FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4755

FusionGeneSummary for C16orf87_CNOT1

check button Fusion gene summary
Fusion gene informationFusion gene name: C16orf87_CNOT1
Fusion gene ID: 4755
HgeneTgene
Gene symbol

C16orf87

CNOT1

Gene ID

388272

23019

Gene namechromosome 16 open reading frame 87CCR4-NOT transcription complex subunit 1
Synonyms-AD-005|CDC39|NOT1|NOT1H
Cytomap

16q11.2

16q21

Type of geneprotein-codingprotein-coding
DescriptionUPF0547 protein C16orf87CCR4-NOT transcription complex subunit 1CCR4-associated factor 1NOT1 (negative regulator of transcription 1, yeast) homologadrenal gland protein AD-005negative regulator of transcription subunit 1 homolog
Modification date2018051920180523
UniProtAcc

Q6PH81

A5YKK6

Ensembl transtripts involved in fusion geneENST00000394806, ENST00000285697, 
ENST00000564250, 
ENST00000317147, 
ENST00000569240, ENST00000441024, 
ENST00000569732, ENST00000245138, 
Fusion gene scores* DoF score2 X 1 X 2=44 X 5 X 3=60
# samples 25
** MAII scorelog2(2/4*10)=2.32192809488736log2(5/60*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: C16orf87 [Title/Abstract] AND CNOT1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneCNOT1

GO:0000122

negative regulation of transcription by RNA polymerase II

16778766

TgeneCNOT1

GO:0010606

positive regulation of cytoplasmic mRNA processing body assembly

21976065

TgeneCNOT1

GO:0017148

negative regulation of translation

24736845

TgeneCNOT1

GO:0033147

negative regulation of intracellular estrogen receptor signaling pathway

16778766

TgeneCNOT1

GO:0035195

gene silencing by miRNA

23172285|24768540

TgeneCNOT1

GO:0048387

negative regulation of retinoic acid receptor signaling pathway

16778766

TgeneCNOT1

GO:0060213

positive regulation of nuclear-transcribed mRNA poly(A) tail shortening

23644599


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVKIRCTCGA-CJ-4923-01AC16orf87chr16

46864996

-CNOT1chr16

58581200

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000394806ENST00000317147C16orf87chr16

46864996

-CNOT1chr16

58581200

-
In-frameENST00000394806ENST00000569240C16orf87chr16

46864996

-CNOT1chr16

58581200

-
In-frameENST00000394806ENST00000441024C16orf87chr16

46864996

-CNOT1chr16

58581200

-
5CDS-intronENST00000394806ENST00000569732C16orf87chr16

46864996

-CNOT1chr16

58581200

-
5CDS-intronENST00000394806ENST00000245138C16orf87chr16

46864996

-CNOT1chr16

58581200

-
In-frameENST00000285697ENST00000317147C16orf87chr16

46864996

-CNOT1chr16

58581200

-
In-frameENST00000285697ENST00000569240C16orf87chr16

46864996

-CNOT1chr16

58581200

-
In-frameENST00000285697ENST00000441024C16orf87chr16

46864996

-CNOT1chr16

58581200

-
5CDS-intronENST00000285697ENST00000569732C16orf87chr16

46864996

-CNOT1chr16

58581200

-
5CDS-intronENST00000285697ENST00000245138C16orf87chr16

46864996

-CNOT1chr16

58581200

-
intron-3CDSENST00000564250ENST00000317147C16orf87chr16

46864996

-CNOT1chr16

58581200

-
intron-3CDSENST00000564250ENST00000569240C16orf87chr16

46864996

-CNOT1chr16

58581200

-
intron-3CDSENST00000564250ENST00000441024C16orf87chr16

46864996

-CNOT1chr16

58581200

-
intron-intronENST00000564250ENST00000569732C16orf87chr16

46864996

-CNOT1chr16

58581200

-
intron-intronENST00000564250ENST00000245138C16orf87chr16

46864996

-CNOT1chr16

58581200

-

Top

FusionProtFeatures for C16orf87_CNOT1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
C16orf87

Q6PH81

CNOT1

A5YKK6


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCNOT1chr16:46864996chr16:58581200ENST00000317147-25491333_135012132377Compositional biasNote=Thr-rich
TgeneCNOT1chr16:46864996chr16:58581200ENST00000441024-25311333_135012131552Compositional biasNote=Thr-rich
TgeneCNOT1chr16:46864996chr16:58581200ENST00000569240-25491333_135012082372Compositional biasNote=Thr-rich
TgeneCNOT1chr16:46864996chr16:58581200ENST00000317147-25491639_164312132377MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000317147-25491942_194612132377MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000317147-25492096_210012132377MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000441024-25311639_164312131552MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000441024-25311942_194612131552MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000441024-25312096_210012131552MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000569240-25491639_164312082372MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000569240-25491942_194612082372MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000569240-25492096_210012082372MotifNote=LXXLL

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneC16orf87chr16:46864996chr16:58581200ENST00000285697-14104_13222155Coiled coilOntology_term=ECO:0000255
HgeneC16orf87chr16:46864996chr16:58581200ENST00000394806-13104_1322294Coiled coilOntology_term=ECO:0000255
TgeneCNOT1chr16:46864996chr16:58581200ENST00000317147-2549153_15712132377MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000317147-2549181_18512132377MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000317147-2549223_22712132377MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000317147-2549570_57412132377MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000441024-2531153_15712131552MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000441024-2531181_18512131552MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000441024-2531223_22712131552MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000441024-2531570_57412131552MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000569240-2549153_15712082372MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000569240-2549181_18512082372MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000569240-2549223_22712082372MotifNote=LXXLL
TgeneCNOT1chr16:46864996chr16:58581200ENST00000569240-2549570_57412082372MotifNote=LXXLL


Top

FusionGeneSequence for C16orf87_CNOT1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_C16orf87_ENST00000394806_chr16_46864996_-_CNOT1_ENST00000317147_chr16_58581200_-_1186aa
MSATRAKKVKMATKSCPECDQQDLDVKSLLLEATVKGQQELLTVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDLKLNLKF
EIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLSAPKKDVKQPEELPPITTTTTSTTPATNTTCTATVPPQPQYSYHDINVTSLAGLA
PHITLNPTIPLFQAHPQLKQCVRQAIERAVQELVHPVVDRSIKIAMTTCEQIVRKDFALDSEESRMRIAAHHMMRNLTAGMAMITCREPL
LMSISTNLKNSFASALRTASPQQREMMDQAAAQLAQDNCELACCFIQKTAVEKAGPEMDKRLATEFELRKHARQEGRRYCDPVVLTTQAE
RMPEQIRLKVGGVDPKQLAVYEEFARNVPGFLPTNDLSQPTGFLAQPMKQAWATDDVAQITDKCITELEQHLHAIPPTLAMNPQAQALRS
LLEVVVLSRNSRDAIAALGLLQKAVEGLLDATSGADADLLLRYRECHLLVLKALQDGRATGSPWCNKQITRCLIECRDETKTNVEAVELL
IRNHLVNMQQTDLHLAQSMENGLNYMAVAFAMQLVKILLVDERSVAHVTEADLFHTIETLMRINAHSRGNAPEGLPQLMEVVRSNTEAMI
DRAHGGPNFMMHSGISQASETDDPPGLREKAETLLREWVNLYHSAAAGRDSTKAFSAFVGQMHQQGILKTDDLITRFFRLCTEMCVEISY
RAQAEQQHNPAANPTMIRAKCTHNLDAFVRLIALLVKHSGEATNTVTKINLLNKVLGIVVGVLLQDHDVRQSEFQQLPYHRIFIMLLLEL
NAPEHVLETINFQTLTAFCNTFHILRPTKAPGFVTAWLELISHRIFIARMLAHTPQQKGWPMTAQLLIDLFKTLAPFLRNVELTKPMQIL
YKGTLRVLLVLLHDFPEFLCDYHTGFCDVIPPNCIQLRNLILSAFPRNMRLPDPFTPNLKVDMLSEINIAPRILTNFTGVMPPQFKKDLD
STLKTRSPVTFLSDLRSNLQVSNEPGNRYNLQLINALVLTVGTQAIAHIHNKGSTPSMSTITHSAHMDIFQNLAVDLDTEGRTLFLNAIA
NQLRYPNSHTHYFSCTMLYLFAEANTEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPAFKFWNHEFVHCAPEIEKLFQSVAQCCM

>In-frame_C16orf87_ENST00000394806_chr16_46864996_-_CNOT1_ENST00000569240_chr16_58581200_-_1186aa
MSATRAKKVKMATKSCPECDQQDLDVKSLLLEATVKGQQELLTVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDLKLNLKF
EIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLSAPKKDVKQPEELPPITTTTTSTTPATNTTCTATVPPQPQYSYHDINVTSLAGLA
PHITLNPTIPLFQAHPQLKQCVRQAIERAVQELVHPVVDRSIKIAMTTCEQIVRKDFALDSEESRMRIAAHHMMRNLTAGMAMITCREPL
LMSISTNLKNSFASALRTASPQQREMMDQAAAQLAQDNCELACCFIQKTAVEKAGPEMDKRLATEFELRKHARQEGRRYCDPVVLTTQAE
RMPEQIRLKVGGVDPKQLAVYEEFARNVPGFLPTNDLSQPTGFLAQPMKQAWATDDVAQITDKCITELEQHLHAIPPTLAMNPQAQALRS
LLEVVVLSRNSRDAIAALGLLQKAVEGLLDATSGADADLLLRYRECHLLVLKALQDGRATGSPWCNKQITRCLIECRDETKTNVEAVELL
IRNHLVNMQQTDLHLAQSMENGLNYMAVAFAMQLVKILLVDERSVAHVTEADLFHTIETLMRINAHSRGNAPEGLPQLMEVVRSNTEAMI
DRAHGGPNFMMHSGISQASETDDPPGLREKAETLLREWVNLYHSAAAGRDSTKAFSAFVGQMHQQGILKTDDLITRFFRLCTEMCVEISY
RAQAEQQHNPAANPTMIRAKCTHNLDAFVRLIALLVKHSGEATNTVTKINLLNKVLGIVVGVLLQDHDVRQSEFQQLPYHRIFIMLLLEL
NAPEHVLETINFQTLTAFCNTFHILRPTKAPGFVTAWLELISHRIFIARMLAHTPQQKGWPMTAQLLIDLFKTLAPFLRNVELTKPMQIL
YKGTLRVLLVLLHDFPEFLCDYHTGFCDVIPPNCIQLRNLILSAFPRNMRLPDPFTPNLKVDMLSEINIAPRILTNFTGVMPPQFKKDLD
STLKTRSPVTFLSDLRSNLQVSNEPGNRYNLQLINALVLTVGTQAIAHIHNKGSTPSMSTITHSAHMDIFQNLAVDLDTEGRTLFLNAIA
NQLRYPNSHTHYFSCTMLYLFAEANTEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPAFKFWNHEFVHCAPEIEKLFQSVAQCCM

>In-frame_C16orf87_ENST00000394806_chr16_46864996_-_CNOT1_ENST00000441024_chr16_58581200_-_361aa
MSATRAKKVKMATKSCPECDQQDLDVKSLLLEATVKGQQELLTVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDLKLNLKF
EIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLSAPKKDVKQPEELPPITTTTTSTTPATNTTCTATVPPQPQYSYHDINVTSLAGLA
PHITLNPTIPLFQAHPQLKQCVRQAIERAVQELVHPVVDRSIKIAMTTCEQIVRKDFALDSEESRMRIAAHHMMRNLTAGMAMITCREPL
LMSISTNLKNSFASALRVSWLFPWTRYKTTYCLSVIIFFFVTIWHWALPLILNNHHICLMSSIILDCNSVRQSIMSVCFFFFLLTSQHDV

