FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4657

FusionGeneSummary for C11orf84_MACROD1

check button Fusion gene summary
Fusion gene informationFusion gene name: C11orf84_MACROD1
Fusion gene ID: 4657
HgeneTgene
Gene symbol

C11orf84

MACROD1

Gene ID

28992

Gene nameMACRO domain containing 1
SynonymsLRP16
Cytomap

11q13.1

Type of geneprotein-coding
DescriptionO-acetyl-ADP-ribose deacetylase MACROD1MACRO domain-containing protein 1[Protein ADP-ribosylglutamate] hydrolase
Modification date20180519
UniProtAcc

Q9BUA3

Q9BQ69

Ensembl transtripts involved in fusion geneENST00000294244, ENST00000255681, 
ENST00000538595, 
Fusion gene scores* DoF score5 X 3 X 5=756 X 4 X 6=144
# samples 76
** MAII scorelog2(7/75*10)=-0.0995356735509144
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/144*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: C11orf84 [Title/Abstract] AND MACROD1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneMACROD1

GO:0042278

purine nucleoside metabolic process

21257746

TgeneMACROD1

GO:0051725

protein de-ADP-ribosylation

23474712


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDGBMTCGA-28-1753-01AC11orf84chr11

63586474

+MACROD1chr11

63782753

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000294244ENST00000255681C11orf84chr11

63586474

+MACROD1chr11

63782753

-
5CDS-intronENST00000294244ENST00000538595C11orf84chr11

63586474

+MACROD1chr11

63782753

-

Top

FusionProtFeatures for C11orf84_MACROD1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
C11orf84

Q9BUA3

MACROD1

Q9BQ69

Negatively regulates the transcriptional activatoractivity of SPIN1 via inhibition of its histone methyl-bindingability. Represses the expression of a number of SPIN1-regulatedgenes and the SPIN1-mediated activation of the Wnt signalingpathway. Can also inhibit the histone methyl-binding abilities ofSPIN2A, SPIN2B, SPIN3 and SPIN4 (PubMed:29061846).{ECO:0000269|PubMed:29061846}. Removes ADP-ribose from glutamate residues in proteinsbearing a single ADP-ribose moiety. Inactive towards proteinsbearing poly-ADP-ribose. Deacetylates O-acetyl-ADP ribose, asignaling molecule generated by the deacetylation of acetylatedlysine residues in histones and other proteins. Plays a role inestrogen signaling. Binds to androgen receptor (AR) and amplifiesthe transactivation function of AR in response to androgen. Mayplay an important role in carcinogenesis and/or progression ofhormone-dependent cancers by feed-forward mechanism that activatesESR1 transactivation. Could be an ESR1 coactivator, providing apositive feedback regulatory loop for ESR1 signal transduction.Could be involved in invasive growth by down-regulating CDH1 inendometrial cancer cells. Enhances ESR1-mediated transcriptionactivity. {ECO:0000269|PubMed:17893710,ECO:0000269|PubMed:17914104, ECO:0000269|PubMed:19022849,ECO:0000269|PubMed:19403568, ECO:0000269|PubMed:21257746,ECO:0000269|PubMed:23474712}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneC11orf84chr11:63586474chr11:63782753ENST00000294244+56147_252311382Compositional biasNote=Pro-rich
TgeneMACROD1chr11:63586474chr11:63782753ENST00000255681-211172_174172225RegionSubstrate binding
TgeneMACROD1chr11:63586474chr11:63782753ENST00000255681-211179_184172225RegionSubstrate binding
TgeneMACROD1chr11:63586474chr11:63782753ENST00000255681-211267_273172225RegionSubstrate binding

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMACROD1chr11:63586474chr11:63782753ENST00000255681-211141_322172225DomainMacro
TgeneMACROD1chr11:63586474chr11:63782753ENST00000255681-211159_161172225RegionSubstrate binding


Top

FusionGeneSequence for C11orf84_MACROD1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_C11orf84_ENST00000294244_chr11_63586474_+_MACROD1_ENST00000255681_chr11_63782753_-_465aa
MALKAEGAALDCFEVTLKCEEGEDEEEAMVVAVIPRPEPMLRVTQQEKTPPPRPSPLEAGSDGCEEPKQQVSWEQEFLVGSSPGGSGRAL
CMVCGAEIRAPSADTARSHILEQHPHTLDLSPSEKSNILEAWSEGVALLQDVRAEQPSPPNSDSGQDAHPDPDANPDAARMPAEIVVLLD
SEDNPSLPKRSRPRGLRPLELPAVPATEPGNKKPRGQRWKEPPGEEPVRKKRGRPMTKNLDPDPEPPSPDSPTETFAAPAEVRHFTDGSF
PAGFVLQLFSHTQLRGPDSKDSPKDREVAEGGLPRAESPSPANSSLLGGGGVDGCIHRAAGPLLTDECRTLQSCKTGKAKITGGTRLPAK
YVIHTVGPIAYGEPSASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAAEIVLATLREWLEQHKDKVDRLIICVFLEKDE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_C11orf84_ENST00000294244_chr11_63586474_+_MACROD1_ENST00000255681_chr11_63782753_-_1395nt
ATGGCCCTAAAGGCCGAGGGCGCCGCACTCGACTGCTTCGAGGTGACGCTGAAATGCGAGGAAGGGGAGGACGAGGAGGAGGCCATGGTG
GTGGCCGTAATTCCGCGGCCCGAGCCGATGCTCAGAGTGACCCAACAGGAGAAGACCCCACCGCCTAGACCCAGCCCGCTAGAGGCAGGC
AGTGATGGCTGTGAGGAGCCGAAGCAGCAGGTGTCTTGGGAGCAGGAGTTCCTGGTGGGCAGCAGCCCAGGAGGCAGCGGGCGGGCACTG
TGCATGGTGTGTGGCGCTGAGATCCGGGCACCCTCGGCCGACACAGCTCGCTCGCACATCTTGGAGCAGCACCCTCACACCTTGGACCTG
AGCCCTTCTGAGAAGAGCAATATCCTGGAGGCCTGGAGTGAAGGGGTGGCCCTCTTGCAAGACGTGAGAGCTGAGCAGCCGTCCCCACCC
AACTCAGACTCGGGCCAGGATGCCCACCCAGACCCAGACGCCAACCCAGACGCTGCCAGAATGCCAGCCGAAATCGTCGTTCTCCTTGAC
TCTGAGGATAACCCATCCCTCCCTAAAAGGAGCCGGCCCAGGGGACTCCGCCCCCTCGAGCTTCCTGCTGTCCCTGCCACAGAGCCAGGA
AATAAGAAGCCCCGTGGTCAGAGATGGAAGGAACCCCCAGGGGAAGAGCCAGTCAGAAAGAAAAGAGGCAGACCTATGACCAAAAACCTG
GACCCTGACCCAGAGCCCCCATCGCCAGACTCGCCCACGGAGACTTTCGCAGCACCAGCCGAGGTCCGACACTTCACTGACGGCAGCTTC
CCCGCCGGCTTCGTCTTGCAGCTCTTCTCCCACACCCAGCTCAGGGGCCCAGACAGCAAGGACTCACCCAAAGACAGGGAAGTGGCAGAA
GGAGGCCTTCCCCGGGCGGAGAGCCCCTCTCCAGCCAACAGCTCCCTGCTCGGAGGCGGTGGCGTGGACGGCTGCATTCATCGGGCCGCC
GGCCCCCTGCTTACCGACGAGTGCCGGACCCTGCAGAGCTGTAAGACTGGCAAGGCCAAGATCACCGGCGGCTATCGGCTCCCGGCCAAG
TACGTCATCCACACAGTGGGGCCCATCGCCTACGGGGAGCCCAGCGCCAGTCAGGCTGCCGAGCTCCGCAGCTGCTACCTGAGCAGTCTG
GACCTGCTGCTGGAGCACCGGCTCCGCTCGGTGGCGTTCCCCTGCATCTCCACCGGCGTGTTTGGCTACCCCTGTGAGGCGGCCGCCGAG
ATCGTGCTGGCCACGCTGCGAGAGTGGCTGGAGCAGCACAAGGACAAGGTGGACCGGCTGATCATCTGCGTGTTCCTCGAGAAGGACGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_C11orf84_ENST00000294244_chr11_63586474_+_MACROD1_ENST00000255681_chr11_63782753_-_1854nt
GGCTGGCCGGCCGGGCGGGCGCCGACAATGAGCCTCCATAAAAGGGAGCGGCGGGGGGCAGGGGCCCCGGATTGAGCCCTCCCCGCCCGG
GCTCCCGACGCGCCGAGGTCTCGGGGAGGCCCGGACGCGCCGGTCGCAGGCCCGGCCGGCGAGCGGCGGGCGGGCGGCGGGGAGGGGGCT
GCGCGGGGCGGGCGGCGGGCCCGGCGCTATTCCGGCCAGGAGGCGGGAGGCGGTTGCCGGCTGCGCGCCGAAGCCTGCGCGCCAGTCCTC
CGGCCACTGCTATCGCCCACGGCCGCACCATGGCCCTAAAGGCCGAGGGCGCCGCACTCGACTGCTTCGAGGTGACGCTGAAATGCGAGG
AAGGGGAGGACGAGGAGGAGGCCATGGTGGTGGCCGTAATTCCGCGGCCCGAGCCGATGCTCAGAGTGACCCAACAGGAGAAGACCCCAC
CGCCTAGACCCAGCCCGCTAGAGGCAGGCAGTGATGGCTGTGAGGAGCCGAAGCAGCAGGTGTCTTGGGAGCAGGAGTTCCTGGTGGGCA
GCAGCCCAGGAGGCAGCGGGCGGGCACTGTGCATGGTGTGTGGCGCTGAGATCCGGGCACCCTCGGCCGACACAGCTCGCTCGCACATCT
TGGAGCAGCACCCTCACACCTTGGACCTGAGCCCTTCTGAGAAGAGCAATATCCTGGAGGCCTGGAGTGAAGGGGTGGCCCTCTTGCAAG
ACGTGAGAGCTGAGCAGCCGTCCCCACCCAACTCAGACTCGGGCCAGGATGCCCACCCAGACCCAGACGCCAACCCAGACGCTGCCAGAA
TGCCAGCCGAAATCGTCGTTCTCCTTGACTCTGAGGATAACCCATCCCTCCCTAAAAGGAGCCGGCCCAGGGGACTCCGCCCCCTCGAGC
TTCCTGCTGTCCCTGCCACAGAGCCAGGAAATAAGAAGCCCCGTGGTCAGAGATGGAAGGAACCCCCAGGGGAAGAGCCAGTCAGAAAGA
AAAGAGGCAGACCTATGACCAAAAACCTGGACCCTGACCCAGAGCCCCCATCGCCAGACTCGCCCACGGAGACTTTCGCAGCACCAGCCG
AGGTCCGACACTTCACTGACGGCAGCTTCCCCGCCGGCTTCGTCTTGCAGCTCTTCTCCCACACCCAGCTCAGGGGCCCAGACAGCAAGG
ACTCACCCAAAGACAGGGAAGTGGCAGAAGGAGGCCTTCCCCGGGCGGAGAGCCCCTCTCCAGCCAACAGCTCCCTGCTCGGAGGCGGTG
GCGTGGACGGCTGCATTCATCGGGCCGCCGGCCCCCTGCTTACCGACGAGTGCCGGACCCTGCAGAGCTGTAAGACTGGCAAGGCCAAGA
TCACCGGCGGCTATCGGCTCCCGGCCAAGTACGTCATCCACACAGTGGGGCCCATCGCCTACGGGGAGCCCAGCGCCAGTCAGGCTGCCG
AGCTCCGCAGCTGCTACCTGAGCAGTCTGGACCTGCTGCTGGAGCACCGGCTCCGCTCGGTGGCGTTCCCCTGCATCTCCACCGGCGTGT
TTGGCTACCCCTGTGAGGCGGCCGCCGAGATCGTGCTGGCCACGCTGCGAGAGTGGCTGGAGCAGCACAAGGACAAGGTGGACCGGCTGA
TCATCTGCGTGTTCCTCGAGAAGGACGAGGACATCTACCGGAGCCGGCTCCCCCACTACTTCCCCGTGGCCTGAGGCTCCCGCAGCCCAC
CCTGACCGGGACTGACCCGCCTTCGGGACCCCGCTCCCAGCTCTGAGAGGTCGCCAAAGCCTGCAGCCTGGCCTGGGCCTGGCCACCCCT


Top

FusionGenePPI for C11orf84_MACROD1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
C11orf84EGFR, YWHAE, UBL4A, HECW2, ASB2, FBXW11, SPIN2B, SPIN1, SPIN3, HIST1H3E, GAN, RC3H1, CRBN, CFAP20, POLR2E, C17orf89, CYLD, PARK7, TRIM25, YAP1MACROD1BAG3, PARP1, IKBKG, XRCC6, XRCC5, IKBKB, ERC1, EIF2AK2, HNRNPU, CSTF3, YBX1, DHX9, DDX21, PPP2R1A, PTP4A1, H2AFX, PARP2, SUPT16H, HIST2H3PS2, XPC, SSRP1, HBA2, EXOC3, CETN2, LIG3, HBE1, RPA1, PTPN6, PTPN7, DLD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for C11orf84_MACROD1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for C11orf84_MACROD1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource