471478_15464632139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471492_15344632139RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471665_16854632139RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471699_17184632139RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471109_11984632139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471478_15464632139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471492_15344632139RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471665_16854632139RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471699_17184632139RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461109_11984632145RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461478_15464632145RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461492_15344632145RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461665_16854632145RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461699_17184632145RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471109_11984632139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471478_15464632139RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471492_15344632139RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471665_16854632139RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471699_17184632139RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471109_11984632158RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471478_15464632158RegionDihydropyridine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471492_15344632158RegionPhenylalkylamine binding
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471665_16854632158RegionCalmodulin-binding IQ region
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471699_17184632158RegionImportant for localization in at the junctional membrane
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481226_15274632174RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948510_7564632174RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948887_11894632174RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471226_15274632180RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947510_7564632180RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947887_11894632180RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491226_15274632187RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949510_7564632187RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949887_11894632187RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461226_15274632147RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946510_7564632147RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946887_11894632147RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461226_15274632147RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946510_7564632147RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946887_11894632147RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471226_15274632139RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947510_7564632139RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947887_11894632139RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471226_15274632139RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947510_7564632139RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947887_11894632139RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471226_15274632139RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947510_7564632139RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947887_11894632139RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481226_15274632159RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948510_7564632159RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948887_11894632159RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481226_15274632174RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948510_7564632174RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948887_11894632174RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471226_15274632158RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947510_7564632158RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947887_11894632158RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471226_15274632156RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947510_7564632156RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947887_11894632156RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471226_15274632158RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947510_7564632158RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947887_11894632158RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481226_15274632167RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948510_7564632167RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948887_11894632167RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471226_15274632139RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947510_7564632139RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947887_11894632139RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471226_15274632139RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947510_7564632139RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947887_11894632139RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461226_15274632145RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946510_7564632145RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946887_11894632145RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471226_15274632139RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947510_7564632139RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947887_11894632139RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471226_15274632158RepeatNote=IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947510_7564632158RepeatNote=II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947887_11894632158RepeatNote=III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481007_10134632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481033_10514632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481072_11214632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481143_11594632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481182_12394632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481262_12694632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481292_13014632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481322_13724632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481392_14094632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481431_14524632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481472_14994632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481525_22214632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948402_5244632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948544_5544632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948576_5864632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948607_6154632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948635_6534632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948674_6934632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948716_7254632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948746_9004632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948920_9314632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948953_9874632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471007_10134632180Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471033_10514632180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471072_11214632180Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471143_11594632180Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471182_12394632180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471262_12694632180Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471292_13014632180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471322_13724632180Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471392_14094632180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471431_14524632180Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471472_14994632180Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471525_22214632180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947402_5244632180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947544_5544632180Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947576_5864632180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947607_6154632180Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947635_6534632180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947674_6934632180Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947716_7254632180Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947746_9004632180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947920_9314632180Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947953_9874632180Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491007_10134632187Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491033_10514632187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491072_11214632187Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491143_11594632187Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491182_12394632187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491262_12694632187Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491292_13014632187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491322_13724632187Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491392_14094632187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491431_14524632187Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491472_14994632187Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491525_22214632187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949402_5244632187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949544_5544632187Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949576_5864632187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949607_6154632187Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949635_6534632187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949674_6934632187Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949716_7254632187Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949746_9004632187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949920_9314632187Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949953_9874632187Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461007_10134632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461033_10514632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461072_11214632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461143_11594632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461182_12394632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461262_12694632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461292_13014632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461322_13724632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461392_14094632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461431_14524632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461472_14994632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461525_22214632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946402_5244632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946544_5544632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946576_5864632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946607_6154632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946635_6534632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946674_6934632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946716_7254632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946746_9004632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946920_9314632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946953_9874632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461007_10134632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461033_10514632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461072_11214632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461143_11594632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461182_12394632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461262_12694632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461292_13014632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461322_13724632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461392_14094632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461431_14524632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461472_14994632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461525_22214632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946402_5244632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946544_5544632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946576_5864632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946607_6154632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946635_6534632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946674_6934632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946716_7254632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946746_9004632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946920_9314632147Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946953_9874632147Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471007_10134632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471033_10514632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471072_11214632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471143_11594632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471182_12394632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471262_12694632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471292_13014632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471322_13724632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471392_14094632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471431_14524632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471472_14994632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471525_22214632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947402_5244632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947544_5544632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947576_5864632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947607_6154632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947635_6534632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947674_6934632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947716_7254632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947746_9004632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947920_9314632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947953_9874632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471007_10134632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471033_10514632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471072_11214632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471143_11594632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471182_12394632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471262_12694632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471292_13014632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471322_13724632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471392_14094632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471431_14524632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471472_14994632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471525_22214632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947402_5244632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947544_5544632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947576_5864632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947607_6154632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947635_6534632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947674_6934632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947716_7254632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947746_9004632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947920_9314632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947953_9874632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471007_10134632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471033_10514632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471072_11214632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471143_11594632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471182_12394632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471262_12694632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471292_13014632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471322_13724632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471392_14094632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471431_14524632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471472_14994632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471525_22214632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947402_5244632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947544_5544632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947576_5864632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947607_6154632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947635_6534632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947674_6934632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947716_7254632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947746_9004632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947920_9314632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947953_9874632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481007_10134632159Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481033_10514632159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481072_11214632159Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481143_11594632159Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481182_12394632159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481262_12694632159Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481292_13014632159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481322_13724632159Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481392_14094632159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481431_14524632159Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481472_14994632159Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481525_22214632159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948402_5244632159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948544_5544632159Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948576_5864632159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948607_6154632159Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948635_6534632159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948674_6934632159Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948716_7254632159Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948746_9004632159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948920_9314632159Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948953_9874632159Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481007_10134632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481033_10514632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481072_11214632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481143_11594632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481182_12394632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481262_12694632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481292_13014632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481322_13724632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481392_14094632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481431_14524632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481472_14994632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481525_22214632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948402_5244632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948544_5544632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948576_5864632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948607_6154632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948635_6534632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948674_6934632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948716_7254632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948746_9004632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948920_9314632174Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948953_9874632174Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471007_10134632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471033_10514632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471072_11214632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471143_11594632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471182_12394632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471262_12694632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471292_13014632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471322_13724632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471392_14094632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471431_14524632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471472_14994632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471525_22214632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947402_5244632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947544_5544632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947576_5864632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947607_6154632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947635_6534632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947674_6934632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947716_7254632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947746_9004632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947920_9314632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947953_9874632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471007_10134632156Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471033_10514632156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471072_11214632156Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471143_11594632156Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471182_12394632156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471262_12694632156Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471292_13014632156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471322_13724632156Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471392_14094632156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471431_14524632156Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471472_14994632156Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471525_22214632156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947402_5244632156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947544_5544632156Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947576_5864632156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947607_6154632156Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947635_6534632156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947674_6934632156Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947716_7254632156Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947746_9004632156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947920_9314632156Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947953_9874632156Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471007_10134632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471033_10514632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471072_11214632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471143_11594632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471182_12394632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471262_12694632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471292_13014632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471322_13724632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471392_14094632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471431_14524632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471472_14994632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471525_22214632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947402_5244632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947544_5544632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947576_5864632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947607_6154632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947635_6534632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947674_6934632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947716_7254632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947746_9004632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947920_9314632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947953_9874632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481007_10134632167Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481033_10514632167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481072_11214632167Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481143_11594632167Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481182_12394632167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481262_12694632167Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481292_13014632167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481322_13724632167Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481392_14094632167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481431_14524632167Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481472_14994632167Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481525_22214632167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948402_5244632167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948544_5544632167Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948576_5864632167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948607_6154632167Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948635_6534632167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948674_6934632167Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948716_7254632167Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948746_9004632167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948920_9314632167Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948953_9874632167Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471007_10134632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471033_10514632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471072_11214632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471143_11594632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471182_12394632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471262_12694632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471292_13014632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471322_13724632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471392_14094632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471431_14524632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471472_14994632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471525_22214632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947402_5244632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947544_5544632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947576_5864632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947607_6154632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947635_6534632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947674_6934632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947716_7254632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947746_9004632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947920_9314632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947953_9874632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471007_10134632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471033_10514632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471072_11214632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471143_11594632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471182_12394632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471262_12694632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471292_13014632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471322_13724632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471392_14094632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471431_14524632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471472_14994632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471525_22214632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947402_5244632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947544_5544632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947576_5864632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947607_6154632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947635_6534632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947674_6934632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947716_7254632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947746_9004632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947920_9314632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947953_9874632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461007_10134632145Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461033_10514632145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461072_11214632145Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461143_11594632145Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461182_12394632145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461262_12694632145Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461292_13014632145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461322_13724632145Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461392_14094632145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461431_14524632145Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461472_14994632145Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461525_22214632145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946402_5244632145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946544_5544632145Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946576_5864632145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946607_6154632145Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946635_6534632145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946674_6934632145Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946716_7254632145Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946746_9004632145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946920_9314632145Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946953_9874632145Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471007_10134632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471033_10514632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471072_11214632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471143_11594632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471182_12394632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471262_12694632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471292_13014632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471322_13724632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471392_14094632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471431_14524632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471472_14994632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471525_22214632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947402_5244632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947544_5544632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947576_5864632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947607_6154632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947635_6534632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947674_6934632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947716_7254632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947746_9004632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947920_9314632139Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947953_9874632139Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471007_10134632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471033_10514632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471072_11214632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471143_11594632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471182_12394632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471262_12694632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471292_13014632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471322_13724632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471392_14094632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471431_14524632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471472_14994632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471525_22214632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947402_5244632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947544_5544632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947576_5864632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947607_6154632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947635_6534632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947674_6934632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947716_7254632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947746_9004632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947920_9314632158Topological domainExtracellular
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947953_9874632158Topological domainCytoplasmic
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481014_10324632174TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481052_10714632174TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481160_11814632174TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481240_12614632174TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481270_12914632174TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481302_13214632174TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481373_13914632174TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481410_14304632174TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+9481500_15244632174TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948525_5434632174TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948555_5754632174TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948587_6064632174TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948616_6344632174TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948654_6734632174TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948726_7454632174TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948901_9194632174TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948932_9524632174TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000327702+948988_10064632174TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471014_10324632180TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471052_10714632180TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471160_11814632180TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471240_12614632180TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471270_12914632180TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471302_13214632180TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471373_13914632180TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471410_14304632180TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+9471500_15244632180TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947525_5434632180TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947555_5754632180TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947587_6064632180TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947616_6344632180TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947654_6734632180TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947726_7454632180TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947901_9194632180TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947932_9524632180TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000344100+947988_10064632180TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491014_10324632187TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491052_10714632187TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491160_11814632187TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491240_12614632187TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491270_12914632187TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491302_13214632187TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491373_13914632187TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491410_14304632187TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+9491500_15244632187TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949525_5434632187TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949555_5754632187TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949587_6064632187TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949616_6344632187TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949654_6734632187TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949726_7454632187TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949901_9194632187TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949932_9524632187TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000347598+949988_10064632187TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461014_10324632147TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461052_10714632147TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461160_11814632147TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461240_12614632147TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461270_12914632147TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461302_13214632147TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461373_13914632147TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461410_14304632147TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+9461500_15244632147TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946525_5434632147TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946555_5754632147TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946587_6064632147TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946616_6344632147TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946654_6734632147TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946726_7454632147TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946901_9194632147TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946932_9524632147TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399591+946988_10064632147TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461014_10324632147TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461052_10714632147TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461160_11814632147TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461240_12614632147TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461270_12914632147TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461302_13214632147TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461373_13914632147TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461410_14304632147TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+9461500_15244632147TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946525_5434632147TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946555_5754632147TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946587_6064632147TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946616_6344632147TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946654_6734632147TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946726_7454632147TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946901_9194632147TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946932_9524632147TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399595+946988_10064632147TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471014_10324632139TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471052_10714632139TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471160_11814632139TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471240_12614632139TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471270_12914632139TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471302_13214632139TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471373_13914632139TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471410_14304632139TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+9471500_15244632139TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947525_5434632139TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947555_5754632139TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947587_6064632139TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947616_6344632139TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947654_6734632139TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947726_7454632139TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947901_9194632139TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947932_9524632139TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399597+947988_10064632139TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471014_10324632139TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471052_10714632139TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471160_11814632139TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471240_12614632139TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471270_12914632139TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471302_13214632139TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471373_13914632139TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471410_14304632139TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+9471500_15244632139TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947525_5434632139TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947555_5754632139TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947587_6064632139TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947616_6344632139TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947654_6734632139TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947726_7454632139TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947901_9194632139TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947932_9524632139TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399601+947988_10064632139TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471014_10324632139TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471052_10714632139TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471160_11814632139TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471240_12614632139TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471270_12914632139TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471302_13214632139TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471373_13914632139TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471410_14304632139TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+9471500_15244632139TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947525_5434632139TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947555_5754632139TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947587_6064632139TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947616_6344632139TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947654_6734632139TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947726_7454632139TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947901_9194632139TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947932_9524632139TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399603+947988_10064632139TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481014_10324632159TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481052_10714632159TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481160_11814632159TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481240_12614632159TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481270_12914632159TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481302_13214632159TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481373_13914632159TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481410_14304632159TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+9481500_15244632159TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948525_5434632159TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948555_5754632159TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948587_6064632159TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948616_6344632159TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948654_6734632159TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948726_7454632159TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948901_9194632159TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948932_9524632159TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399606+948988_10064632159TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481014_10324632174TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481052_10714632174TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481160_11814632174TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481240_12614632174TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481270_12914632174TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481302_13214632174TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481373_13914632174TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481410_14304632174TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+9481500_15244632174TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948525_5434632174TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948555_5754632174TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948587_6064632174TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948616_6344632174TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948654_6734632174TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948726_7454632174TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948901_9194632174TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948932_9524632174TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399617+948988_10064632174TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471014_10324632158TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471052_10714632158TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471160_11814632158TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471240_12614632158TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471270_12914632158TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471302_13214632158TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471373_13914632158TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471410_14304632158TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+9471500_15244632158TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947525_5434632158TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947555_5754632158TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947587_6064632158TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947616_6344632158TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947654_6734632158TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947726_7454632158TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947901_9194632158TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947932_9524632158TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399621+947988_10064632158TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471014_10324632156TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471052_10714632156TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471160_11814632156TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471240_12614632156TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471270_12914632156TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471302_13214632156TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471373_13914632156TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471410_14304632156TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+9471500_15244632156TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947525_5434632156TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947555_5754632156TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947587_6064632156TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947616_6344632156TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947654_6734632156TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947726_7454632156TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947901_9194632156TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947932_9524632156TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399629+947988_10064632156TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471014_10324632158TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471052_10714632158TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471160_11814632158TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471240_12614632158TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471270_12914632158TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471302_13214632158TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471373_13914632158TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471410_14304632158TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+9471500_15244632158TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947525_5434632158TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947555_5754632158TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947587_6064632158TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947616_6344632158TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947654_6734632158TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947726_7454632158TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947901_9194632158TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947932_9524632158TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399637+947988_10064632158TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481014_10324632167TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481052_10714632167TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481160_11814632167TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481240_12614632167TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481270_12914632167TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481302_13214632167TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481373_13914632167TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481410_14304632167TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+9481500_15244632167TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948525_5434632167TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948555_5754632167TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948587_6064632167TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948616_6344632167TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948654_6734632167TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948726_7454632167TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948901_9194632167TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948932_9524632167TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399638+948988_10064632167TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471014_10324632139TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471052_10714632139TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471160_11814632139TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471240_12614632139TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471270_12914632139TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471302_13214632139TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471373_13914632139TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471410_14304632139TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+9471500_15244632139TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947525_5434632139TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947555_5754632139TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947587_6064632139TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947616_6344632139TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947654_6734632139TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947726_7454632139TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947901_9194632139TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947932_9524632139TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399641+947988_10064632139TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471014_10324632139TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471052_10714632139TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471160_11814632139TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471240_12614632139TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471270_12914632139TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471302_13214632139TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471373_13914632139TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471410_14304632139TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+9471500_15244632139TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947525_5434632139TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947555_5754632139TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947587_6064632139TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947616_6344632139TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947654_6734632139TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947726_7454632139TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947901_9194632139TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947932_9524632139TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399644+947988_10064632139TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461014_10324632145TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461052_10714632145TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461160_11814632145TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461240_12614632145TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461270_12914632145TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461302_13214632145TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461373_13914632145TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461410_14304632145TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+9461500_15244632145TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946525_5434632145TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946555_5754632145TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946587_6064632145TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946616_6344632145TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946654_6734632145TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946726_7454632145TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946901_9194632145TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946932_9524632145TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399649+946988_10064632145TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471014_10324632139TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471052_10714632139TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471160_11814632139TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471240_12614632139TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471270_12914632139TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471302_13214632139TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471373_13914632139TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471410_14304632139TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+9471500_15244632139TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947525_5434632139TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947555_5754632139TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947587_6064632139TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947616_6344632139TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947654_6734632139TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947726_7454632139TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947901_9194632139TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947932_9524632139TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000399655+947988_10064632139TransmembraneHelical%3B Name%3DS3 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471014_10324632158TransmembraneHelical%3B Name%3DS4 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471052_10714632158TransmembraneHelical%3B Name%3DS5 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471160_11814632158TransmembraneHelical%3B Name%3DS6 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471240_12614632158TransmembraneHelical%3B Name%3DS1 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471270_12914632158TransmembraneHelical%3B Name%3DS2 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471302_13214632158TransmembraneHelical%3B Name%3DS3 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471373_13914632158TransmembraneHelical%3B Name%3DS4 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471410_14304632158TransmembraneHelical%3B Name%3DS5 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+9471500_15244632158TransmembraneHelical%3B Name%3DS6 of repeat IV
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947525_5434632158TransmembraneHelical%3B Name%3DS1 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947555_5754632158TransmembraneHelical%3B Name%3DS2 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947587_6064632158TransmembraneHelical%3B Name%3DS3 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947616_6344632158TransmembraneHelical%3B Name%3DS4 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947654_6734632158TransmembraneHelical%3B Name%3DS5 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947726_7454632158TransmembraneHelical%3B Name%3DS6 of repeat II
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947901_9194632158TransmembraneHelical%3B Name%3DS1 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947932_9524632158TransmembraneHelical%3B Name%3DS2 of repeat III
HgeneCACNA1Cchr12:2622150chr12:16109870ENST00000402845+947988_10064632158TransmembraneHelical%3B Name%3DS3 of repeat III


Top

FusionGeneSequence for CACNA1C_DERA


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CACNA1C_ENST00000335762_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000335762_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000399655_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000399655_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000480911_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000480911_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000399644_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000399644_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000344100_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000344100_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000399638_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000399638_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000399629_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000399629_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000399597_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000399597_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000327702_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000327702_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000399621_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000399621_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000399649_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000399649_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000399637_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000399637_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000402845_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000402845_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000399591_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000399591_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000399641_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000399641_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000347598_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000347598_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000399606_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000399606_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000399595_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000399595_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000399601_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000399601_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000399603_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000399603_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000399634_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000399634_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000399617_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000399617_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA

>In-frame_CACNA1C_ENST00000406454_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_772aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQ
FRKACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLA

>In-frame_CACNA1C_ENST00000406454_chr12_2622150_+_DERA_ENST00000532964_chr12_16109870_+_729aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNNLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKAL
NMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEGSDFIKTS
TGKETVNATFPVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQIYHHVTGRYA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CACNA1C_ENST00000335762_chr12_2622150_+_DERA_ENST00000428559_chr12_16109870_+_2316nt
ATGGTCAATGAGAATACGAGGATGTACATTCCAGAGGAAAACCACCAAGGTTCCAACTATGGGAGCCCACGCCCCGCCCATGCCAACATG
AATGCCAATGCGGCAGCGGGGCTGGCCCCTGAGCACATCCCCACCCCGGGGGCTGCCCTGTCGTGGCAGGCGGCCATCGACGCAGCCCGG
CAGGCTAAGCTGATGGGCAGCGCTGGCAATGCGACCATCTCCACAGTCAGCTCCACGCAGCGGAAGCGGCAGCAATATGGGAAACCCAAG
AAGCAGGGCAGCACCACGGCCACACGCCCGCCCCGAGCCCTGCTCTGCCTGACCCTGAAGAACCCCATCCGGAGGGCCTGCATCAGCATT
GTCGAATGGAAACCATTTGAAATAATTATTTTACTGACTATTTTTGCCAATTGTGTGGCCTTAGCGATCTATATTCCCTTTCCAGAAGAT
GATTCCAACGCCACCAATTCCAACCTGGAACGAGTGGAATATCTCTTTCTCATAATTTTTACGGTGGAAGCGTTTTTAAAAGTAATCGCC
TATGGACTCCTCTTTCAC