>In-frame_C16orf87_ENST00000285697_chr16_46864996_-_CNOT1_ENST00000317147_chr16_58581200_-_1186aa
MSATRAKKVKMATKSCPECDQQDLDVKSLLLEATVKGQQELLTVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDLKLNLKF
EIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLSAPKKDVKQPEELPPITTTTTSTTPATNTTCTATVPPQPQYSYHDINVTSLAGLA
PHITLNPTIPLFQAHPQLKQCVRQAIERAVQELVHPVVDRSIKIAMTTCEQIVRKDFALDSEESRMRIAAHHMMRNLTAGMAMITCREPL
LMSISTNLKNSFASALRTASPQQREMMDQAAAQLAQDNCELACCFIQKTAVEKAGPEMDKRLATEFELRKHARQEGRRYCDPVVLTTQAE
RMPEQIRLKVGGVDPKQLAVYEEFARNVPGFLPTNDLSQPTGFLAQPMKQAWATDDVAQITDKCITELEQHLHAIPPTLAMNPQAQALRS
LLEVVVLSRNSRDAIAALGLLQKAVEGLLDATSGADADLLLRYRECHLLVLKALQDGRATGSPWCNKQITRCLIECRDETKTNVEAVELL
IRNHLVNMQQTDLHLAQSMENGLNYMAVAFAMQLVKILLVDERSVAHVTEADLFHTIETLMRINAHSRGNAPEGLPQLMEVVRSNTEAMI
DRAHGGPNFMMHSGISQASETDDPPGLREKAETLLREWVNLYHSAAAGRDSTKAFSAFVGQMHQQGILKTDDLITRFFRLCTEMCVEISY
RAQAEQQHNPAANPTMIRAKCTHNLDAFVRLIALLVKHSGEATNTVTKINLLNKVLGIVVGVLLQDHDVRQSEFQQLPYHRIFIMLLLEL
NAPEHVLETINFQTLTAFCNTFHILRPTKAPGFVTAWLELISHRIFIARMLAHTPQQKGWPMTAQLLIDLFKTLAPFLRNVELTKPMQIL
YKGTLRVLLVLLHDFPEFLCDYHTGFCDVIPPNCIQLRNLILSAFPRNMRLPDPFTPNLKVDMLSEINIAPRILTNFTGVMPPQFKKDLD
STLKTRSPVTFLSDLRSNLQVSNEPGNRYNLQLINALVLTVGTQAIAHIHNKGSTPSMSTITHSAHMDIFQNLAVDLDTEGRTLFLNAIA
NQLRYPNSHTHYFSCTMLYLFAEANTEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPAFKFWNHEFVHCAPEIEKLFQSVAQCCM

>In-frame_C16orf87_ENST00000285697_chr16_46864996_-_CNOT1_ENST00000569240_chr16_58581200_-_1186aa
MSATRAKKVKMATKSCPECDQQDLDVKSLLLEATVKGQQELLTVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDLKLNLKF
EIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLSAPKKDVKQPEELPPITTTTTSTTPATNTTCTATVPPQPQYSYHDINVTSLAGLA
PHITLNPTIPLFQAHPQLKQCVRQAIERAVQELVHPVVDRSIKIAMTTCEQIVRKDFALDSEESRMRIAAHHMMRNLTAGMAMITCREPL
LMSISTNLKNSFASALRTASPQQREMMDQAAAQLAQDNCELACCFIQKTAVEKAGPEMDKRLATEFELRKHARQEGRRYCDPVVLTTQAE
RMPEQIRLKVGGVDPKQLAVYEEFARNVPGFLPTNDLSQPTGFLAQPMKQAWATDDVAQITDKCITELEQHLHAIPPTLAMNPQAQALRS
LLEVVVLSRNSRDAIAALGLLQKAVEGLLDATSGADADLLLRYRECHLLVLKALQDGRATGSPWCNKQITRCLIECRDETKTNVEAVELL
IRNHLVNMQQTDLHLAQSMENGLNYMAVAFAMQLVKILLVDERSVAHVTEADLFHTIETLMRINAHSRGNAPEGLPQLMEVVRSNTEAMI
DRAHGGPNFMMHSGISQASETDDPPGLREKAETLLREWVNLYHSAAAGRDSTKAFSAFVGQMHQQGILKTDDLITRFFRLCTEMCVEISY
RAQAEQQHNPAANPTMIRAKCTHNLDAFVRLIALLVKHSGEATNTVTKINLLNKVLGIVVGVLLQDHDVRQSEFQQLPYHRIFIMLLLEL
NAPEHVLETINFQTLTAFCNTFHILRPTKAPGFVTAWLELISHRIFIARMLAHTPQQKGWPMTAQLLIDLFKTLAPFLRNVELTKPMQIL
YKGTLRVLLVLLHDFPEFLCDYHTGFCDVIPPNCIQLRNLILSAFPRNMRLPDPFTPNLKVDMLSEINIAPRILTNFTGVMPPQFKKDLD
STLKTRSPVTFLSDLRSNLQVSNEPGNRYNLQLINALVLTVGTQAIAHIHNKGSTPSMSTITHSAHMDIFQNLAVDLDTEGRTLFLNAIA
NQLRYPNSHTHYFSCTMLYLFAEANTEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPAFKFWNHEFVHCAPEIEKLFQSVAQCCM

>In-frame_C16orf87_ENST00000285697_chr16_46864996_-_CNOT1_ENST00000441024_chr16_58581200_-_361aa
MSATRAKKVKMATKSCPECDQQDLDVKSLLLEATVKGQQELLTVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDLKLNLKF
EIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLSAPKKDVKQPEELPPITTTTTSTTPATNTTCTATVPPQPQYSYHDINVTSLAGLA
PHITLNPTIPLFQAHPQLKQCVRQAIERAVQELVHPVVDRSIKIAMTTCEQIVRKDFALDSEESRMRIAAHHMMRNLTAGMAMITCREPL
LMSISTNLKNSFASALRVSWLFPWTRYKTTYCLSVIIFFFVTIWHWALPLILNNHHICLMSSIILDCNSVRQSIMSVCFFFFLLTSQHDV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_C16orf87_ENST00000394806_chr16_46864996_-_CNOT1_ENST00000317147_chr16_58581200_-_3558nt
ATGTCTGCAACTCGAGCCAAGAAAGTGAAGATGGCCACCAAATCATGCCCCGAGTGCGACCAACAGGACTTGGATGTGAAATCATTGCTG
CTAGAGGCTTATGTTAAAGGACAACAAGAATTGCTCTATGTAGTGCCCTTTGTTGCCAAAGTCTTAGAATCTAGCATTCGTAGTGTGGTT
TTTAGGCCACCAAACCCTTGGACAATGGCAATTATGAATGTATTAGCTGAGCTACATCAGGAGCATGACTTAAAGTTAAACTTGAAGTTT
GAAATCGAGGTTCTCTGCAAGAACCTTGCATTAGACATCAATGAGCTAAAACCTGGAAACCTCCTAAAGGATAAAGATCGCCTGAAGAAT
TTAGATGAGCAACTCTCTGCTCCAAAGAAAGATGTCAAGCAGCCAGAAGAACTCCCTCCCATCACAACCACAACAACTTCTACTACACCA
GCTACCAACACCACTTGTACAGCCACGGTTCCACCACAGCCACAGTACAGCTACCACGACATCAATGTCTATTCCCTTGCGGGCTTGGCA
CCACACATTACTCTGAATCCAACAATTCCCTTGTTTCAGGCCCATCCACAGTTGAAGCAGTGTGTGCGTCAGGCAATTGAACGGGCTGTC
CAGGAGCTGGTCCATCCTGTGGTGGATCGATCAATTAAGATTGCCATGACTACTTGTGAGCAAATAGTCAGGAAGGATTTTGCCCTGGAT
TCGGAGGAATCTCGAATGCGAATAGCAGCTCATCACATGATGCGTAACTTGACAGCTGGAATGGCTATGATTACATGCAGGGAACCTTTG
CTCATGAGCATATCTACCAACTTAAAAAACAGTTTTGCCTCAGCCCTTCGTACTGCTTCCCCACAACAAAGAGAAATGATGGATCAGGCA
GCTGCTCAATTAGCTCAGGACAATTGTGAGTTGGCTTGCTGTTTTATTCAGAAGACTGCAGTAGAAAAAGCAGGCCCTGAGATGGACAAG
AGATTAGCAACTGAATTTGAGCTGAGAAAACATGCTAGGCAAGAAGGACGCAGATACTGTGATCCTGTTGTTTTAACATATCAAGCTGAA
CGGATGCCAGAGCAAATCAGGCTGAAAGTTGGTGGTGTGGACCCAAAGCAGTTGGCTGTTTACGAAGAGTTTGCACGCAATGTTCCTGGC
TTCTTACCTACAAATGACTTAAGTCAGCCCACGGGATTTTTAGCCCAGCCCATGAAGCAAGCTTGGGCAACAGATGATGTAGCTCAGATT
TATGATAAGTGTATTACAGAACTGGAGCAACATCTACATGCCATCCCACCAACTTTGGCCATGAACCCTCAAGCTCAGGCTCTTCGAAGT
CTCTTGGAGGTTGTAGTTTTATCTCGAAACTCTCGGGATGCCATAGCTGCTCTTGGATTGCTCCAAAAGGCTGTAGAGGGCTTACTAGAT
GCCACAAGTGGTGCTGATGCTGACCTTCTGCTGCGCTACAGGGAATGCCACCTCTTGGTCCTAAAAGCTCTGCAGGATGGCCGGGCATAT
GGGTCTCCATGGTGCAACAAACAGATCACAAGGTGCCTAATTGAATGTCGAGATGAATATAAATATAATGTGGAGGCTGTGGAGCTGCTA
ATTCGCAATCATTTGGTTAATATGCAGCAGTATGATCTTCACCTAGCGCAGTCAATGGAGAATGGCTTAAACTACATGGCTGTGGCATTT
GCTATGCAGTTAGTAAAAATCCTGCTGGTGGATGAAAGGAGTGTTGCTCATGTTACTGAGGCAGATCTGTTCCACACCATTGAAACCCTC
ATGAGGATTAATGCTCATTCCAGAGGCAATGCTCCAGAAGGATTGCCCCAGCTGATGGAAGTAGTGCGATCCAACTATGAAGCAATGATT
GATCGTGCTCATGGAGGCCCAAACTTTATGATGCATTCTGGGATCTCTCAAGCCTCAGAGTATGATGACCCTCCAGGCCTGAGGGAGAAG
GCAGAGTATCTTCTGAGGGAATGGGTGAATCTCTACCATTCAGCAGCAGCTGGCCGCGACAGTACCAAAGCTTTCTCTGCATTTGTTGGA
CAGATGCACCAGCAAGGAATACTGAAGACCGATGATCTCATAACAAGGTTCTTTCGTCTGTGTACTGAAATGTGTGTTGAAATCAGTTAC
CGTGCTCAGGCTGAGCAGCAGCACAATCCTGCTGCCAATCCCACCATGATCCGAGCCAAGTGCTATCACAACCTGGATGCCTTTGTTCGA
CTCATTGCACTGCTCGTGAAACACTCAGGGGAGGCCACCAACACTGTCACAAAGATTAATCTGCTGAACAAGGTCCTTGGTATAGTAGTG
GGAGTTCTCCTTCAGGATCATGATGTTCGTCAGAGTGAATTTCAGCAACTTCCCTACCATCGAATTTTTATCATGCTTCTCTTGGAACTC
AATGCACCTGAGCATGTGTTGGAAACCATTAATTTCCAGACACTTACAGCTTTCTGCAATACATTCCACATCTTGAGGCCTACCAAAGCT
CCTGGCTTTGTATATGCCTGGCTTGAACTGATTTCCCATCGGATATTTATTGCAAGAATGCTGGCACATACGCCACAGCAGAAGGGGTGG
CCTATGTATGCACAGCTACTGATTGATTTATTCAAATATTTAGCGCCTTTCCTTAGAAATGTGGAACTCACCAAACCTATGCAAATCCTC
TACAAGGGCACTTTAAGAGTGCTGCTGGTTCTTTTGCATGATTTCCCAGAGTTCCTTTGTGATTACCATTATGGGTTCTGTGATGTGATC
CCACCTAATTGTATCCAGTTAAGAAATTTGATCCTGAGTGCCTTTCCAAGAAACATGAGGCTCCCCGACCCATTCACTCCTAATCTAAAG
GTGGACATGTTGAGTGAAATTAACATTGCTCCCCGGATTCTCACCAATTTCACTGGAGTAATGCCACCTCAGTTCAAAAAGGATTTGGAT
TCCTATCTTAAAACTCGATCACCAGTCACTTTCCTGTCTGATCTGCGCAGCAACCTACAGGTATCCAATGAACCTGGGAATCGCTACAAC
CTCCAGCTCATCAATGCACTGGTGCTCTATGTCGGGACTCAGGCCATTGCGCACATCCACAACAAGGGCAGCACACCTTCAATGAGCACC
ATCACTCACTCAGCACACATGGATATCTTCCAGAATTTGGCTGTGGACTTGGACACTGAGGGTCGCTATCTCTTTTTGAATGCAATTGCA
AATCAGCTCCGGTACCCAAATAGCCACACTCACTACTTCAGTTGCACCATGCTGTACCTTTTTGCAGAGGCCAATACGGAAGCCATCCAA
GAACAGATCACAAGAGTTCTCTTGGAACGGTTGATTGTAAATAGGCCACATCCTTGGGGTCTTCTTATTACCTTCATTGAGCTGATTAAA
AACCCAGCGTTTAAGTTCTGGAACCATGAATTTGTACACTGTGCCCCAGAAATCGAAAAGTTATTCCAGTCGGTCGCACAGTGCTGCATG

>In-frame_C16orf87_ENST00000394806_chr16_46864996_-_CNOT1_ENST00000569240_chr16_58581200_-_3558nt
ATGTCTGCAACTCGAGCCAAGAAAGTGAAGATGGCCACCAAATCATGCCCCGAGTGCGACCAACAGGACTTGGATGTGAAATCATTGCTG
CTAGAGGCTTATGTTAAAGGACAACAAGAATTGCTCTATGTAGTGCCCTTTGTTGCCAAAGTCTTAGAATCTAGCATTCGTAGTGTGGTT
TTTAGGCCACCAAACCCTTGGACAATGGCAATTATGAATGTATTAGCTGAGCTACATCAGGAGCATGACTTAAAGTTAAACTTGAAGTTT
GAAATCGAGGTTCTCTGCAAGAACCTTGCATTAGACATCAATGAGCTAAAACCTGGAAACCTCCTAAAGGATAAAGATCGCCTGAAGAAT
TTAGATGAGCAACTCTCTGCTCCAAAGAAAGATGTCAAGCAGCCAGAAGAACTCCCTCCCATCACAACCACAACAACTTCTACTACACCA
GCTACCAACACCACTTGTACAGCCACGGTTCCACCACAGCCACAGTACAGCTACCACGACATCAATGTCTATTCCCTTGCGGGCTTGGCA
CCACACATTACTCTGAATCCAACAATTCCCTTGTTTCAGGCCCATCCACAGTTGAAGCAGTGTGTGCGTCAGGCAATTGAACGGGCTGTC
CAGGAGCTGGTCCATCCTGTGGTGGATCGATCAATTAAGATTGCCATGACTACTTGTGAGCAAATAGTCAGGAAGGATTTTGCCCTGGAT
TCGGAGGAATCTCGAATGCGAATAGCAGCTCATCACATGATGCGTAACTTGACAGCTGGAATGGCTATGATTACATGCAGGGAACCTTTG
CTCATGAGCATATCTACCAACTTAAAAAACAGTTTTGCCTCAGCCCTTCGTACTGCTTCCCCACAACAAAGAGAAATGATGGATCAGGCA
GCTGCTCAATTAGCTCAGGACAATTGTGAGTTGGCTTGCTGTTTTATTCAGAAGACTGCAGTAGAAAAAGCAGGCCCTGAGATGGACAAG
AGATTAGCAACTGAATTTGAGCTGAGAAAACATGCTAGGCAAGAAGGACGCAGATACTGTGATCCTGTTGTTTTAACATATCAAGCTGAA
CGGATGCCAGAGCAAATCAGGCTGAAAGTTGGTGGTGTGGACCCAAAGCAGTTGGCTGTTTACGAAGAGTTTGCACGCAATGTTCCTGGC
TTCTTACCTACAAATGACTTAAGTCAGCCCACGGGATTTTTAGCCCAGCCCATGAAGCAAGCTTGGGCAACAGATGATGTAGCTCAGATT
TATGATAAGTGTATTACAGAACTGGAGCAACATCTACATGCCATCCCACCAACTTTGGCCATGAACCCTCAAGCTCAGGCTCTTCGAAGT
CTCTTGGAGGTTGTAGTTTTATCTCGAAACTCTCGGGATGCCATAGCTGCTCTTGGATTGCTCCAAAAGGCTGTAGAGGGCTTACTAGAT
GCCACAAGTGGTGCTGATGCTGACCTTCTGCTGCGCTACAGGGAATGCCACCTCTTGGTCCTAAAAGCTCTGCAGGATGGCCGGGCATAT
GGGTCTCCATGGTGCAACAAACAGATCACAAGGTGCCTAATTGAATGTCGAGATGAATATAAATATAATGTGGAGGCTGTGGAGCTGCTA
ATTCGCAATCATTTGGTTAATATGCAGCAGTATGATCTTCACCTAGCGCAGTCAATGGAGAATGGCTTAAACTACATGGCTGTGGCATTT
GCTATGCAGTTAGTAAAAATCCTGCTGGTGGATGAAAGGAGTGTTGCTCATGTTACTGAGGCAGATCTGTTCCACACCATTGAAACCCTC
ATGAGGATTAATGCTCATTCCAGAGGCAATGCTCCAGAAGGATTGCCCCAGCTGATGGAAGTAGTGCGATCCAACTATGAAGCAATGATT
GATCGTGCTCATGGAGGCCCAAACTTTATGATGCATTCTGGGATCTCTCAAGCCTCAGAGTATGATGACCCTCCAGGCCTGAGGGAGAAG
GCAGAGTATCTTCTGAGGGAATGGGTGAATCTCTACCATTCAGCAGCAGCTGGCCGCGACAGTACCAAAGCTTTCTCTGCATTTGTTGGA
CAGATGCACCAGCAAGGAATACTGAAGACCGATGATCTCATAACAAGGTTCTTTCGTCTGTGTACTGAAATGTGTGTTGAAATCAGTTAC
CGTGCTCAGGCTGAGCAGCAGCACAATCCTGCTGCCAATCCCACCATGATCCGAGCCAAGTGCTATCACAACCTGGATGCCTTTGTTCGA
CTCATTGCACTGCTCGTGAAACACTCAGGGGAGGCCACCAACACTGTCACAAAGATTAATCTGCTGAACAAGGTCCTTGGTATAGTAGTG
GGAGTTCTCCTTCAGGATCATGATGTTCGTCAGAGTGAATTTCAGCAACTTCCCTACCATCGAATTTTTATCATGCTTCTCTTGGAACTC
AATGCACCTGAGCATGTGTTGGAAACCATTAATTTCCAGACACTTACAGCTTTCTGCAATACATTCCACATCTTGAGGCCTACCAAAGCT
CCTGGCTTTGTATATGCCTGGCTTGAACTGATTTCCCATCGGATATTTATTGCAAGAATGCTGGCACATACGCCACAGCAGAAGGGGTGG
CCTATGTATGCACAGCTACTGATTGATTTATTCAAATATTTAGCGCCTTTCCTTAGAAATGTGGAACTCACCAAACCTATGCAAATCCTC
TACAAGGGCACTTTAAGAGTGCTGCTGGTTCTTTTGCATGATTTCCCAGAGTTCCTTTGTGATTACCATTATGGGTTCTGTGATGTGATC
CCACCTAATTGTATCCAGTTAAGAAATTTGATCCTGAGTGCCTTTCCAAGAAACATGAGGCTCCCCGACCCATTCACTCCTAATCTAAAG
GTGGACATGTTGAGTGAAATTAACATTGCTCCCCGGATTCTCACCAATTTCACTGGAGTAATGCCACCTCAGTTCAAAAAGGATTTGGAT
TCCTATCTTAAAACTCGATCACCAGTCACTTTCCTGTCTGATCTGCGCAGCAACCTACAGGTATCCAATGAACCTGGGAATCGCTACAAC
CTCCAGCTCATCAATGCACTGGTGCTCTATGTCGGGACTCAGGCCATTGCGCACATCCACAACAAGGGCAGCACACCTTCAATGAGCACC
ATCACTCACTCAGCACACATGGATATCTTCCAGAATTTGGCTGTGGACTTGGACACTGAGGGTCGCTATCTCTTTTTGAATGCAATTGCA
AATCAGCTCCGGTACCCAAATAGCCACACTCACTACTTCAGTTGCACCATGCTGTACCTTTTTGCAGAGGCCAATACGGAAGCCATCCAA
GAACAGATCACAAGAGTTCTCTTGGAACGGTTGATTGTAAATAGGCCACATCCTTGGGGTCTTCTTATTACCTTCATTGAGCTGATTAAA
AACCCAGCGTTTAAGTTCTGGAACCATGAATTTGTACACTGTGCCCCAGAAATCGAAAAGTTATTCCAGTCGGTCGCACAGTGCTGCATG

>In-frame_C16orf87_ENST00000394806_chr16_46864996_-_CNOT1_ENST00000441024_chr16_58581200_-_1083nt
ATGTCTGCAACTCGAGCCAAGAAAGTGAAGATGGCCACCAAATCATGCCCCGAGTGCGACCAACAGGACTTGGATGTGAAATCATTGCTG
CTAGAGGCTTATGTTAAAGGACAACAAGAATTGCTCTATGTAGTGCCCTTTGTTGCCAAAGTCTTAGAATCTAGCATTCGTAGTGTGGTT
TTTAGGCCACCAAACCCTTGGACAATGGCAATTATGAATGTATTAGCTGAGCTACATCAGGAGCATGACTTAAAGTTAAACTTGAAGTTT
GAAATCGAGGTTCTCTGCAAGAACCTTGCATTAGACATCAATGAGCTAAAACCTGGAAACCTCCTAAAGGATAAAGATCGCCTGAAGAAT
TTAGATGAGCAACTCTCTGCTCCAAAGAAAGATGTCAAGCAGCCAGAAGAACTCCCTCCCATCACAACCACAACAACTTCTACTACACCA
GCTACCAACACCACTTGTACAGCCACGGTTCCACCACAGCCACAGTACAGCTACCACGACATCAATGTCTATTCCCTTGCGGGCTTGGCA
CCACACATTACTCTGAATCCAACAATTCCCTTGTTTCAGGCCCATCCACAGTTGAAGCAGTGTGTGCGTCAGGCAATTGAACGGGCTGTC
CAGGAGCTGGTCCATCCTGTGGTGGATCGATCAATTAAGATTGCCATGACTACTTGTGAGCAAATAGTCAGGAAGGATTTTGCCCTGGAT
TCGGAGGAATCTCGAATGCGAATAGCAGCTCATCACATGATGCGTAACTTGACAGCTGGAATGGCTATGATTACATGCAGGGAACCTTTG
CTCATGAGCATATCTACCAACTTAAAAAACAGTTTTGCCTCAGCCCTTCGTGTAAGTTGGCTATTTCCTTGGTATAGGTACAAAACGTAT
TACTGCTTGTCTGTAATAATTTTTTTCTTTGTCTATATATGGCACTGGGCGTTACCACTTATTCTTAATAATCACCATATTTGTTTGATG
TCTTCCATCATTTTAGATTGTAATTCTGTGAGGCAAAGCATCATGTCTGTGTGTTTTTTTTTTTTTCTGTTATATTCTCAACACGATGTT

>In-frame_C16orf87_ENST00000285697_chr16_46864996_-_CNOT1_ENST00000317147_chr16_58581200_-_3558nt
ATGTCTGCAACTCGAGCCAAGAAAGTGAAGATGGCCACCAAATCATGCCCCGAGTGCGACCAACAGGACTTGGATGTGAAATCATTGCTG
CTAGAGGCTTATGTTAAAGGACAACAAGAATTGCTCTATGTAGTGCCCTTTGTTGCCAAAGTCTTAGAATCTAGCATTCGTAGTGTGGTT
TTTAGGCCACCAAACCCTTGGACAATGGCAATTATGAATGTATTAGCTGAGCTACATCAGGAGCATGACTTAAAGTTAAACTTGAAGTTT
GAAATCGAGGTTCTCTGCAAGAACCTTGCATTAGACATCAATGAGCTAAAACCTGGAAACCTCCTAAAGGATAAAGATCGCCTGAAGAAT
TTAGATGAGCAACTCTCTGCTCCAAAGAAAGATGTCAAGCAGCCAGAAGAACTCCCTCCCATCACAACCACAACAACTTCTACTACACCA
GCTACCAACACCACTTGTACAGCCACGGTTCCACCACAGCCACAGTACAGCTACCACGACATCAATGTCTATTCCCTTGCGGGCTTGGCA
CCACACATTACTCTGAATCCAACAATTCCCTTGTTTCAGGCCCATCCACAGTTGAAGCAGTGTGTGCGTCAGGCAATTGAACGGGCTGTC
CAGGAGCTGGTCCATCCTGTGGTGGATCGATCAATTAAGATTGCCATGACTACTTGTGAGCAAATAGTCAGGAAGGATTTTGCCCTGGAT
TCGGAGGAATCTCGAATGCGAATAGCAGCTCATCACATGATGCGTAACTTGACAGCTGGAATGGCTATGATTACATGCAGGGAACCTTTG
CTCATGAGCATATCTACCAACTTAAAAAACAGTTTTGCCTCAGCCCTTCGTACTGCTTCCCCACAACAAAGAGAAATGATGGATCAGGCA
GCTGCTCAATTAGCTCAGGACAATTGTGAGTTGGCTTGCTGTTTTATTCAGAAGACTGCAGTAGAAAAAGCAGGCCCTGAGATGGACAAG
AGATTAGCAACTGAATTTGAGCTGAGAAAACATGCTAGGCAAGAAGGACGCAGATACTGTGATCCTGTTGTTTTAACATATCAAGCTGAA
CGGATGCCAGAGCAAATCAGGCTGAAAGTTGGTGGTGTGGACCCAAAGCAGTTGGCTGTTTACGAAGAGTTTGCACGCAATGTTCCTGGC
TTCTTACCTACAAATGACTTAAGTCAGCCCACGGGATTTTTAGCCCAGCCCATGAAGCAAGCTTGGGCAACAGATGATGTAGCTCAGATT
TATGATAAGTGTATTACAGAACTGGAGCAACATCTACATGCCATCCCACCAACTTTGGCCATGAACCCTCAAGCTCAGGCTCTTCGAAGT
CTCTTGGAGGTTGTAGTTTTATCTCGAAACTCTCGGGATGCCATAGCTGCTCTTGGATTGCTCCAAAAGGCTGTAGAGGGCTTACTAGAT
GCCACAAGTGGTGCTGATGCTGACCTTCTGCTGCGCTACAGGGAATGCCACCTCTTGGTCCTAAAAGCTCTGCAGGATGGCCGGGCATAT
GGGTCTCCATGGTGCAACAAACAGATCACAAGGTGCCTAATTGAATGTCGAGATGAATATAAATATAATGTGGAGGCTGTGGAGCTGCTA
ATTCGCAATCATTTGGTTAATATGCAGCAGTATGATCTTCACCTAGCGCAGTCAATGGAGAATGGCTTAAACTACATGGCTGTGGCATTT
GCTATGCAGTTAGTAAAAATCCTGCTGGTGGATGAAAGGAGTGTTGCTCATGTTACTGAGGCAGATCTGTTCCACACCATTGAAACCCTC
ATGAGGATTAATGCTCATTCCAGAGGCAATGCTCCAGAAGGATTGCCCCAGCTGATGGAAGTAGTGCGATCCAACTATGAAGCAATGATT
GATCGTGCTCATGGAGGCCCAAACTTTATGATGCATTCTGGGATCTCTCAAGCCTCAGAGTATGATGACCCTCCAGGCCTGAGGGAGAAG
GCAGAGTATCTTCTGAGGGAATGGGTGAATCTCTACCATTCAGCAGCAGCTGGCCGCGACAGTACCAAAGCTTTCTCTGCATTTGTTGGA
CAGATGCACCAGCAAGGAATACTGAAGACCGATGATCTCATAACAAGGTTCTTTCGTCTGTGTACTGAAATGTGTGTTGAAATCAGTTAC
CGTGCTCAGGCTGAGCAGCAGCACAATCCTGCTGCCAATCCCACCATGATCCGAGCCAAGTGCTATCACAACCTGGATGCCTTTGTTCGA
CTCATTGCACTGCTCGTGAAACACTCAGGGGAGGCCACCAACACTGTCACAAAGATTAATCTGCTGAACAAGGTCCTTGGTATAGTAGTG
GGAGTTCTCCTTCAGGATCATGATGTTCGTCAGAGTGAATTTCAGCAACTTCCCTACCATCGAATTTTTATCATGCTTCTCTTGGAACTC
AATGCACCTGAGCATGTGTTGGAAACCATTAATTTCCAGACACTTACAGCTTTCTGCAATACATTCCACATCTTGAGGCCTACCAAAGCT
CCTGGCTTTGTATATGCCTGGCTTGAACTGATTTCCCATCGGATATTTATTGCAAGAATGCTGGCACATACGCCACAGCAGAAGGGGTGG
CCTATGTATGCACAGCTACTGATTGATTTATTCAAATATTTAGCGCCTTTCCTTAGAAATGTGGAACTCACCAAACCTATGCAAATCCTC
TACAAGGGCACTTTAAGAGTGCTGCTGGTTCTTTTGCATGATTTCCCAGAGTTCCTTTGTGATTACCATTATGGGTTCTGTGATGTGATC
CCACCTAATTGTATCCAGTTAAGAAATTTGATCCTGAGTGCCTTTCCAAGAAACATGAGGCTCCCCGACCCATTCACTCCTAATCTAAAG
GTGGACATGTTGAGTGAAATTAACATTGCTCCCCGGATTCTCACCAATTTCACTGGAGTAATGCCACCTCAGTTCAAAAAGGATTTGGAT
TCCTATCTTAAAACTCGATCACCAGTCACTTTCCTGTCTGATCTGCGCAGCAACCTACAGGTATCCAATGAACCTGGGAATCGCTACAAC
CTCCAGCTCATCAATGCACTGGTGCTCTATGTCGGGACTCAGGCCATTGCGCACATCCACAACAAGGGCAGCACACCTTCAATGAGCACC
ATCACTCACTCAGCACACATGGATATCTTCCAGAATTTGGCTGTGGACTTGGACACTGAGGGTCGCTATCTCTTTTTGAATGCAATTGCA
AATCAGCTCCGGTACCCAAATAGCCACACTCACTACTTCAGTTGCACCATGCTGTACCTTTTTGCAGAGGCCAATACGGAAGCCATCCAA
GAACAGATCACAAGAGTTCTCTTGGAACGGTTGATTGTAAATAGGCCACATCCTTGGGGTCTTCTTATTACCTTCATTGAGCTGATTAAA
AACCCAGCGTTTAAGTTCTGGAACCATGAATTTGTACACTGTGCCCCAGAAATCGAAAAGTTATTCCAGTCGGTCGCACAGTGCTGCATG

>In-frame_C16orf87_ENST00000285697_chr16_46864996_-_CNOT1_ENST00000569240_chr16_58581200_-_3558nt
ATGTCTGCAACTCGAGCCAAGAAAGTGAAGATGGCCACCAAATCATGCCCCGAGTGCGACCAACAGGACTTGGATGTGAAATCATTGCTG
CTAGAGGCTTATGTTAAAGGACAACAAGAATTGCTCTATGTAGTGCCCTTTGTTGCCAAAGTCTTAGAATCTAGCATTCGTAGTGTGGTT
TTTAGGCCACCAAACCCTTGGACAATGGCAATTATGAATGTATTAGCTGAGCTACATCAGGAGCATGACTTAAAGTTAAACTTGAAGTTT
GAAATCGAGGTTCTCTGCAAGAACCTTGCATTAGACATCAATGAGCTAAAACCTGGAAACCTCCTAAAGGATAAAGATCGCCTGAAGAAT
TTAGATGAGCAACTCTCTGCTCCAAAGAAAGATGTCAAGCAGCCAGAAGAACTCCCTCCCATCACAACCACAACAACTTCTACTACACCA
GCTACCAACACCACTTGTACAGCCACGGTTCCACCACAGCCACAGTACAGCTACCACGACATCAATGTCTATTCCCTTGCGGGCTTGGCA
CCACACATTACTCTGAATCCAACAATTCCCTTGTTTCAGGCCCATCCACAGTTGAAGCAGTGTGTGCGTCAGGCAATTGAACGGGCTGTC
CAGGAGCTGGTCCATCCTGTGGTGGATCGATCAATTAAGATTGCCATGACTACTTGTGAGCAAATAGTCAGGAAGGATTTTGCCCTGGAT
TCGGAGGAATCTCGAATGCGAATAGCAGCTCATCACATGATGCGTAACTTGACAGCTGGAATGGCTATGATTACATGCAGGGAACCTTTG
CTCATGAGCATATCTACCAACTTAAAAAACAGTTTTGCCTCAGCCCTTCGTACTGCTTCCCCACAACAAAGAGAAATGATGGATCAGGCA
GCTGCTCAATTAGCTCAGGACAATTGTGAGTTGGCTTGCTGTTTTATTCAGAAGACTGCAGTAGAAAAAGCAGGCCCTGAGATGGACAAG
AGATTAGCAACTGAATTTGAGCTGAGAAAACATGCTAGGCAAGAAGGACGCAGATACTGTGATCCTGTTGTTTTAACATATCAAGCTGAA
CGGATGCCAGAGCAAATCAGGCTGAAAGTTGGTGGTGTGGACCCAAAGCAGTTGGCTGTTTACGAAGAGTTTGCACGCAATGTTCCTGGC
TTCTTACCTACAAATGACTTAAGTCAGCCCACGGGATTTTTAGCCCAGCCCATGAAGCAAGCTTGGGCAACAGATGATGTAGCTCAGATT
TATGATAAGTGTATTACAGAACTGGAGCAACATCTACATGCCATCCCACCAACTTTGGCCATGAACCCTCAAGCTCAGGCTCTTCGAAGT
CTCTTGGAGGTTGTAGTTTTATCTCGAAACTCTCGGGATGCCATAGCTGCTCTTGGATTGCTCCAAAAGGCTGTAGAGGGCTTACTAGAT
GCCACAAGTGGTGCTGATGCTGACCTTCTGCTGCGCTACAGGGAATGCCACCTCTTGGTCCTAAAAGCTCTGCAGGATGGCCGGGCATAT
GGGTCTCCATGGTGCAACAAACAGATCACAAGGTGCCTAATTGAATGTCGAGATGAATATAAATATAATGTGGAGGCTGTGGAGCTGCTA
ATTCGCAATCATTTGGTTAATATGCAGCAGTATGATCTTCACCTAGCGCAGTCAATGGAGAATGGCTTAAACTACATGGCTGTGGCATTT
GCTATGCAGTTAGTAAAAATCCTGCTGGTGGATGAAAGGAGTGTTGCTCATGTTACTGAGGCAGATCTGTTCCACACCATTGAAACCCTC
ATGAGGATTAATGCTCATTCCAGAGGCAATGCTCCAGAAGGATTGCCCCAGCTGATGGAAGTAGTGCGATCCAACTATGAAGCAATGATT
GATCGTGCTCATGGAGGCCCAAACTTTATGATGCATTCTGGGATCTCTCAAGCCTCAGAGTATGATGACCCTCCAGGCCTGAGGGAGAAG
GCAGAGTATCTTCTGAGGGAATGGGTGAATCTCTACCATTCAGCAGCAGCTGGCCGCGACAGTACCAAAGCTTTCTCTGCATTTGTTGGA
CAGATGCACCAGCAAGGAATACTGAAGACCGATGATCTCATAACAAGGTTCTTTCGTCTGTGTACTGAAATGTGTGTTGAAATCAGTTAC
CGTGCTCAGGCTGAGCAGCAGCACAATCCTGCTGCCAATCCCACCATGATCCGAGCCAAGTGCTATCACAACCTGGATGCCTTTGTTCGA
CTCATTGCACTGCTCGTGAAACACTCAGGGGAGGCCACCAACACTGTCACAAAGATTAATCTGCTGAACAAGGTCCTTGGTATAGTAGTG
GGAGTTCTCCTTCAGGATCATGATGTTCGTCAGAGTGAATTTCAGCAACTTCCCTACCATCGAATTTTTATCATGCTTCTCTTGGAACTC
AATGCACCTGAGCATGTGTTGGAAACCATTAATTTCCAGACACTTACAGCTTTCTGCAATACATTCCACATCTTGAGGCCTACCAAAGCT
CCTGGCTTTGTATATGCCTGGCTTGAACTGATTTCCCATCGGATATTTATTGCAAGAATGCTGGCACATACGCCACAGCAGAAGGGGTGG
CCTATGTATGCACAGCTACTGATTGATTTATTCAAATATTTAGCGCCTTTCCTTAGAAATGTGGAACTCACCAAACCTATGCAAATCCTC
TACAAGGGCACTTTAAGAGTGCTGCTGGTTCTTTTGCATGATTTCCCAGAGTTCCTTTGTGATTACCATTATGGGTTCTGTGATGTGATC
CCACCTAATTGTATCCAGTTAAGAAATTTGATCCTGAGTGCCTTTCCAAGAAACATGAGGCTCCCCGACCCATTCACTCCTAATCTAAAG
GTGGACATGTTGAGTGAAATTAACATTGCTCCCCGGATTCTCACCAATTTCACTGGAGTAATGCCACCTCAGTTCAAAAAGGATTTGGAT
TCCTATCTTAAAACTCGATCACCAGTCACTTTCCTGTCTGATCTGCGCAGCAACCTACAGGTATCCAATGAACCTGGGAATCGCTACAAC
CTCCAGCTCATCAATGCACTGGTGCTCTATGTCGGGACTCAGGCCATTGCGCACATCCACAACAAGGGCAGCACACCTTCAATGAGCACC
ATCACTCACTCAGCACACATGGATATCTTCCAGAATTTGGCTGTGGACTTGGACACTGAGGGTCGCTATCTCTTTTTGAATGCAATTGCA
AATCAGCTCCGGTACCCAAATAGCCACACTCACTACTTCAGTTGCACCATGCTGTACCTTTTTGCAGAGGCCAATACGGAAGCCATCCAA
GAACAGATCACAAGAGTTCTCTTGGAACGGTTGATTGTAAATAGGCCACATCCTTGGGGTCTTCTTATTACCTTCATTGAGCTGATTAAA
AACCCAGCGTTTAAGTTCTGGAACCATGAATTTGTACACTGTGCCCCAGAAATCGAAAAGTTATTCCAGTCGGTCGCACAGTGCTGCATG

>In-frame_C16orf87_ENST00000285697_chr16_46864996_-_CNOT1_ENST00000441024_chr16_58581200_-_1083nt
ATGTCTGCAACTCGAGCCAAGAAAGTGAAGATGGCCACCAAATCATGCCCCGAGTGCGACCAACAGGACTTGGATGTGAAATCATTGCTG
CTAGAGGCTTATGTTAAAGGACAACAAGAATTGCTCTATGTAGTGCCCTTTGTTGCCAAAGTCTTAGAATCTAGCATTCGTAGTGTGGTT
TTTAGGCCACCAAACCCTTGGACAATGGCAATTATGAATGTATTAGCTGAGCTACATCAGGAGCATGACTTAAAGTTAAACTTGAAGTTT
GAAATCGAGGTTCTCTGCAAGAACCTTGCATTAGACATCAATGAGCTAAAACCTGGAAACCTCCTAAAGGATAAAGATCGCCTGAAGAAT
TTAGATGAGCAACTCTCTGCTCCAAAGAAAGATGTCAAGCAGCCAGAAGAACTCCCTCCCATCACAACCACAACAACTTCTACTACACCA
GCTACCAACACCACTTGTACAGCCACGGTTCCACCACAGCCACAGTACAGCTACCACGACATCAATGTCTATTCCCTTGCGGGCTTGGCA
CCACACATTACTCTGAATCCAACAATTCCCTTGTTTCAGGCCCATCCACAGTTGAAGCAGTGTGTGCGTCAGGCAATTGAACGGGCTGTC
CAGGAGCTGGTCCATCCTGTGGTGGATCGATCAATTAAGATTGCCATGACTACTTGTGAGCAAATAGTCAGGAAGGATTTTGCCCTGGAT
TCGGAGGAATCTCGAATGCGAATAGCAGCTCATCACATGATGCGTAACTTGACAGCTGGAATGGCTATGATTACATGCAGGGAACCTTTG
CTCATGAGCATATCTACCAACTTAAAAAACAGTTTTGCCTCAGCCCTTCGTGTAAGTTGGCTATTTCCTTGGTATAGGTACAAAACGTAT
TACTGCTTGTCTGTAATAATTTTTTTCTTTGTCTATATATGGCACTGGGCGTTACCACTTATTCTTAATAATCACCATATTTGTTTGATG
TCTTCCATCATTTTAGATTGTAATTCTGTGAGGCAAAGCATCATGTCTGTGTGTTTTTTTTTTTTTCTGTTATATTCTCAACACGATGTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_C16orf87_ENST00000394806_chr16_46864996_-_CNOT1_ENST00000317147_chr16_58581200_-_4578nt
AAGGGAGAGGAGCATGTCTGCAACTCGAGCCAAGAAAGTGAAGATGGCCACCAAATCATGCCCCGAGTGCGACCAACAGGACTTGGATGT
GAAATCATTGCTGCTAGAGGCTTATGTTAAAGGACAACAAGAATTGCTCTATGTAGTGCCCTTTGTTGCCAAAGTCTTAGAATCTAGCAT
TCGTAGTGTGGTTTTTAGGCCACCAAACCCTTGGACAATGGCAATTATGAATGTATTAGCTGAGCTACATCAGGAGCATGACTTAAAGTT
AAACTTGAAGTTTGAAATCGAGGTTCTCTGCAAGAACCTTGCATTAGACATCAATGAGCTAAAACCTGGAAACCTCCTAAAGGATAAAGA
TCGCCTGAAGAATTTAGATGAGCAACTCTCTGCTCCAAAGAAAGATGTCAAGCAGCCAGAAGAACTCCCTCCCATCACAACCACAACAAC
TTCTACTACACCAGCTACCAACACCACTTGTACAGCCACGGTTCCACCACAGCCACAGTACAGCTACCACGACATCAATGTCTATTCCCT
TGCGGGCTTGGCACCACACATTACTCTGAATCCAACAATTCCCTTGTTTCAGGCCCATCCACAGTTGAAGCAGTGTGTGCGTCAGGCAAT
TGAACGGGCTGTCCAGGAGCTGGTCCATCCTGTGGTGGATCGATCAATTAAGATTGCCATGACTACTTGTGAGCAAATAGTCAGGAAGGA
TTTTGCCCTGGATTCGGAGGAATCTCGAATGCGAATAGCAGCTCATCACATGATGCGTAACTTGACAGCTGGAATGGCTATGATTACATG
CAGGGAACCTTTGCTCATGAGCATATCTACCAACTTAAAAAACAGTTTTGCCTCAGCCCTTCGTACTGCTTCCCCACAACAAAGAGAAAT
GATGGATCAGGCAGCTGCTCAATTAGCTCAGGACAATTGTGAGTTGGCTTGCTGTTTTATTCAGAAGACTGCAGTAGAAAAAGCAGGCCC
TGAGATGGACAAGAGATTAGCAACTGAATTTGAGCTGAGAAAACATGCTAGGCAAGAAGGACGCAGATACTGTGATCCTGTTGTTTTAAC
ATATCAAGCTGAACGGATGCCAGAGCAAATCAGGCTGAAAGTTGGTGGTGTGGACCCAAAGCAGTTGGCTGTTTACGAAGAGTTTGCACG
CAATGTTCCTGGCTTCTTACCTACAAATGACTTAAGTCAGCCCACGGGATTTTTAGCCCAGCCCATGAAGCAAGCTTGGGCAACAGATGA
TGTAGCTCAGATTTATGATAAGTGTATTACAGAACTGGAGCAACATCTACATGCCATCCCACCAACTTTGGCCATGAACCCTCAAGCTCA
GGCTCTTCGAAGTCTCTTGGAGGTTGTAGTTTTATCTCGAAACTCTCGGGATGCCATAGCTGCTCTTGGATTGCTCCAAAAGGCTGTAGA
GGGCTTACTAGATGCCACAAGTGGTGCTGATGCTGACCTTCTGCTGCGCTACAGGGAATGCCACCTCTTGGTCCTAAAAGCTCTGCAGGA
TGGCCGGGCATATGGGTCTCCATGGTGCAACAAACAGATCACAAGGTGCCTAATTGAATGTCGAGATGAATATAAATATAATGTGGAGGC
TGTGGAGCTGCTAATTCGCAATCATTTGGTTAATATGCAGCAGTATGATCTTCACCTAGCGCAGTCAATGGAGAATGGCTTAAACTACAT
GGCTGTGGCATTTGCTATGCAGTTAGTAAAAATCCTGCTGGTGGATGAAAGGAGTGTTGCTCATGTTACTGAGGCAGATCTGTTCCACAC
CATTGAAACCCTCATGAGGATTAATGCTCATTCCAGAGGCAATGCTCCAGAAGGATTGCCCCAGCTGATGGAAGTAGTGCGATCCAACTA
TGAAGCAATGATTGATCGTGCTCATGGAGGCCCAAACTTTATGATGCATTCTGGGATCTCTCAAGCCTCAGAGTATGATGACCCTCCAGG
CCTGAGGGAGAAGGCAGAGTATCTTCTGAGGGAATGGGTGAATCTCTACCATTCAGCAGCAGCTGGCCGCGACAGTACCAAAGCTTTCTC
TGCATTTGTTGGACAGATGCACCAGCAAGGAATACTGAAGACCGATGATCTCATAACAAGGTTCTTTCGTCTGTGTACTGAAATGTGTGT
TGAAATCAGTTACCGTGCTCAGGCTGAGCAGCAGCACAATCCTGCTGCCAATCCCACCATGATCCGAGCCAAGTGCTATCACAACCTGGA
TGCCTTTGTTCGACTCATTGCACTGCTCGTGAAACACTCAGGGGAGGCCACCAACACTGTCACAAAGATTAATCTGCTGAACAAGGTCCT
TGGTATAGTAGTGGGAGTTCTCCTTCAGGATCATGATGTTCGTCAGAGTGAATTTCAGCAACTTCCCTACCATCGAATTTTTATCATGCT
TCTCTTGGAACTCAATGCACCTGAGCATGTGTTGGAAACCATTAATTTCCAGACACTTACAGCTTTCTGCAATACATTCCACATCTTGAG
GCCTACCAAAGCTCCTGGCTTTGTATATGCCTGGCTTGAACTGATTTCCCATCGGATATTTATTGCAAGAATGCTGGCACATACGCCACA
GCAGAAGGGGTGGCCTATGTATGCACAGCTACTGATTGATTTATTCAAATATTTAGCGCCTTTCCTTAGAAATGTGGAACTCACCAAACC
TATGCAAATCCTCTACAAGGGCACTTTAAGAGTGCTGCTGGTTCTTTTGCATGATTTCCCAGAGTTCCTTTGTGATTACCATTATGGGTT
CTGTGATGTGATCCCACCTAATTGTATCCAGTTAAGAAATTTGATCCTGAGTGCCTTTCCAAGAAACATGAGGCTCCCCGACCCATTCAC
TCCTAATCTAAAGGTGGACATGTTGAGTGAAATTAACATTGCTCCCCGGATTCTCACCAATTTCACTGGAGTAATGCCACCTCAGTTCAA
AAAGGATTTGGATTCCTATCTTAAAACTCGATCACCAGTCACTTTCCTGTCTGATCTGCGCAGCAACCTACAGGTATCCAATGAACCTGG
GAATCGCTACAACCTCCAGCTCATCAATGCACTGGTGCTCTATGTCGGGACTCAGGCCATTGCGCACATCCACAACAAGGGCAGCACACC
TTCAATGAGCACCATCACTCACTCAGCACACATGGATATCTTCCAGAATTTGGCTGTGGACTTGGACACTGAGGGTCGCTATCTCTTTTT
GAATGCAATTGCAAATCAGCTCCGGTACCCAAATAGCCACACTCACTACTTCAGTTGCACCATGCTGTACCTTTTTGCAGAGGCCAATAC
GGAAGCCATCCAAGAACAGATCACAAGAGTTCTCTTGGAACGGTTGATTGTAAATAGGCCACATCCTTGGGGTCTTCTTATTACCTTCAT
TGAGCTGATTAAAAACCCAGCGTTTAAGTTCTGGAACCATGAATTTGTACACTGTGCCCCAGAAATCGAAAAGTTATTCCAGTCGGTCGC
ACAGTGCTGCATGGGACAGAAGCAGGCCCAGCAAGTAATGGAAGGGACAGGTGCCAGTTAGACGAAACTGCATCTCTGTTGTACGTGTCA
GTCTAGAGGTCTCACTGCACCGAGTTCATAAACTGACTGAAGAATCCTTTCAGCTCTTCCTGACTTTCCCAGCCCTTTGGTTTGTGGGTA
TCTGCCCCAACTACTGTTGGGATCAGCCTCCTGTCTTATGTGGGCACGTTCCAAAGTTTAAATGCATTTTTTTGACTCTTGGCCAAAATT
TAGAAGATGCTGTGAATATCATTTTGAACTTGTGTAAATACATGAAAGAGAAAACCTTTGTCTGGAACTTCTTGGCTTTGTGCAAGCTGT
GTCCAAGGCAAGTACATAAACTGGTACCTTGTAATGAAGAGGCAGCTGATGCCATGCACTTGTCTGAGGGCATAGCTCCATGTCTTCTGA
CATTCCTGGTGTCCCAAAGAATAGCAAAAAGCCAGTTTGAATATTATGTAACTTATTTTTTTAATGTGGACAGGGGACCTTGAAAATCAC
TAAGTTATTAAAAATGTGGATGTGCTAGAATTGGATATGTCCAGGAACATGGGAAGGGCTCACTATTGGAATCCCATGAGTTTCCATTTT
GTCTCTACCCAAACGTATTCCAAAGCTGACTGCATTTGTACCATCTTATTTCTTTTGGGGATTATACACCTCAGCCGCCTGAGATGGGGG
TCAGCTCTTTATATAAAGGGAAACCAGACCAGGCCTAAAGCCCACCCCTACCCTCACCCCCCCAATCCTCTCCTGAAACTTAAAAACAGT
GGGAATATAGGAAAGGGAACCAAATCTCATTAATTAATTGTTCTCCCCCATTACCCCACTGAATGAATGGCCATACAGGCTAAGCTGAAT
AATGACAAAGTTGAAAGGACCAATACAGCCCCTTTTATAAGGATTTTGAATGTTTTGCAAATGTATTGGTCCCTGTGTTGTATTTTGTAG

>In-frame_C16orf87_ENST00000394806_chr16_46864996_-_CNOT1_ENST00000569240_chr16_58581200_-_3834nt
AAGGGAGAGGAGCATGTCTGCAACTCGAGCCAAGAAAGTGAAGATGGCCACCAAATCATGCCCCGAGTGCGACCAACAGGACTTGGATGT
GAAATCATTGCTGCTAGAGGCTTATGTTAAAGGACAACAAGAATTGCTCTATGTAGTGCCCTTTGTTGCCAAAGTCTTAGAATCTAGCAT
TCGTAGTGTGGTTTTTAGGCCACCAAACCCTTGGACAATGGCAATTATGAATGTATTAGCTGAGCTACATCAGGAGCATGACTTAAAGTT
AAACTTGAAGTTTGAAATCGAGGTTCTCTGCAAGAACCTTGCATTAGACATCAATGAGCTAAAACCTGGAAACCTCCTAAAGGATAAAGA
TCGCCTGAAGAATTTAGATGAGCAACTCTCTGCTCCAAAGAAAGATGTCAAGCAGCCAGAAGAACTCCCTCCCATCACAACCACAACAAC
TTCTACTACACCAGCTACCAACACCACTTGTACAGCCACGGTTCCACCACAGCCACAGTACAGCTACCACGACATCAATGTCTATTCCCT
TGCGGGCTTGGCACCACACATTACTCTGAATCCAACAATTCCCTTGTTTCAGGCCCATCCACAGTTGAAGCAGTGTGTGCGTCAGGCAAT
TGAACGGGCTGTCCAGGAGCTGGTCCATCCTGTGGTGGATCGATCAATTAAGATTGCCATGACTACTTGTGAGCAAATAGTCAGGAAGGA
TTTTGCCCTGGATTCGGAGGAATCTCGAATGCGAATAGCAGCTCATCACATGATGCGTAACTTGACAGCTGGAATGGCTATGATTACATG
CAGGGAACCTTTGCTCATGAGCATATCTACCAACTTAAAAAACAGTTTTGCCTCAGCCCTTCGTACTGCTTCCCCACAACAAAGAGAAAT
GATGGATCAGGCAGCTGCTCAATTAGCTCAGGACAATTGTGAGTTGGCTTGCTGTTTTATTCAGAAGACTGCAGTAGAAAAAGCAGGCCC
TGAGATGGACAAGAGATTAGCAACTGAATTTGAGCTGAGAAAACATGCTAGGCAAGAAGGACGCAGATACTGTGATCCTGTTGTTTTAAC
ATATCAAGCTGAACGGATGCCAGAGCAAATCAGGCTGAAAGTTGGTGGTGTGGACCCAAAGCAGTTGGCTGTTTACGAAGAGTTTGCACG
CAATGTTCCTGGCTTCTTACCTACAAATGACTTAAGTCAGCCCACGGGATTTTTAGCCCAGCCCATGAAGCAAGCTTGGGCAACAGATGA
TGTAGCTCAGATTTATGATAAGTGTATTACAGAACTGGAGCAACATCTACATGCCATCCCACCAACTTTGGCCATGAACCCTCAAGCTCA
GGCTCTTCGAAGTCTCTTGGAGGTTGTAGTTTTATCTCGAAACTCTCGGGATGCCATAGCTGCTCTTGGATTGCTCCAAAAGGCTGTAGA
GGGCTTACTAGATGCCACAAGTGGTGCTGATGCTGACCTTCTGCTGCGCTACAGGGAATGCCACCTCTTGGTCCTAAAAGCTCTGCAGGA
TGGCCGGGCATATGGGTCTCCATGGTGCAACAAACAGATCACAAGGTGCCTAATTGAATGTCGAGATGAATATAAATATAATGTGGAGGC
TGTGGAGCTGCTAATTCGCAATCATTTGGTTAATATGCAGCAGTATGATCTTCACCTAGCGCAGTCAATGGAGAATGGCTTAAACTACAT
GGCTGTGGCATTTGCTATGCAGTTAGTAAAAATCCTGCTGGTGGATGAAAGGAGTGTTGCTCATGTTACTGAGGCAGATCTGTTCCACAC
CATTGAAACCCTCATGAGGATTAATGCTCATTCCAGAGGCAATGCTCCAGAAGGATTGCCCCAGCTGATGGAAGTAGTGCGATCCAACTA
TGAAGCAATGATTGATCGTGCTCATGGAGGCCCAAACTTTATGATGCATTCTGGGATCTCTCAAGCCTCAGAGTATGATGACCCTCCAGG
CCTGAGGGAGAAGGCAGAGTATCTTCTGAGGGAATGGGTGAATCTCTACCATTCAGCAGCAGCTGGCCGCGACAGTACCAAAGCTTTCTC
TGCATTTGTTGGACAGATGCACCAGCAAGGAATACTGAAGACCGATGATCTCATAACAAGGTTCTTTCGTCTGTGTACTGAAATGTGTGT
TGAAATCAGTTACCGTGCTCAGGCTGAGCAGCAGCACAATCCTGCTGCCAATCCCACCATGATCCGAGCCAAGTGCTATCACAACCTGGA
TGCCTTTGTTCGACTCATTGCACTGCTCGTGAAACACTCAGGGGAGGCCACCAACACTGTCACAAAGATTAATCTGCTGAACAAGGTCCT
TGGTATAGTAGTGGGAGTTCTCCTTCAGGATCATGATGTTCGTCAGAGTGAATTTCAGCAACTTCCCTACCATCGAATTTTTATCATGCT
TCTCTTGGAACTCAATGCACCTGAGCATGTGTTGGAAACCATTAATTTCCAGACACTTACAGCTTTCTGCAATACATTCCACATCTTGAG
GCCTACCAAAGCTCCTGGCTTTGTATATGCCTGGCTTGAACTGATTTCCCATCGGATATTTATTGCAAGAATGCTGGCACATACGCCACA
GCAGAAGGGGTGGCCTATGTATGCACAGCTACTGATTGATTTATTCAAATATTTAGCGCCTTTCCTTAGAAATGTGGAACTCACCAAACC
TATGCAAATCCTCTACAAGGGCACTTTAAGAGTGCTGCTGGTTCTTTTGCATGATTTCCCAGAGTTCCTTTGTGATTACCATTATGGGTT
CTGTGATGTGATCCCACCTAATTGTATCCAGTTAAGAAATTTGATCCTGAGTGCCTTTCCAAGAAACATGAGGCTCCCCGACCCATTCAC
TCCTAATCTAAAGGTGGACATGTTGAGTGAAATTAACATTGCTCCCCGGATTCTCACCAATTTCACTGGAGTAATGCCACCTCAGTTCAA
AAAGGATTTGGATTCCTATCTTAAAACTCGATCACCAGTCACTTTCCTGTCTGATCTGCGCAGCAACCTACAGGTATCCAATGAACCTGG
GAATCGCTACAACCTCCAGCTCATCAATGCACTGGTGCTCTATGTCGGGACTCAGGCCATTGCGCACATCCACAACAAGGGCAGCACACC
TTCAATGAGCACCATCACTCACTCAGCACACATGGATATCTTCCAGAATTTGGCTGTGGACTTGGACACTGAGGGTCGCTATCTCTTTTT
GAATGCAATTGCAAATCAGCTCCGGTACCCAAATAGCCACACTCACTACTTCAGTTGCACCATGCTGTACCTTTTTGCAGAGGCCAATAC
GGAAGCCATCCAAGAACAGATCACAAGAGTTCTCTTGGAACGGTTGATTGTAAATAGGCCACATCCTTGGGGTCTTCTTATTACCTTCAT
TGAGCTGATTAAAAACCCAGCGTTTAAGTTCTGGAACCATGAATTTGTACACTGTGCCCCAGAAATCGAAAAGTTATTCCAGTCGGTCGC
ACAGTGCTGCATGGGACAGAAGCAGGCCCAGCAAGTAATGGAAGGGACAGGTGCCAGTTAGACGAAACTGCATCTCTGTTGTACGTGTCA
GTCTAGAGGTCTCACTGCACCGAGTTCATAAACTGACTGAAGAATCCTTTCAGCTCTTCCTGACTTTCCCAGCCCTTTGGTTTGTGGGTA
TCTGCCCCAACTACTGTTGGGATCAGCCTCCTGTCTTATGTGGGCACGTTCCAAAGTTTAAATGCATTTTTTTGACTCTTGGCCAAAATT

>In-frame_C16orf87_ENST00000394806_chr16_46864996_-_CNOT1_ENST00000441024_chr16_58581200_-_1154nt
AAGGGAGAGGAGCATGTCTGCAACTCGAGCCAAGAAAGTGAAGATGGCCACCAAATCATGCCCCGAGTGCGACCAACAGGACTTGGATGT
GAAATCATTGCTGCTAGAGGCTTATGTTAAAGGACAACAAGAATTGCTCTATGTAGTGCCCTTTGTTGCCAAAGTCTTAGAATCTAGCAT
TCGTAGTGTGGTTTTTAGGCCACCAAACCCTTGGACAATGGCAATTATGAATGTATTAGCTGAGCTACATCAGGAGCATGACTTAAAGTT
AAACTTGAAGTTTGAAATCGAGGTTCTCTGCAAGAACCTTGCATTAGACATCAATGAGCTAAAACCTGGAAACCTCCTAAAGGATAAAGA
TCGCCTGAAGAATTTAGATGAGCAACTCTCTGCTCCAAAGAAAGATGTCAAGCAGCCAGAAGAACTCCCTCCCATCACAACCACAACAAC
TTCTACTACACCAGCTACCAACACCACTTGTACAGCCACGGTTCCACCACAGCCACAGTACAGCTACCACGACATCAATGTCTATTCCCT
TGCGGGCTTGGCACCACACATTACTCTGAATCCAACAATTCCCTTGTTTCAGGCCCATCCACAGTTGAAGCAGTGTGTGCGTCAGGCAAT
TGAACGGGCTGTCCAGGAGCTGGTCCATCCTGTGGTGGATCGATCAATTAAGATTGCCATGACTACTTGTGAGCAAATAGTCAGGAAGGA
TTTTGCCCTGGATTCGGAGGAATCTCGAATGCGAATAGCAGCTCATCACATGATGCGTAACTTGACAGCTGGAATGGCTATGATTACATG
CAGGGAACCTTTGCTCATGAGCATATCTACCAACTTAAAAAACAGTTTTGCCTCAGCCCTTCGTGTAAGTTGGCTATTTCCTTGGTATAG
GTACAAAACGTATTACTGCTTGTCTGTAATAATTTTTTTCTTTGTCTATATATGGCACTGGGCGTTACCACTTATTCTTAATAATCACCA
TATTTGTTTGATGTCTTCCATCATTTTAGATTGTAATTCTGTGAGGCAAAGCATCATGTCTGTGTGTTTTTTTTTTTTTCTGTTATATTC

>In-frame_C16orf87_ENST00000285697_chr16_46864996_-_CNOT1_ENST00000317147_chr16_58581200_-_4827nt
GATACTCTGGGCGAGCTCGCGGGCGGGCTGTGGGTCGCGAGCCGCCGTGGGAGCGCGTGTCGCGGTCCCCAGGAGCCGCCGGCCGACGCT
CCGCCCCGCCCCCTTGGCGCCCAGGTCCCGCGCGAGCTCGCGCACGCGCGCGCGCGCACCCGCCAGAGGCTTGTTTGAGGCCCGCGGGGA
CTGGGCGGGCGGAGGCCGGGCTGCCGAAGTGTGAGGGGAGGAGCCCGAGCCGTCGCTGCTGCCGCCGCTAAGGGAGAGGAGCATGTCTGC
AACTCGAGCCAAGAAAGTGAAGATGGCCACCAAATCATGCCCCGAGTGCGACCAACAGGACTTGGATGTGAAATCATTGCTGCTAGAGGC
TTATGTTAAAGGACAACAAGAATTGCTCTATGTAGTGCCCTTTGTTGCCAAAGTCTTAGAATCTAGCATTCGTAGTGTGGTTTTTAGGCC
ACCAAACCCTTGGACAATGGCAATTATGAATGTATTAGCTGAGCTACATCAGGAGCATGACTTAAAGTTAAACTTGAAGTTTGAAATCGA
GGTTCTCTGCAAGAACCTTGCATTAGACATCAATGAGCTAAAACCTGGAAACCTCCTAAAGGATAAAGATCGCCTGAAGAATTTAGATGA
GCAACTCTCTGCTCCAAAGAAAGATGTCAAGCAGCCAGAAGAACTCCCTCCCATCACAACCACAACAACTTCTACTACACCAGCTACCAA
CACCACTTGTACAGCCACGGTTCCACCACAGCCACAGTACAGCTACCACGACATCAATGTCTATTCCCTTGCGGGCTTGGCACCACACAT
TACTCTGAATCCAACAATTCCCTTGTTTCAGGCCCATCCACAGTTGAAGCAGTGTGTGCGTCAGGCAATTGAACGGGCTGTCCAGGAGCT
GGTCCATCCTGTGGTGGATCGATCAATTAAGATTGCCATGACTACTTGTGAGCAAATAGTCAGGAAGGATTTTGCCCTGGATTCGGAGGA
ATCTCGAATGCGAATAGCAGCTCATCACATGATGCGTAACTTGACAGCTGGAATGGCTATGATTACATGCAGGGAACCTTTGCTCATGAG
CATATCTACCAACTTAAAAAACAGTTTTGCCTCAGCCCTTCGTACTGCTTCCCCACAACAAAGAGAAATGATGGATCAGGCAGCTGCTCA
ATTAGCTCAGGACAATTGTGAGTTGGCTTGCTGTTTTATTCAGAAGACTGCAGTAGAAAAAGCAGGCCCTGAGATGGACAAGAGATTAGC
AACTGAATTTGAGCTGAGAAAACATGCTAGGCAAGAAGGACGCAGATACTGTGATCCTGTTGTTTTAACATATCAAGCTGAACGGATGCC
AGAGCAAATCAGGCTGAAAGTTGGTGGTGTGGACCCAAAGCAGTTGGCTGTTTACGAAGAGTTTGCACGCAATGTTCCTGGCTTCTTACC
TACAAATGACTTAAGTCAGCCCACGGGATTTTTAGCCCAGCCCATGAAGCAAGCTTGGGCAACAGATGATGTAGCTCAGATTTATGATAA
GTGTATTACAGAACTGGAGCAACATCTACATGCCATCCCACCAACTTTGGCCATGAACCCTCAAGCTCAGGCTCTTCGAAGTCTCTTGGA
GGTTGTAGTTTTATCTCGAAACTCTCGGGATGCCATAGCTGCTCTTGGATTGCTCCAAAAGGCTGTAGAGGGCTTACTAGATGCCACAAG
TGGTGCTGATGCTGACCTTCTGCTGCGCTACAGGGAATGCCACCTCTTGGTCCTAAAAGCTCTGCAGGATGGCCGGGCATATGGGTCTCC
ATGGTGCAACAAACAGATCACAAGGTGCCTAATTGAATGTCGAGATGAATATAAATATAATGTGGAGGCTGTGGAGCTGCTAATTCGCAA
TCATTTGGTTAATATGCAGCAGTATGATCTTCACCTAGCGCAGTCAATGGAGAATGGCTTAAACTACATGGCTGTGGCATTTGCTATGCA
GTTAGTAAAAATCCTGCTGGTGGATGAAAGGAGTGTTGCTCATGTTACTGAGGCAGATCTGTTCCACACCATTGAAACCCTCATGAGGAT
TAATGCTCATTCCAGAGGCAATGCTCCAGAAGGATTGCCCCAGCTGATGGAAGTAGTGCGATCCAACTATGAAGCAATGATTGATCGTGC
TCATGGAGGCCCAAACTTTATGATGCATTCTGGGATCTCTCAAGCCTCAGAGTATGATGACCCTCCAGGCCTGAGGGAGAAGGCAGAGTA
TCTTCTGAGGGAATGGGTGAATCTCTACCATTCAGCAGCAGCTGGCCGCGACAGTACCAAAGCTTTCTCTGCATTTGTTGGACAGATGCA
CCAGCAAGGAATACTGAAGACCGATGATCTCATAACAAGGTTCTTTCGTCTGTGTACTGAAATGTGTGTTGAAATCAGTTACCGTGCTCA
GGCTGAGCAGCAGCACAATCCTGCTGCCAATCCCACCATGATCCGAGCCAAGTGCTATCACAACCTGGATGCCTTTGTTCGACTCATTGC
ACTGCTCGTGAAACACTCAGGGGAGGCCACCAACACTGTCACAAAGATTAATCTGCTGAACAAGGTCCTTGGTATAGTAGTGGGAGTTCT
CCTTCAGGATCATGATGTTCGTCAGAGTGAATTTCAGCAACTTCCCTACCATCGAATTTTTATCATGCTTCTCTTGGAACTCAATGCACC
TGAGCATGTGTTGGAAACCATTAATTTCCAGACACTTACAGCTTTCTGCAATACATTCCACATCTTGAGGCCTACCAAAGCTCCTGGCTT
TGTATATGCCTGGCTTGAACTGATTTCCCATCGGATATTTATTGCAAGAATGCTGGCACATACGCCACAGCAGAAGGGGTGGCCTATGTA
TGCACAGCTACTGATTGATTTATTCAAATATTTAGCGCCTTTCCTTAGAAATGTGGAACTCACCAAACCTATGCAAATCCTCTACAAGGG
CACTTTAAGAGTGCTGCTGGTTCTTTTGCATGATTTCCCAGAGTTCCTTTGTGATTACCATTATGGGTTCTGTGATGTGATCCCACCTAA
TTGTATCCAGTTAAGAAATTTGATCCTGAGTGCCTTTCCAAGAAACATGAGGCTCCCCGACCCATTCACTCCTAATCTAAAGGTGGACAT
GTTGAGTGAAATTAACATTGCTCCCCGGATTCTCACCAATTTCACTGGAGTAATGCCACCTCAGTTCAAAAAGGATTTGGATTCCTATCT
TAAAACTCGATCACCAGTCACTTTCCTGTCTGATCTGCGCAGCAACCTACAGGTATCCAATGAACCTGGGAATCGCTACAACCTCCAGCT
CATCAATGCACTGGTGCTCTATGTCGGGACTCAGGCCATTGCGCACATCCACAACAAGGGCAGCACACCTTCAATGAGCACCATCACTCA
CTCAGCACACATGGATATCTTCCAGAATTTGGCTGTGGACTTGGACACTGAGGGTCGCTATCTCTTTTTGAATGCAATTGCAAATCAGCT
CCGGTACCCAAATAGCCACACTCACTACTTCAGTTGCACCATGCTGTACCTTTTTGCAGAGGCCAATACGGAAGCCATCCAAGAACAGAT
CACAAGAGTTCTCTTGGAACGGTTGATTGTAAATAGGCCACATCCTTGGGGTCTTCTTATTACCTTCATTGAGCTGATTAAAAACCCAGC
GTTTAAGTTCTGGAACCATGAATTTGTACACTGTGCCCCAGAAATCGAAAAGTTATTCCAGTCGGTCGCACAGTGCTGCATGGGACAGAA
GCAGGCCCAGCAAGTAATGGAAGGGACAGGTGCCAGTTAGACGAAACTGCATCTCTGTTGTACGTGTCAGTCTAGAGGTCTCACTGCACC
GAGTTCATAAACTGACTGAAGAATCCTTTCAGCTCTTCCTGACTTTCCCAGCCCTTTGGTTTGTGGGTATCTGCCCCAACTACTGTTGGG
ATCAGCCTCCTGTCTTATGTGGGCACGTTCCAAAGTTTAAATGCATTTTTTTGACTCTTGGCCAAAATTTAGAAGATGCTGTGAATATCA
TTTTGAACTTGTGTAAATACATGAAAGAGAAAACCTTTGTCTGGAACTTCTTGGCTTTGTGCAAGCTGTGTCCAAGGCAAGTACATAAAC
TGGTACCTTGTAATGAAGAGGCAGCTGATGCCATGCACTTGTCTGAGGGCATAGCTCCATGTCTTCTGACATTCCTGGTGTCCCAAAGAA
TAGCAAAAAGCCAGTTTGAATATTATGTAACTTATTTTTTTAATGTGGACAGGGGACCTTGAAAATCACTAAGTTATTAAAAATGTGGAT
GTGCTAGAATTGGATATGTCCAGGAACATGGGAAGGGCTCACTATTGGAATCCCATGAGTTTCCATTTTGTCTCTACCCAAACGTATTCC
AAAGCTGACTGCATTTGTACCATCTTATTTCTTTTGGGGATTATACACCTCAGCCGCCTGAGATGGGGGTCAGCTCTTTATATAAAGGGA
AACCAGACCAGGCCTAAAGCCCACCCCTACCCTCACCCCCCCAATCCTCTCCTGAAACTTAAAAACAGTGGGAATATAGGAAAGGGAACC
AAATCTCATTAATTAATTGTTCTCCCCCATTACCCCACTGAATGAATGGCCATACAGGCTAAGCTGAATAATGACAAAGTTGAAAGGACC
AATACAGCCCCTTTTATAAGGATTTTGAATGTTTTGCAAATGTATTGGTCCCTGTGTTGTATTTTGTAGCCTTTTCCTGGGCTTCAGCTC

>In-frame_C16orf87_ENST00000285697_chr16_46864996_-_CNOT1_ENST00000569240_chr16_58581200_-_4083nt
GATACTCTGGGCGAGCTCGCGGGCGGGCTGTGGGTCGCGAGCCGCCGTGGGAGCGCGTGTCGCGGTCCCCAGGAGCCGCCGGCCGACGCT
CCGCCCCGCCCCCTTGGCGCCCAGGTCCCGCGCGAGCTCGCGCACGCGCGCGCGCGCACCCGCCAGAGGCTTGTTTGAGGCCCGCGGGGA
CTGGGCGGGCGGAGGCCGGGCTGCCGAAGTGTGAGGGGAGGAGCCCGAGCCGTCGCTGCTGCCGCCGCTAAGGGAGAGGAGCATGTCTGC
AACTCGAGCCAAGAAAGTGAAGATGGCCACCAAATCATGCCCCGAGTGCGACCAACAGGACTTGGATGTGAAATCATTGCTGCTAGAGGC
TTATGTTAAAGGACAACAAGAATTGCTCTATGTAGTGCCCTTTGTTGCCAAAGTCTTAGAATCTAGCATTCGTAGTGTGGTTTTTAGGCC
ACCAAACCCTTGGACAATGGCAATTATGAATGTATTAGCTGAGCTACATCAGGAGCATGACTTAAAGTTAAACTTGAAGTTTGAAATCGA
GGTTCTCTGCAAGAACCTTGCATTAGACATCAATGAGCTAAAACCTGGAAACCTCCTAAAGGATAAAGATCGCCTGAAGAATTTAGATGA
GCAACTCTCTGCTCCAAAGAAAGATGTCAAGCAGCCAGAAGAACTCCCTCCCATCACAACCACAACAACTTCTACTACACCAGCTACCAA
CACCACTTGTACAGCCACGGTTCCACCACAGCCACAGTACAGCTACCACGACATCAATGTCTATTCCCTTGCGGGCTTGGCACCACACAT
TACTCTGAATCCAACAATTCCCTTGTTTCAGGCCCATCCACAGTTGAAGCAGTGTGTGCGTCAGGCAATTGAACGGGCTGTCCAGGAGCT
GGTCCATCCTGTGGTGGATCGATCAATTAAGATTGCCATGACTACTTGTGAGCAAATAGTCAGGAAGGATTTTGCCCTGGATTCGGAGGA
ATCTCGAATGCGAATAGCAGCTCATCACATGATGCGTAACTTGACAGCTGGAATGGCTATGATTACATGCAGGGAACCTTTGCTCATGAG
CATATCTACCAACTTAAAAAACAGTTTTGCCTCAGCCCTTCGTACTGCTTCCCCACAACAAAGAGAAATGATGGATCAGGCAGCTGCTCA
ATTAGCTCAGGACAATTGTGAGTTGGCTTGCTGTTTTATTCAGAAGACTGCAGTAGAAAAAGCAGGCCCTGAGATGGACAAGAGATTAGC
AACTGAATTTGAGCTGAGAAAACATGCTAGGCAAGAAGGACGCAGATACTGTGATCCTGTTGTTTTAACATATCAAGCTGAACGGATGCC
AGAGCAAATCAGGCTGAAAGTTGGTGGTGTGGACCCAAAGCAGTTGGCTGTTTACGAAGAGTTTGCACGCAATGTTCCTGGCTTCTTACC
TACAAATGACTTAAGTCAGCCCACGGGATTTTTAGCCCAGCCCATGAAGCAAGCTTGGGCAACAGATGATGTAGCTCAGATTTATGATAA
GTGTATTACAGAACTGGAGCAACATCTACATGCCATCCCACCAACTTTGGCCATGAACCCTCAAGCTCAGGCTCTTCGAAGTCTCTTGGA
GGTTGTAGTTTTATCTCGAAACTCTCGGGATGCCATAGCTGCTCTTGGATTGCTCCAAAAGGCTGTAGAGGGCTTACTAGATGCCACAAG
TGGTGCTGATGCTGACCTTCTGCTGCGCTACAGGGAATGCCACCTCTTGGTCCTAAAAGCTCTGCAGGATGGCCGGGCATATGGGTCTCC
ATGGTGCAACAAACAGATCACAAGGTGCCTAATTGAATGTCGAGATGAATATAAATATAATGTGGAGGCTGTGGAGCTGCTAATTCGCAA
TCATTTGGTTAATATGCAGCAGTATGATCTTCACCTAGCGCAGTCAATGGAGAATGGCTTAAACTACATGGCTGTGGCATTTGCTATGCA
GTTAGTAAAAATCCTGCTGGTGGATGAAAGGAGTGTTGCTCATGTTACTGAGGCAGATCTGTTCCACACCATTGAAACCCTCATGAGGAT
TAATGCTCATTCCAGAGGCAATGCTCCAGAAGGATTGCCCCAGCTGATGGAAGTAGTGCGATCCAACTATGAAGCAATGATTGATCGTGC
TCATGGAGGCCCAAACTTTATGATGCATTCTGGGATCTCTCAAGCCTCAGAGTATGATGACCCTCCAGGCCTGAGGGAGAAGGCAGAGTA
TCTTCTGAGGGAATGGGTGAATCTCTACCATTCAGCAGCAGCTGGCCGCGACAGTACCAAAGCTTTCTCTGCATTTGTTGGACAGATGCA
CCAGCAAGGAATACTGAAGACCGATGATCTCATAACAAGGTTCTTTCGTCTGTGTACTGAAATGTGTGTTGAAATCAGTTACCGTGCTCA
GGCTGAGCAGCAGCACAATCCTGCTGCCAATCCCACCATGATCCGAGCCAAGTGCTATCACAACCTGGATGCCTTTGTTCGACTCATTGC
ACTGCTCGTGAAACACTCAGGGGAGGCCACCAACACTGTCACAAAGATTAATCTGCTGAACAAGGTCCTTGGTATAGTAGTGGGAGTTCT
CCTTCAGGATCATGATGTTCGTCAGAGTGAATTTCAGCAACTTCCCTACCATCGAATTTTTATCATGCTTCTCTTGGAACTCAATGCACC
TGAGCATGTGTTGGAAACCATTAATTTCCAGACACTTACAGCTTTCTGCAATACATTCCACATCTTGAGGCCTACCAAAGCTCCTGGCTT
TGTATATGCCTGGCTTGAACTGATTTCCCATCGGATATTTATTGCAAGAATGCTGGCACATACGCCACAGCAGAAGGGGTGGCCTATGTA
TGCACAGCTACTGATTGATTTATTCAAATATTTAGCGCCTTTCCTTAGAAATGTGGAACTCACCAAACCTATGCAAATCCTCTACAAGGG
CACTTTAAGAGTGCTGCTGGTTCTTTTGCATGATTTCCCAGAGTTCCTTTGTGATTACCATTATGGGTTCTGTGATGTGATCCCACCTAA
TTGTATCCAGTTAAGAAATTTGATCCTGAGTGCCTTTCCAAGAAACATGAGGCTCCCCGACCCATTCACTCCTAATCTAAAGGTGGACAT
GTTGAGTGAAATTAACATTGCTCCCCGGATTCTCACCAATTTCACTGGAGTAATGCCACCTCAGTTCAAAAAGGATTTGGATTCCTATCT
TAAAACTCGATCACCAGTCACTTTCCTGTCTGATCTGCGCAGCAACCTACAGGTATCCAATGAACCTGGGAATCGCTACAACCTCCAGCT
CATCAATGCACTGGTGCTCTATGTCGGGACTCAGGCCATTGCGCACATCCACAACAAGGGCAGCACACCTTCAATGAGCACCATCACTCA
CTCAGCACACATGGATATCTTCCAGAATTTGGCTGTGGACTTGGACACTGAGGGTCGCTATCTCTTTTTGAATGCAATTGCAAATCAGCT
CCGGTACCCAAATAGCCACACTCACTACTTCAGTTGCACCATGCTGTACCTTTTTGCAGAGGCCAATACGGAAGCCATCCAAGAACAGAT
CACAAGAGTTCTCTTGGAACGGTTGATTGTAAATAGGCCACATCCTTGGGGTCTTCTTATTACCTTCATTGAGCTGATTAAAAACCCAGC
GTTTAAGTTCTGGAACCATGAATTTGTACACTGTGCCCCAGAAATCGAAAAGTTATTCCAGTCGGTCGCACAGTGCTGCATGGGACAGAA
GCAGGCCCAGCAAGTAATGGAAGGGACAGGTGCCAGTTAGACGAAACTGCATCTCTGTTGTACGTGTCAGTCTAGAGGTCTCACTGCACC
GAGTTCATAAACTGACTGAAGAATCCTTTCAGCTCTTCCTGACTTTCCCAGCCCTTTGGTTTGTGGGTATCTGCCCCAACTACTGTTGGG
ATCAGCCTCCTGTCTTATGTGGGCACGTTCCAAAGTTTAAATGCATTTTTTTGACTCTTGGCCAAAATTTAGAAGATGCTGTGAATATCA

>In-frame_C16orf87_ENST00000285697_chr16_46864996_-_CNOT1_ENST00000441024_chr16_58581200_-_1403nt
GATACTCTGGGCGAGCTCGCGGGCGGGCTGTGGGTCGCGAGCCGCCGTGGGAGCGCGTGTCGCGGTCCCCAGGAGCCGCCGGCCGACGCT
CCGCCCCGCCCCCTTGGCGCCCAGGTCCCGCGCGAGCTCGCGCACGCGCGCGCGCGCACCCGCCAGAGGCTTGTTTGAGGCCCGCGGGGA
CTGGGCGGGCGGAGGCCGGGCTGCCGAAGTGTGAGGGGAGGAGCCCGAGCCGTCGCTGCTGCCGCCGCTAAGGGAGAGGAGCATGTCTGC
AACTCGAGCCAAGAAAGTGAAGATGGCCACCAAATCATGCCCCGAGTGCGACCAACAGGACTTGGATGTGAAATCATTGCTGCTAGAGGC
TTATGTTAAAGGACAACAAGAATTGCTCTATGTAGTGCCCTTTGTTGCCAAAGTCTTAGAATCTAGCATTCGTAGTGTGGTTTTTAGGCC
ACCAAACCCTTGGACAATGGCAATTATGAATGTATTAGCTGAGCTACATCAGGAGCATGACTTAAAGTTAAACTTGAAGTTTGAAATCGA
GGTTCTCTGCAAGAACCTTGCATTAGACATCAATGAGCTAAAACCTGGAAACCTCCTAAAGGATAAAGATCGCCTGAAGAATTTAGATGA
GCAACTCTCTGCTCCAAAGAAAGATGTCAAGCAGCCAGAAGAACTCCCTCCCATCACAACCACAACAACTTCTACTACACCAGCTACCAA
CACCACTTGTACAGCCACGGTTCCACCACAGCCACAGTACAGCTACCACGACATCAATGTCTATTCCCTTGCGGGCTTGGCACCACACAT
TACTCTGAATCCAACAATTCCCTTGTTTCAGGCCCATCCACAGTTGAAGCAGTGTGTGCGTCAGGCAATTGAACGGGCTGTCCAGGAGCT
GGTCCATCCTGTGGTGGATCGATCAATTAAGATTGCCATGACTACTTGTGAGCAAATAGTCAGGAAGGATTTTGCCCTGGATTCGGAGGA
ATCTCGAATGCGAATAGCAGCTCATCACATGATGCGTAACTTGACAGCTGGAATGGCTATGATTACATGCAGGGAACCTTTGCTCATGAG
CATATCTACCAACTTAAAAAACAGTTTTGCCTCAGCCCTTCGTGTAAGTTGGCTATTTCCTTGGTATAGGTACAAAACGTATTACTGCTT
GTCTGTAATAATTTTTTTCTTTGTCTATATATGGCACTGGGCGTTACCACTTATTCTTAATAATCACCATATTTGTTTGATGTCTTCCAT
CATTTTAGATTGTAATTCTGTGAGGCAAAGCATCATGTCTGTGTGTTTTTTTTTTTTTCTGTTATATTCTCAACACGATGTTTGACAGAT


Top

FusionGenePPI for C16orf87_CNOT1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
C16orf87ELAVL1, HDAC1, HDAC2, MAGEA12, MOV10, HIST1H2BA, MIER3, ANAPC2, MIER1, CDC16, ARID5B, NEK2, ANAPC4, CDC23, CDC27, MIER2, ANAPC5, ANAPC1, FZR1, H2AFX, ANAPC7, ANAPC16CNOT1CNOT8, BTG2, CNOT2, CNOT4, USP22, GTF2A1, SIRT7, GRB2, CNOT3, RQCD1, NOTCH1, EPAS1, ALB, FN1, CNOT6L, CNOT6, PEX14, PPP6R1, CCAR2, KRT18, POLR1C, LGR4, RNF219, FBXW11, TNRC6A, TNRC6C, RXRA, CCDC8, NANOS1, NANOS2, NANOS3, TRIM74, CT55, MMP7, CAPZA2, CNOT7, SCN2B, TNRC6B, AGO2, NTRK1, KRAS, IFI16, BTRC, MED4, SSX2IP, CEP152, CNTROB, NINL, CENPJ, XPO1, ABCF1, ATRX, CAPZA1, CAPZB, FHL2, RPS27, SDCBP, UBTF, TOB1, TOB2, BTG3, NUPL2, REEP5, BAG6, CNOT10, IBTK, SND1, AFF4, AURKAIP1, PI4K2A, CNOT11, GPBP1L1, INTS5, TNKS1BP1, RAVER1, DDX6, SNW1, CDC5L, MEX3C, RC3H1, EYA2, TEX13A, RIBC1, GADD45B, IZUMO1, TRIM25, G3BP1, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneCNOT1chr16:46864996chr16:58581200ENST00000317147-25491090_160512132377CNOT6%2C CNOT6L%2C CNOT7 and CNOT8
TgeneCNOT1chr16:46864996chr16:58581200ENST00000441024-25311090_160512131552CNOT6%2C CNOT6L%2C CNOT7 and CNOT8
TgeneCNOT1chr16:46864996chr16:58581200ENST00000569240-25491090_160512082372CNOT6%2C CNOT6L%2C CNOT7 and CNOT8
TgeneCNOT1chr16:46864996chr16:58581200ENST00000317147-2549800_101512132377ZFP36
TgeneCNOT1chr16:46864996chr16:58581200ENST00000441024-2531800_101512131552ZFP36
TgeneCNOT1chr16:46864996chr16:58581200ENST00000569240-2549800_101512082372ZFP36


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for C16orf87_CNOT1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for C16orf87_CNOT1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource