FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4451

FusionGeneSummary for BRMS1L_ZNF839

check button Fusion gene summary
Fusion gene informationFusion gene name: BRMS1L_ZNF839
Fusion gene ID: 4451
HgeneTgene
Gene symbol

BRMS1L

ZNF839

Gene ID

84312

55778

Gene nameBRMS1 like transcriptional repressorzinc finger protein 839
SynonymsBRMS1C14orf131
Cytomap

14q13.2

14q32.31

Type of geneprotein-codingprotein-coding
Descriptionbreast cancer metastasis-suppressor 1-like proteinBRMS1-homolog protein p40BRMS1-like protein p40breast cancer metastasis-suppressor 1breast cancer metastasis-suppressor 1 likezinc finger protein 839renal carcinoma antigen NY-REN-50
Modification date2018052320180519
UniProtAcc

Q5PSV4

A8K0R7

Ensembl transtripts involved in fusion geneENST00000216807, ENST00000543183, 
ENST00000558850, ENST00000559185, 
ENST00000442396, ENST00000262236, 
ENST00000420933, 
Fusion gene scores* DoF score3 X 2 X 3=182 X 2 X 2=8
# samples 32
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(2/8*10)=1.32192809488736
Context

PubMed: BRMS1L [Title/Abstract] AND ZNF839 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVACCTCGA-OR-A5KW-01ABRMS1Lchr14

36304129

+ZNF839chr14

102805153

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000216807ENST00000558850BRMS1Lchr14

36304129

+ZNF839chr14

102805153

+
In-frameENST00000216807ENST00000559185BRMS1Lchr14

36304129

+ZNF839chr14

102805153

+
In-frameENST00000216807ENST00000442396BRMS1Lchr14

36304129

+ZNF839chr14

102805153

+
In-frameENST00000216807ENST00000262236BRMS1Lchr14

36304129

+ZNF839chr14

102805153

+
5CDS-3UTRENST00000216807ENST00000420933BRMS1Lchr14

36304129

+ZNF839chr14

102805153

+
In-frameENST00000543183ENST00000558850BRMS1Lchr14

36304129

+ZNF839chr14

102805153

+
In-frameENST00000543183ENST00000559185BRMS1Lchr14

36304129

+ZNF839chr14

102805153

+
In-frameENST00000543183ENST00000442396BRMS1Lchr14

36304129

+ZNF839chr14

102805153

+
In-frameENST00000543183ENST00000262236BRMS1Lchr14

36304129

+ZNF839chr14

102805153

+
5CDS-3UTRENST00000543183ENST00000420933BRMS1Lchr14

36304129

+ZNF839chr14

102805153

+

Top

FusionProtFeatures for BRMS1L_ZNF839


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BRMS1L

Q5PSV4

ZNF839

A8K0R7

Involved in the histone deacetylase (HDAC1)-dependenttranscriptional repression activity. When overexpressed in lungcancer cell line that lacks p53/TP53 expression, inhibits cellgrowth. {ECO:0000269|PubMed:15451426}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBRMS1Lchr14:36304129chr14:102805153ENST00000216807+41052_84147324Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBRMS1Lchr14:36304129chr14:102805153ENST00000216807+410149_180147324Coiled coilOntology_term=ECO:0000255
TgeneZNF839chr14:36304129chr14:102805153ENST00000262236+48103_108437814Compositional biasNote=Poly-Ser
TgeneZNF839chr14:36304129chr14:102805153ENST00000442396+48103_108553928Compositional biasNote=Poly-Ser
TgeneZNF839chr14:36304129chr14:102805153ENST00000558850+48103_108437812Compositional biasNote=Poly-Ser
TgeneZNF839chr14:36304129chr14:102805153ENST00000559185+48103_108437812Compositional biasNote=Poly-Ser
TgeneZNF839chr14:36304129chr14:102805153ENST00000262236+48197_222437814Zinc fingerC2H2-type
TgeneZNF839chr14:36304129chr14:102805153ENST00000442396+48197_222553928Zinc fingerC2H2-type
TgeneZNF839chr14:36304129chr14:102805153ENST00000558850+48197_222437812Zinc fingerC2H2-type
TgeneZNF839chr14:36304129chr14:102805153ENST00000559185+48197_222437812Zinc fingerC2H2-type


Top

FusionGeneSequence for BRMS1L_ZNF839


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BRMS1L_ENST00000216807_chr14_36304129_+_ZNF839_ENST00000558850_chr14_102805153_+_522aa
MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAK
LQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQASRQHCEVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGE
QLEGASSEKREREAAEEGLASVKRPRREALSNDTTESLAANSRGREKPRPLHALAAGFSPPVNVTVSPRSEESHTTTVSGGNGSVFQAGP
QLQALANLEARRGSIGAALSSRDVSGLPVYAQSGEPRRLTQAQVAAFPGENALEHSSDQDTWDSLRSPGFCSPLSSGGGAESLPPGGPGH
AEAGHLGKVCDFHLNHQQPSPTSVLPTEVAAPPLEKILSVDSVAVDCAYRTVPKPGPQPGPHGSLLTEGCLRSLSGDLNRFPCGMEVHSG

>In-frame_BRMS1L_ENST00000216807_chr14_36304129_+_ZNF839_ENST00000559185_chr14_102805153_+_522aa
MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAK
LQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQASRQHCEVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGE
QLEGASSEKREREAAEEGLASVKRPRREALSNDTTESLAANSRGREKPRPLHALAAGFSPPVNVTVSPRSEESHTTTVSGGNGSVFQAGP
QLQALANLEARRGSIGAALSSRDVSGLPVYAQSGEPRRLTQAQVAAFPGENALEHSSDQDTWDSLRSPGFCSPLSSGGGAESLPPGGPGH
AEAGHLGKVCDFHLNHQQPSPTSVLPTEVAAPPLEKILSVDSVAVDCAYRTVPKPGPQPGPHGSLLTEGCLRSLSGDLNRFPCGMEVHSG

>In-frame_BRMS1L_ENST00000216807_chr14_36304129_+_ZNF839_ENST00000442396_chr14_102805153_+_522aa
MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAK
LQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQASRQHCEVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGE
QLEGASSEKREREAAEEGLASVKRPRREALSNDTTESLAANSRGREKPRPLHALAAGFSPPVNVTVSPRSEESHTTTVSGGNGSVFQAGP
QLQALANLEARRGSIGAALSSRDVSGLPVYAQSGEPRRLTQAQVAAFPGENALEHSSDQDTWDSLRSPGFCSPLSSGGGAESLPPGGPGH
AEAGHLGKVCDFHLNHQQPSPTSVLPTEVAAPPLEKILSVDSVAVDCAYRTVPKPGPQPGPHGSLLTEGCLRSLSGDLNRFPCGMEVHSG

>In-frame_BRMS1L_ENST00000216807_chr14_36304129_+_ZNF839_ENST00000262236_chr14_102805153_+_524aa
MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAK
LQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQASRQHCEVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGE
QLEGASSEKREREAAEEGLASVKRPRREALSNDTTESLAANSRGREKPRPLHALAAGEGFSPPVNVTVSPRSEESHTTTVSGGNGSVFQA
GPQLQALANLEARRGSIGAALSSRDVSGLPVYAQSGEPRRLTQAQVAAFPGENALEHSSDQDTWDSLRSPGFCSPLSSGGGAESLPPGGP
GHAEAGHLGKVCDFHLNHQQPSPTSVLPTEVAAPPLEKILSVDSVAVDCAYRTVPKPGPQPGPHGSLLTEGCLRSLSGDLNRFPCGMEVH

>In-frame_BRMS1L_ENST00000543183_chr14_36304129_+_ZNF839_ENST00000558850_chr14_102805153_+_474aa
MDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECE
IQASRQHCEVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGEQLEGASSEKREREAAEEGLASVKRPRREALSNDTTESLAANSRGREKP
RPLHALAAGFSPPVNVTVSPRSEESHTTTVSGGNGSVFQAGPQLQALANLEARRGSIGAALSSRDVSGLPVYAQSGEPRRLTQAQVAAFP
GENALEHSSDQDTWDSLRSPGFCSPLSSGGGAESLPPGGPGHAEAGHLGKVCDFHLNHQQPSPTSVLPTEVAAPPLEKILSVDSVAVDCA
YRTVPKPGPQPGPHGSLLTEGCLRSLSGDLNRFPCGMEVHSGQRELESVVAVGEAMAFEISNGSHELLSQGQKQIFIQTSDGLILSPPGT

>In-frame_BRMS1L_ENST00000543183_chr14_36304129_+_ZNF839_ENST00000559185_chr14_102805153_+_474aa
MDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECE
IQASRQHCEVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGEQLEGASSEKREREAAEEGLASVKRPRREALSNDTTESLAANSRGREKP
RPLHALAAGFSPPVNVTVSPRSEESHTTTVSGGNGSVFQAGPQLQALANLEARRGSIGAALSSRDVSGLPVYAQSGEPRRLTQAQVAAFP
GENALEHSSDQDTWDSLRSPGFCSPLSSGGGAESLPPGGPGHAEAGHLGKVCDFHLNHQQPSPTSVLPTEVAAPPLEKILSVDSVAVDCA
YRTVPKPGPQPGPHGSLLTEGCLRSLSGDLNRFPCGMEVHSGQRELESVVAVGEAMAFEISNGSHELLSQGQKQIFIQTSDGLILSPPGT

>In-frame_BRMS1L_ENST00000543183_chr14_36304129_+_ZNF839_ENST00000442396_chr14_102805153_+_474aa
MDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECE
IQASRQHCEVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGEQLEGASSEKREREAAEEGLASVKRPRREALSNDTTESLAANSRGREKP
RPLHALAAGFSPPVNVTVSPRSEESHTTTVSGGNGSVFQAGPQLQALANLEARRGSIGAALSSRDVSGLPVYAQSGEPRRLTQAQVAAFP
GENALEHSSDQDTWDSLRSPGFCSPLSSGGGAESLPPGGPGHAEAGHLGKVCDFHLNHQQPSPTSVLPTEVAAPPLEKILSVDSVAVDCA
YRTVPKPGPQPGPHGSLLTEGCLRSLSGDLNRFPCGMEVHSGQRELESVVAVGEAMAFEISNGSHELLSQGQKQIFIQTSDGLILSPPGT

>In-frame_BRMS1L_ENST00000543183_chr14_36304129_+_ZNF839_ENST00000262236_chr14_102805153_+_476aa
MDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECE
IQASRQHCEVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGEQLEGASSEKREREAAEEGLASVKRPRREALSNDTTESLAANSRGREKP
RPLHALAAGEGFSPPVNVTVSPRSEESHTTTVSGGNGSVFQAGPQLQALANLEARRGSIGAALSSRDVSGLPVYAQSGEPRRLTQAQVAA
FPGENALEHSSDQDTWDSLRSPGFCSPLSSGGGAESLPPGGPGHAEAGHLGKVCDFHLNHQQPSPTSVLPTEVAAPPLEKILSVDSVAVD
CAYRTVPKPGPQPGPHGSLLTEGCLRSLSGDLNRFPCGMEVHSGQRELESVVAVGEAMAFEISNGSHELLSQGQKQIFIQTSDGLILSPP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BRMS1L_ENST00000216807_chr14_36304129_+_ZNF839_ENST00000558850_chr14_102805153_+_1566nt
ATGCCAGTCCATTCCCGAGGGGATAAGAAGGAGACCAACCATCACGATGAGATGGAGGTGGACTACGCCGAAAATGAGGGGAGCAGCTCC
GAGGACGAGGACACTGAGAGCTCGTCGGTCTCCGAGGATGGAGATAGCTCAGAAATGGATGATGAAGACTGTGAAAGAAGAAGAATGGAA
TGTTTGGATGAAATGTCCAATCTTGAAAAACAGTTTACCGATCTCAAAGATCAACTTTATAAAGAACGATTAAGTCAGGTGGATGCAAAA
CTACAAGAAGTCATAGCTGGAAAAGCACCAGAATACTTGGAACCGCTGGCAACTTTACAGGAAAATATGCAAATTCGTACAAAGGTAGCA
GGAATCTATAGAGAGCTCTGCTTAGAATCTGTAAAGAACAAATATGAATGTGAAATTCAAGCTTCTCGCCAGCATTGTGAGGTTGCTGAG
TCATTAGGAATCACAGAATTCCTACGGAAGAAAGAAATACACCCAGACAACCTTGGACCCAAGCACCTCAGCCGAGACATGGATGGGGAG
CAGCTAGAGGGAGCTAGCAGCGAGAAGAGGGAACGTGAGGCTGCGGAGGAGGGACTGGCCTCAGTGAAAAGGCCCAGAAGAGAAGCCCTG
TCCAACGATACCACTGAATCTCTTGCTGCCAACAGCAGAGGCCGGGAGAAGCCCAGGCCCTTGCATGCTTTGGCCGCTGGTTTTTCCCCT
CCAGTAAATGTGACTGTCTCTCCCCGTTCTGAAGAAAGCCATACAACGACGGTTTCTGGTGGCAATGGGAGCGTGTTCCAGGCGGGCCCG
CAGCTTCAGGCACTGGCTAACTTAGAAGCCAGGAGGGGGTCTATAGGTGCTGCTCTCTCATCCCGGGATGTCAGTGGGCTGCCTGTTTAT
GCTCAGTCAGGAGAGCCTAGGAGGCTGACCCAGGCACAGGTGGCAGCGTTTCCTGGAGAGAATGCTTTGGAACACTCTTCAGACCAGGAC
ACCTGGGACAGCCTGAGGAGCCCGGGTTTCTGCAGCCCTTTGTCATCTGGTGGTGGAGCAGAGTCCCTGCCGCCTGGGGGGCCTGGACAT
GCAGAGGCAGGACACCTCGGCAAGGTTTGTGACTTCCACCTGAACCACCAGCAGCCCAGCCCCACCAGCGTCCTGCCTACAGAGGTGGCA
GCCCCTCCGCTTGAGAAAATTTTGTCTGTGGATAGCGTGGCAGTGGACTGTGCCTACAGGACTGTGCCCAAGCCAGGGCCTCAGCCTGGC
CCACATGGATCACTATTGACTGAAGGGTGTCTCAGAAGCCTTTCGGGGGACTTGAACCGGTTCCCCTGTGGGATGGAGGTGCACTCTGGC
CAGAGAGAACTGGAGAGCGTGGTTGCTGTCGGCGAAGCCATGGCTTTTGAAATTTCCAATGGGAGCCATGAGTTACTGTCTCAGGGACAG
AAGCAGATTTTTATTCAGACTTCCGATGGGCTTATCTTGTCCCCTCCAGGTACAATAGTGTCTCAGGAGGAGGACATTGTCACAGTGACT

>In-frame_BRMS1L_ENST00000216807_chr14_36304129_+_ZNF839_ENST00000559185_chr14_102805153_+_1566nt
ATGCCAGTCCATTCCCGAGGGGATAAGAAGGAGACCAACCATCACGATGAGATGGAGGTGGACTACGCCGAAAATGAGGGGAGCAGCTCC
GAGGACGAGGACACTGAGAGCTCGTCGGTCTCCGAGGATGGAGATAGCTCAGAAATGGATGATGAAGACTGTGAAAGAAGAAGAATGGAA
TGTTTGGATGAAATGTCCAATCTTGAAAAACAGTTTACCGATCTCAAAGATCAACTTTATAAAGAACGATTAAGTCAGGTGGATGCAAAA
CTACAAGAAGTCATAGCTGGAAAAGCACCAGAATACTTGGAACCGCTGGCAACTTTACAGGAAAATATGCAAATTCGTACAAAGGTAGCA
GGAATCTATAGAGAGCTCTGCTTAGAATCTGTAAAGAACAAATATGAATGTGAAATTCAAGCTTCTCGCCAGCATTGTGAGGTTGCTGAG
TCATTAGGAATCACAGAATTCCTACGGAAGAAAGAAATACACCCAGACAACCTTGGACCCAAGCACCTCAGCCGAGACATGGATGGGGAG
CAGCTAGAGGGAGCTAGCAGCGAGAAGAGGGAACGTGAGGCTGCGGAGGAGGGACTGGCCTCAGTGAAAAGGCCCAGAAGAGAAGCCCTG
TCCAACGATACCACTGAATCTCTTGCTGCCAACAGCAGAGGCCGGGAGAAGCCCAGGCCCTTGCATGCTTTGGCCGCTGGTTTTTCCCCT
CCAGTAAATGTGACTGTCTCTCCCCGTTCTGAAGAAAGCCATACAACGACGGTTTCTGGTGGCAATGGGAGCGTGTTCCAGGCGGGCCCG
CAGCTTCAGGCACTGGCTAACTTAGAAGCCAGGAGGGGGTCTATAGGTGCTGCTCTCTCATCCCGGGATGTCAGTGGGCTGCCTGTTTAT
GCTCAGTCAGGAGAGCCTAGGAGGCTGACCCAGGCACAGGTGGCAGCGTTTCCTGGAGAGAATGCTTTGGAACACTCTTCAGACCAGGAC
ACCTGGGACAGCCTGAGGAGCCCGGGTTTCTGCAGCCCTTTGTCATCTGGTGGTGGAGCAGAGTCCCTGCCGCCTGGGGGGCCTGGACAT
GCAGAGGCAGGACACCTCGGCAAGGTTTGTGACTTCCACCTGAACCACCAGCAGCCCAGCCCCACCAGCGTCCTGCCTACAGAGGTGGCA
GCCCCTCCGCTTGAGAAAATTTTGTCTGTGGATAGCGTGGCAGTGGACTGTGCCTACAGGACTGTGCCCAAGCCAGGGCCTCAGCCTGGC
CCACATGGATCACTATTGACTGAAGGGTGTCTCAGAAGCCTTTCGGGGGACTTGAACCGGTTCCCCTGTGGGATGGAGGTGCACTCTGGC
CAGAGAGAACTGGAGAGCGTGGTTGCTGTCGGCGAAGCCATGGCTTTTGAAATTTCCAATGGGAGCCATGAGTTACTGTCTCAGGGACAG
AAGCAGATTTTTATTCAGACTTCCGATGGGCTTATCTTGTCCCCTCCAGGTACAATAGTGTCTCAGGAGGAGGACATTGTCACAGTGACT

>In-frame_BRMS1L_ENST00000216807_chr14_36304129_+_ZNF839_ENST00000442396_chr14_102805153_+_1566nt
ATGCCAGTCCATTCCCGAGGGGATAAGAAGGAGACCAACCATCACGATGAGATGGAGGTGGACTACGCCGAAAATGAGGGGAGCAGCTCC
GAGGACGAGGACACTGAGAGCTCGTCGGTCTCCGAGGATGGAGATAGCTCAGAAATGGATGATGAAGACTGTGAAAGAAGAAGAATGGAA
TGTTTGGATGAAATGTCCAATCTTGAAAAACAGTTTACCGATCTCAAAGATCAACTTTATAAAGAACGATTAAGTCAGGTGGATGCAAAA
CTACAAGAAGTCATAGCTGGAAAAGCACCAGAATACTTGGAACCGCTGGCAACTTTACAGGAAAATATGCAAATTCGTACAAAGGTAGCA
GGAATCTATAGAGAGCTCTGCTTAGAATCTGTAAAGAACAAATATGAATGTGAAATTCAAGCTTCTCGCCAGCATTGTGAGGTTGCTGAG
TCATTAGGAATCACAGAATTCCTACGGAAGAAAGAAATACACCCAGACAACCTTGGACCCAAGCACCTCAGCCGAGACATGGATGGGGAG
CAGCTAGAGGGAGCTAGCAGCGAGAAGAGGGAACGTGAGGCTGCGGAGGAGGGACTGGCCTCAGTGAAAAGGCCCAGAAGAGAAGCCCTG
TCCAACGATACCACTGAATCTCTTGCTGCCAACAGCAGAGGCCGGGAGAAGCCCAGGCCCTTGCATGCTTTGGCCGCTGGTTTTTCCCCT
CCAGTAAATGTGACTGTCTCTCCCCGTTCTGAAGAAAGCCATACAACGACGGTTTCTGGTGGCAATGGGAGCGTGTTCCAGGCGGGCCCG
CAGCTTCAGGCACTGGCTAACTTAGAAGCCAGGAGGGGGTCTATAGGTGCTGCTCTCTCATCCCGGGATGTCAGTGGGCTGCCTGTTTAT
GCTCAGTCAGGAGAGCCTAGGAGGCTGACCCAGGCACAGGTGGCAGCGTTTCCTGGAGAGAATGCTTTGGAACACTCTTCAGACCAGGAC
ACCTGGGACAGCCTGAGGAGCCCGGGTTTCTGCAGCCCTTTGTCATCTGGTGGTGGAGCAGAGTCCCTGCCGCCTGGGGGGCCTGGACAT
GCAGAGGCAGGACACCTCGGCAAGGTTTGTGACTTCCACCTGAACCACCAGCAGCCCAGCCCCACCAGCGTCCTGCCTACAGAGGTGGCA
GCCCCTCCGCTTGAGAAAATTTTGTCTGTGGATAGCGTGGCAGTGGACTGTGCCTACAGGACTGTGCCCAAGCCAGGGCCTCAGCCTGGC
CCACATGGATCACTATTGACTGAAGGGTGTCTCAGAAGCCTTTCGGGGGACTTGAACCGGTTCCCCTGTGGGATGGAGGTGCACTCTGGC
CAGAGAGAACTGGAGAGCGTGGTTGCTGTCGGCGAAGCCATGGCTTTTGAAATTTCCAATGGGAGCCATGAGTTACTGTCTCAGGGACAG
AAGCAGATTTTTATTCAGACTTCCGATGGGCTTATCTTGTCCCCTCCAGGTACAATAGTGTCTCAGGAGGAGGACATTGTCACAGTGACT

>In-frame_BRMS1L_ENST00000216807_chr14_36304129_+_ZNF839_ENST00000262236_chr14_102805153_+_1572nt
ATGCCAGTCCATTCCCGAGGGGATAAGAAGGAGACCAACCATCACGATGAGATGGAGGTGGACTACGCCGAAAATGAGGGGAGCAGCTCC
GAGGACGAGGACACTGAGAGCTCGTCGGTCTCCGAGGATGGAGATAGCTCAGAAATGGATGATGAAGACTGTGAAAGAAGAAGAATGGAA
TGTTTGGATGAAATGTCCAATCTTGAAAAACAGTTTACCGATCTCAAAGATCAACTTTATAAAGAACGATTAAGTCAGGTGGATGCAAAA
CTACAAGAAGTCATAGCTGGAAAAGCACCAGAATACTTGGAACCGCTGGCAACTTTACAGGAAAATATGCAAATTCGTACAAAGGTAGCA
GGAATCTATAGAGAGCTCTGCTTAGAATCTGTAAAGAACAAATATGAATGTGAAATTCAAGCTTCTCGCCAGCATTGTGAGGTTGCTGAG
TCATTAGGAATCACAGAATTCCTACGGAAGAAAGAAATACACCCAGACAACCTTGGACCCAAGCACCTCAGCCGAGACATGGATGGGGAG
CAGCTAGAGGGAGCTAGCAGCGAGAAGAGGGAACGTGAGGCTGCGGAGGAGGGACTGGCCTCAGTGAAAAGGCCCAGAAGAGAAGCCCTG
TCCAACGATACCACTGAATCTCTTGCTGCCAACAGCAGAGGCCGGGAGAAGCCCAGGCCCTTGCATGCTTTGGCCGCTGGTGAGGGTTTT
TCCCCTCCAGTAAATGTGACTGTCTCTCCCCGTTCTGAAGAAAGCCATACAACGACGGTTTCTGGTGGCAATGGGAGCGTGTTCCAGGCG
GGCCCGCAGCTTCAGGCACTGGCTAACTTAGAAGCCAGGAGGGGGTCTATAGGTGCTGCTCTCTCATCCCGGGATGTCAGTGGGCTGCCT
GTTTATGCTCAGTCAGGAGAGCCTAGGAGGCTGACCCAGGCACAGGTGGCAGCGTTTCCTGGAGAGAATGCTTTGGAACACTCTTCAGAC
CAGGACACCTGGGACAGCCTGAGGAGCCCGGGTTTCTGCAGCCCTTTGTCATCTGGTGGTGGAGCAGAGTCCCTGCCGCCTGGGGGGCCT
GGACATGCAGAGGCAGGACACCTCGGCAAGGTTTGTGACTTCCACCTGAACCACCAGCAGCCCAGCCCCACCAGCGTCCTGCCTACAGAG
GTGGCAGCCCCTCCGCTTGAGAAAATTTTGTCTGTGGATAGCGTGGCAGTGGACTGTGCCTACAGGACTGTGCCCAAGCCAGGGCCTCAG
CCTGGCCCACATGGATCACTATTGACTGAAGGGTGTCTCAGAAGCCTTTCGGGGGACTTGAACCGGTTCCCCTGTGGGATGGAGGTGCAC
TCTGGCCAGAGAGAACTGGAGAGCGTGGTTGCTGTCGGCGAAGCCATGGCTTTTGAAATTTCCAATGGGAGCCATGAGTTACTGTCTCAG
GGACAGAAGCAGATTTTTATTCAGACTTCCGATGGGCTTATCTTGTCCCCTCCAGGTACAATAGTGTCTCAGGAGGAGGACATTGTCACA

>In-frame_BRMS1L_ENST00000543183_chr14_36304129_+_ZNF839_ENST00000558850_chr14_102805153_+_1422nt
ATGGATGATGAAGACTGTGAAAGAAGAAGAATGGAATGTTTGGATGAAATGTCCAATCTTGAAAAACAGTTTACCGATCTCAAAGATCAA
CTTTATAAAGAACGATTAAGTCAGGTGGATGCAAAACTACAAGAAGTCATAGCTGGAAAAGCACCAGAATACTTGGAACCGCTGGCAACT
TTACAGGAAAATATGCAAATTCGTACAAAGGTAGCAGGAATCTATAGAGAGCTCTGCTTAGAATCTGTAAAGAACAAATATGAATGTGAA
ATTCAAGCTTCTCGCCAGCATTGTGAGGTTGCTGAGTCATTAGGAATCACAGAATTCCTACGGAAGAAAGAAATACACCCAGACAACCTT
GGACCCAAGCACCTCAGCCGAGACATGGATGGGGAGCAGCTAGAGGGAGCTAGCAGCGAGAAGAGGGAACGTGAGGCTGCGGAGGAGGGA
CTGGCCTCAGTGAAAAGGCCCAGAAGAGAAGCCCTGTCCAACGATACCACTGAATCTCTTGCTGCCAACAGCAGAGGCCGGGAGAAGCCC
AGGCCCTTGCATGCTTTGGCCGCTGGTTTTTCCCCTCCAGTAAATGTGACTGTCTCTCCCCGTTCTGAAGAAAGCCATACAACGACGGTT
TCTGGTGGCAATGGGAGCGTGTTCCAGGCGGGCCCGCAGCTTCAGGCACTGGCTAACTTAGAAGCCAGGAGGGGGTCTATAGGTGCTGCT
CTCTCATCCCGGGATGTCAGTGGGCTGCCTGTTTATGCTCAGTCAGGAGAGCCTAGGAGGCTGACCCAGGCACAGGTGGCAGCGTTTCCT
GGAGAGAATGCTTTGGAACACTCTTCAGACCAGGACACCTGGGACAGCCTGAGGAGCCCGGGTTTCTGCAGCCCTTTGTCATCTGGTGGT
GGAGCAGAGTCCCTGCCGCCTGGGGGGCCTGGACATGCAGAGGCAGGACACCTCGGCAAGGTTTGTGACTTCCACCTGAACCACCAGCAG
CCCAGCCCCACCAGCGTCCTGCCTACAGAGGTGGCAGCCCCTCCGCTTGAGAAAATTTTGTCTGTGGATAGCGTGGCAGTGGACTGTGCC
TACAGGACTGTGCCCAAGCCAGGGCCTCAGCCTGGCCCACATGGATCACTATTGACTGAAGGGTGTCTCAGAAGCCTTTCGGGGGACTTG
AACCGGTTCCCCTGTGGGATGGAGGTGCACTCTGGCCAGAGAGAACTGGAGAGCGTGGTTGCTGTCGGCGAAGCCATGGCTTTTGAAATT
TCCAATGGGAGCCATGAGTTACTGTCTCAGGGACAGAAGCAGATTTTTATTCAGACTTCCGATGGGCTTATCTTGTCCCCTCCAGGTACA

>In-frame_BRMS1L_ENST00000543183_chr14_36304129_+_ZNF839_ENST00000559185_chr14_102805153_+_1422nt
ATGGATGATGAAGACTGTGAAAGAAGAAGAATGGAATGTTTGGATGAAATGTCCAATCTTGAAAAACAGTTTACCGATCTCAAAGATCAA
CTTTATAAAGAACGATTAAGTCAGGTGGATGCAAAACTACAAGAAGTCATAGCTGGAAAAGCACCAGAATACTTGGAACCGCTGGCAACT
TTACAGGAAAATATGCAAATTCGTACAAAGGTAGCAGGAATCTATAGAGAGCTCTGCTTAGAATCTGTAAAGAACAAATATGAATGTGAA
ATTCAAGCTTCTCGCCAGCATTGTGAGGTTGCTGAGTCATTAGGAATCACAGAATTCCTACGGAAGAAAGAAATACACCCAGACAACCTT
GGACCCAAGCACCTCAGCCGAGACATGGATGGGGAGCAGCTAGAGGGAGCTAGCAGCGAGAAGAGGGAACGTGAGGCTGCGGAGGAGGGA
CTGGCCTCAGTGAAAAGGCCCAGAAGAGAAGCCCTGTCCAACGATACCACTGAATCTCTTGCTGCCAACAGCAGAGGCCGGGAGAAGCCC
AGGCCCTTGCATGCTTTGGCCGCTGGTTTTTCCCCTCCAGTAAATGTGACTGTCTCTCCCCGTTCTGAAGAAAGCCATACAACGACGGTT
TCTGGTGGCAATGGGAGCGTGTTCCAGGCGGGCCCGCAGCTTCAGGCACTGGCTAACTTAGAAGCCAGGAGGGGGTCTATAGGTGCTGCT
CTCTCATCCCGGGATGTCAGTGGGCTGCCTGTTTATGCTCAGTCAGGAGAGCCTAGGAGGCTGACCCAGGCACAGGTGGCAGCGTTTCCT
GGAGAGAATGCTTTGGAACACTCTTCAGACCAGGACACCTGGGACAGCCTGAGGAGCCCGGGTTTCTGCAGCCCTTTGTCATCTGGTGGT
GGAGCAGAGTCCCTGCCGCCTGGGGGGCCTGGACATGCAGAGGCAGGACACCTCGGCAAGGTTTGTGACTTCCACCTGAACCACCAGCAG
CCCAGCCCCACCAGCGTCCTGCCTACAGAGGTGGCAGCCCCTCCGCTTGAGAAAATTTTGTCTGTGGATAGCGTGGCAGTGGACTGTGCC
TACAGGACTGTGCCCAAGCCAGGGCCTCAGCCTGGCCCACATGGATCACTATTGACTGAAGGGTGTCTCAGAAGCCTTTCGGGGGACTTG
AACCGGTTCCCCTGTGGGATGGAGGTGCACTCTGGCCAGAGAGAACTGGAGAGCGTGGTTGCTGTCGGCGAAGCCATGGCTTTTGAAATT
TCCAATGGGAGCCATGAGTTACTGTCTCAGGGACAGAAGCAGATTTTTATTCAGACTTCCGATGGGCTTATCTTGTCCCCTCCAGGTACA

>In-frame_BRMS1L_ENST00000543183_chr14_36304129_+_ZNF839_ENST00000442396_chr14_102805153_+_1422nt
ATGGATGATGAAGACTGTGAAAGAAGAAGAATGGAATGTTTGGATGAAATGTCCAATCTTGAAAAACAGTTTACCGATCTCAAAGATCAA
CTTTATAAAGAACGATTAAGTCAGGTGGATGCAAAACTACAAGAAGTCATAGCTGGAAAAGCACCAGAATACTTGGAACCGCTGGCAACT
TTACAGGAAAATATGCAAATTCGTACAAAGGTAGCAGGAATCTATAGAGAGCTCTGCTTAGAATCTGTAAAGAACAAATATGAATGTGAA
ATTCAAGCTTCTCGCCAGCATTGTGAGGTTGCTGAGTCATTAGGAATCACAGAATTCCTACGGAAGAAAGAAATACACCCAGACAACCTT
GGACCCAAGCACCTCAGCCGAGACATGGATGGGGAGCAGCTAGAGGGAGCTAGCAGCGAGAAGAGGGAACGTGAGGCTGCGGAGGAGGGA
CTGGCCTCAGTGAAAAGGCCCAGAAGAGAAGCCCTGTCCAACGATACCACTGAATCTCTTGCTGCCAACAGCAGAGGCCGGGAGAAGCCC
AGGCCCTTGCATGCTTTGGCCGCTGGTTTTTCCCCTCCAGTAAATGTGACTGTCTCTCCCCGTTCTGAAGAAAGCCATACAACGACGGTT
TCTGGTGGCAATGGGAGCGTGTTCCAGGCGGGCCCGCAGCTTCAGGCACTGGCTAACTTAGAAGCCAGGAGGGGGTCTATAGGTGCTGCT
CTCTCATCCCGGGATGTCAGTGGGCTGCCTGTTTATGCTCAGTCAGGAGAGCCTAGGAGGCTGACCCAGGCACAGGTGGCAGCGTTTCCT
GGAGAGAATGCTTTGGAACACTCTTCAGACCAGGACACCTGGGACAGCCTGAGGAGCCCGGGTTTCTGCAGCCCTTTGTCATCTGGTGGT
GGAGCAGAGTCCCTGCCGCCTGGGGGGCCTGGACATGCAGAGGCAGGACACCTCGGCAAGGTTTGTGACTTCCACCTGAACCACCAGCAG
CCCAGCCCCACCAGCGTCCTGCCTACAGAGGTGGCAGCCCCTCCGCTTGAGAAAATTTTGTCTGTGGATAGCGTGGCAGTGGACTGTGCC
TACAGGACTGTGCCCAAGCCAGGGCCTCAGCCTGGCCCACATGGATCACTATTGACTGAAGGGTGTCTCAGAAGCCTTTCGGGGGACTTG
AACCGGTTCCCCTGTGGGATGGAGGTGCACTCTGGCCAGAGAGAACTGGAGAGCGTGGTTGCTGTCGGCGAAGCCATGGCTTTTGAAATT
TCCAATGGGAGCCATGAGTTACTGTCTCAGGGACAGAAGCAGATTTTTATTCAGACTTCCGATGGGCTTATCTTGTCCCCTCCAGGTACA

>In-frame_BRMS1L_ENST00000543183_chr14_36304129_+_ZNF839_ENST00000262236_chr14_102805153_+_1428nt
ATGGATGATGAAGACTGTGAAAGAAGAAGAATGGAATGTTTGGATGAAATGTCCAATCTTGAAAAACAGTTTACCGATCTCAAAGATCAA
CTTTATAAAGAACGATTAAGTCAGGTGGATGCAAAACTACAAGAAGTCATAGCTGGAAAAGCACCAGAATACTTGGAACCGCTGGCAACT
TTACAGGAAAATATGCAAATTCGTACAAAGGTAGCAGGAATCTATAGAGAGCTCTGCTTAGAATCTGTAAAGAACAAATATGAATGTGAA
ATTCAAGCTTCTCGCCAGCATTGTGAGGTTGCTGAGTCATTAGGAATCACAGAATTCCTACGGAAGAAAGAAATACACCCAGACAACCTT
GGACCCAAGCACCTCAGCCGAGACATGGATGGGGAGCAGCTAGAGGGAGCTAGCAGCGAGAAGAGGGAACGTGAGGCTGCGGAGGAGGGA
CTGGCCTCAGTGAAAAGGCCCAGAAGAGAAGCCCTGTCCAACGATACCACTGAATCTCTTGCTGCCAACAGCAGAGGCCGGGAGAAGCCC
AGGCCCTTGCATGCTTTGGCCGCTGGTGAGGGTTTTTCCCCTCCAGTAAATGTGACTGTCTCTCCCCGTTCTGAAGAAAGCCATACAACG
ACGGTTTCTGGTGGCAATGGGAGCGTGTTCCAGGCGGGCCCGCAGCTTCAGGCACTGGCTAACTTAGAAGCCAGGAGGGGGTCTATAGGT
GCTGCTCTCTCATCCCGGGATGTCAGTGGGCTGCCTGTTTATGCTCAGTCAGGAGAGCCTAGGAGGCTGACCCAGGCACAGGTGGCAGCG
TTTCCTGGAGAGAATGCTTTGGAACACTCTTCAGACCAGGACACCTGGGACAGCCTGAGGAGCCCGGGTTTCTGCAGCCCTTTGTCATCT
GGTGGTGGAGCAGAGTCCCTGCCGCCTGGGGGGCCTGGACATGCAGAGGCAGGACACCTCGGCAAGGTTTGTGACTTCCACCTGAACCAC
CAGCAGCCCAGCCCCACCAGCGTCCTGCCTACAGAGGTGGCAGCCCCTCCGCTTGAGAAAATTTTGTCTGTGGATAGCGTGGCAGTGGAC
TGTGCCTACAGGACTGTGCCCAAGCCAGGGCCTCAGCCTGGCCCACATGGATCACTATTGACTGAAGGGTGTCTCAGAAGCCTTTCGGGG
GACTTGAACCGGTTCCCCTGTGGGATGGAGGTGCACTCTGGCCAGAGAGAACTGGAGAGCGTGGTTGCTGTCGGCGAAGCCATGGCTTTT
GAAATTTCCAATGGGAGCCATGAGTTACTGTCTCAGGGACAGAAGCAGATTTTTATTCAGACTTCCGATGGGCTTATCTTGTCCCCTCCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_BRMS1L_ENST00000216807_chr14_36304129_+_ZNF839_ENST00000558850_chr14_102805153_+_1950nt
GGAAGGCCTCCGCCAATGGCAGAGCTCCCATCGCAGAGCCTGCGGGTTAGGTTGTGAGGCCCGGGCCGGGGGCGGGGAGGAGCCAAGGGG
GCGAGCAAGCTCGGTGGCTGGGTGGGTTGGGGCGTTCCGCGCGCCCTTCATTGAAGCGGCGGTGGCCGGGCTGGGCGCCGGTAGTGGAAA
GCGACGGCGCGGCTGGAAAATGCCAGTCCATTCCCGAGGGGATAAGAAGGAGACCAACCATCACGATGAGATGGAGGTGGACTACGCCGA
AAATGAGGGGAGCAGCTCCGAGGACGAGGACACTGAGAGCTCGTCGGTCTCCGAGGATGGAGATAGCTCAGAAATGGATGATGAAGACTG
TGAAAGAAGAAGAATGGAATGTTTGGATGAAATGTCCAATCTTGAAAAACAGTTTACCGATCTCAAAGATCAACTTTATAAAGAACGATT
AAGTCAGGTGGATGCAAAACTACAAGAAGTCATAGCTGGAAAAGCACCAGAATACTTGGAACCGCTGGCAACTTTACAGGAAAATATGCA
AATTCGTACAAAGGTAGCAGGAATCTATAGAGAGCTCTGCTTAGAATCTGTAAAGAACAAATATGAATGTGAAATTCAAGCTTCTCGCCA
GCATTGTGAGGTTGCTGAGTCATTAGGAATCACAGAATTCCTACGGAAGAAAGAAATACACCCAGACAACCTTGGACCCAAGCACCTCAG
CCGAGACATGGATGGGGAGCAGCTAGAGGGAGCTAGCAGCGAGAAGAGGGAACGTGAGGCTGCGGAGGAGGGACTGGCCTCAGTGAAAAG
GCCCAGAAGAGAAGCCCTGTCCAACGATACCACTGAATCTCTTGCTGCCAACAGCAGAGGCCGGGAGAAGCCCAGGCCCTTGCATGCTTT
GGCCGCTGGTTTTTCCCCTCCAGTAAATGTGACTGTCTCTCCCCGTTCTGAAGAAAGCCATACAACGACGGTTTCTGGTGGCAATGGGAG
CGTGTTCCAGGCGGGCCCGCAGCTTCAGGCACTGGCTAACTTAGAAGCCAGGAGGGGGTCTATAGGTGCTGCTCTCTCATCCCGGGATGT
CAGTGGGCTGCCTGTTTATGCTCAGTCAGGAGAGCCTAGGAGGCTGACCCAGGCACAGGTGGCAGCGTTTCCTGGAGAGAATGCTTTGGA
ACACTCTTCAGACCAGGACACCTGGGACAGCCTGAGGAGCCCGGGTTTCTGCAGCCCTTTGTCATCTGGTGGTGGAGCAGAGTCCCTGCC
GCCTGGGGGGCCTGGACATGCAGAGGCAGGACACCTCGGCAAGGTTTGTGACTTCCACCTGAACCACCAGCAGCCCAGCCCCACCAGCGT
CCTGCCTACAGAGGTGGCAGCCCCTCCGCTTGAGAAAATTTTGTCTGTGGATAGCGTGGCAGTGGACTGTGCCTACAGGACTGTGCCCAA
GCCAGGGCCTCAGCCTGGCCCACATGGATCACTATTGACTGAAGGGTGTCTCAGAAGCCTTTCGGGGGACTTGAACCGGTTCCCCTGTGG
GATGGAGGTGCACTCTGGCCAGAGAGAACTGGAGAGCGTGGTTGCTGTCGGCGAAGCCATGGCTTTTGAAATTTCCAATGGGAGCCATGA
GTTACTGTCTCAGGGACAGAAGCAGATTTTTATTCAGACTTCCGATGGGCTTATCTTGTCCCCTCCAGGTACAATAGTGTCTCAGGAGGA
GGACATTGTCACAGTGACTGATGCAGAGGGGCGTGCCTGCGGATGGGCCCGCTAGAAGGAGTTCCTCTAGAAGCTGTGGAGTCGGTCGTC
ACCGTGGAGCCAGAGCCCTCACAGTGAAGTGGAGTCAGATCCTAGATTCGTCTGATTTTATCCAGAGAAGGTCTATGGCAAGCAATGTAT

>In-frame_BRMS1L_ENST00000216807_chr14_36304129_+_ZNF839_ENST00000559185_chr14_102805153_+_1953nt
GGAAGGCCTCCGCCAATGGCAGAGCTCCCATCGCAGAGCCTGCGGGTTAGGTTGTGAGGCCCGGGCCGGGGGCGGGGAGGAGCCAAGGGG
GCGAGCAAGCTCGGTGGCTGGGTGGGTTGGGGCGTTCCGCGCGCCCTTCATTGAAGCGGCGGTGGCCGGGCTGGGCGCCGGTAGTGGAAA
GCGACGGCGCGGCTGGAAAATGCCAGTCCATTCCCGAGGGGATAAGAAGGAGACCAACCATCACGATGAGATGGAGGTGGACTACGCCGA
AAATGAGGGGAGCAGCTCCGAGGACGAGGACACTGAGAGCTCGTCGGTCTCCGAGGATGGAGATAGCTCAGAAATGGATGATGAAGACTG
TGAAAGAAGAAGAATGGAATGTTTGGATGAAATGTCCAATCTTGAAAAACAGTTTACCGATCTCAAAGATCAACTTTATAAAGAACGATT
AAGTCAGGTGGATGCAAAACTACAAGAAGTCATAGCTGGAAAAGCACCAGAATACTTGGAACCGCTGGCAACTTTACAGGAAAATATGCA
AATTCGTACAAAGGTAGCAGGAATCTATAGAGAGCTCTGCTTAGAATCTGTAAAGAACAAATATGAATGTGAAATTCAAGCTTCTCGCCA
GCATTGTGAGGTTGCTGAGTCATTAGGAATCACAGAATTCCTACGGAAGAAAGAAATACACCCAGACAACCTTGGACCCAAGCACCTCAG
CCGAGACATGGATGGGGAGCAGCTAGAGGGAGCTAGCAGCGAGAAGAGGGAACGTGAGGCTGCGGAGGAGGGACTGGCCTCAGTGAAAAG
GCCCAGAAGAGAAGCCCTGTCCAACGATACCACTGAATCTCTTGCTGCCAACAGCAGAGGCCGGGAGAAGCCCAGGCCCTTGCATGCTTT
GGCCGCTGGTTTTTCCCCTCCAGTAAATGTGACTGTCTCTCCCCGTTCTGAAGAAAGCCATACAACGACGGTTTCTGGTGGCAATGGGAG
CGTGTTCCAGGCGGGCCCGCAGCTTCAGGCACTGGCTAACTTAGAAGCCAGGAGGGGGTCTATAGGTGCTGCTCTCTCATCCCGGGATGT
CAGTGGGCTGCCTGTTTATGCTCAGTCAGGAGAGCCTAGGAGGCTGACCCAGGCACAGGTGGCAGCGTTTCCTGGAGAGAATGCTTTGGA
ACACTCTTCAGACCAGGACACCTGGGACAGCCTGAGGAGCCCGGGTTTCTGCAGCCCTTTGTCATCTGGTGGTGGAGCAGAGTCCCTGCC
GCCTGGGGGGCCTGGACATGCAGAGGCAGGACACCTCGGCAAGGTTTGTGACTTCCACCTGAACCACCAGCAGCCCAGCCCCACCAGCGT
CCTGCCTACAGAGGTGGCAGCCCCTCCGCTTGAGAAAATTTTGTCTGTGGATAGCGTGGCAGTGGACTGTGCCTACAGGACTGTGCCCAA
GCCAGGGCCTCAGCCTGGCCCACATGGATCACTATTGACTGAAGGGTGTCTCAGAAGCCTTTCGGGGGACTTGAACCGGTTCCCCTGTGG
GATGGAGGTGCACTCTGGCCAGAGAGAACTGGAGAGCGTGGTTGCTGTCGGCGAAGCCATGGCTTTTGAAATTTCCAATGGGAGCCATGA
GTTACTGTCTCAGGGACAGAAGCAGATTTTTATTCAGACTTCCGATGGGCTTATCTTGTCCCCTCCAGGTACAATAGTGTCTCAGGAGGA
GGACATTGTCACAGTGACTGATGCAGAGGGGCGTGCCTGCGGATGGGCCCGCTAGAAGGAGTTCCTCTAGAAGCTGTGGAGTCGGTCGTC
ACCGTGGAGCCAGAGCCCTCACAGTGAAGTGGAGTCAGATCCTAGATTCGTCTGATTTTATCCAGAGAAGGTCTATGGCAAGCAATGTAT

>In-frame_BRMS1L_ENST00000216807_chr14_36304129_+_ZNF839_ENST00000442396_chr14_102805153_+_1953nt
GGAAGGCCTCCGCCAATGGCAGAGCTCCCATCGCAGAGCCTGCGGGTTAGGTTGTGAGGCCCGGGCCGGGGGCGGGGAGGAGCCAAGGGG
GCGAGCAAGCTCGGTGGCTGGGTGGGTTGGGGCGTTCCGCGCGCCCTTCATTGAAGCGGCGGTGGCCGGGCTGGGCGCCGGTAGTGGAAA
GCGACGGCGCGGCTGGAAAATGCCAGTCCATTCCCGAGGGGATAAGAAGGAGACCAACCATCACGATGAGATGGAGGTGGACTACGCCGA
AAATGAGGGGAGCAGCTCCGAGGACGAGGACACTGAGAGCTCGTCGGTCTCCGAGGATGGAGATAGCTCAGAAATGGATGATGAAGACTG
TGAAAGAAGAAGAATGGAATGTTTGGATGAAATGTCCAATCTTGAAAAACAGTTTACCGATCTCAAAGATCAACTTTATAAAGAACGATT
AAGTCAGGTGGATGCAAAACTACAAGAAGTCATAGCTGGAAAAGCACCAGAATACTTGGAACCGCTGGCAACTTTACAGGAAAATATGCA
AATTCGTACAAAGGTAGCAGGAATCTATAGAGAGCTCTGCTTAGAATCTGTAAAGAACAAATATGAATGTGAAATTCAAGCTTCTCGCCA
GCATTGTGAGGTTGCTGAGTCATTAGGAATCACAGAATTCCTACGGAAGAAAGAAATACACCCAGACAACCTTGGACCCAAGCACCTCAG
CCGAGACATGGATGGGGAGCAGCTAGAGGGAGCTAGCAGCGAGAAGAGGGAACGTGAGGCTGCGGAGGAGGGACTGGCCTCAGTGAAAAG
GCCCAGAAGAGAAGCCCTGTCCAACGATACCACTGAATCTCTTGCTGCCAACAGCAGAGGCCGGGAGAAGCCCAGGCCCTTGCATGCTTT
GGCCGCTGGTTTTTCCCCTCCAGTAAATGTGACTGTCTCTCCCCGTTCTGAAGAAAGCCATACAACGACGGTTTCTGGTGGCAATGGGAG
CGTGTTCCAGGCGGGCCCGCAGCTTCAGGCACTGGCTAACTTAGAAGCCAGGAGGGGGTCTATAGGTGCTGCTCTCTCATCCCGGGATGT
CAGTGGGCTGCCTGTTTATGCTCAGTCAGGAGAGCCTAGGAGGCTGACCCAGGCACAGGTGGCAGCGTTTCCTGGAGAGAATGCTTTGGA
ACACTCTTCAGACCAGGACACCTGGGACAGCCTGAGGAGCCCGGGTTTCTGCAGCCCTTTGTCATCTGGTGGTGGAGCAGAGTCCCTGCC
GCCTGGGGGGCCTGGACATGCAGAGGCAGGACACCTCGGCAAGGTTTGTGACTTCCACCTGAACCACCAGCAGCCCAGCCCCACCAGCGT
CCTGCCTACAGAGGTGGCAGCCCCTCCGCTTGAGAAAATTTTGTCTGTGGATAGCGTGGCAGTGGACTGTGCCTACAGGACTGTGCCCAA
GCCAGGGCCTCAGCCTGGCCCACATGGATCACTATTGACTGAAGGGTGTCTCAGAAGCCTTTCGGGGGACTTGAACCGGTTCCCCTGTGG
GATGGAGGTGCACTCTGGCCAGAGAGAACTGGAGAGCGTGGTTGCTGTCGGCGAAGCCATGGCTTTTGAAATTTCCAATGGGAGCCATGA
GTTACTGTCTCAGGGACAGAAGCAGATTTTTATTCAGACTTCCGATGGGCTTATCTTGTCCCCTCCAGGTACAATAGTGTCTCAGGAGGA
GGACATTGTCACAGTGACTGATGCAGAGGGGCGTGCCTGCGGATGGGCCCGCTAGAAGGAGTTCCTCTAGAAGCTGTGGAGTCGGTCGTC
ACCGTGGAGCCAGAGCCCTCACAGTGAAGTGGAGTCAGATCCTAGATTCGTCTGATTTTATCCAGAGAAGGTCTATGGCAAGCAATGTAT

>In-frame_BRMS1L_ENST00000216807_chr14_36304129_+_ZNF839_ENST00000262236_chr14_102805153_+_2299nt
GGAAGGCCTCCGCCAATGGCAGAGCTCCCATCGCAGAGCCTGCGGGTTAGGTTGTGAGGCCCGGGCCGGGGGCGGGGAGGAGCCAAGGGG
GCGAGCAAGCTCGGTGGCTGGGTGGGTTGGGGCGTTCCGCGCGCCCTTCATTGAAGCGGCGGTGGCCGGGCTGGGCGCCGGTAGTGGAAA
GCGACGGCGCGGCTGGAAAATGCCAGTCCATTCCCGAGGGGATAAGAAGGAGACCAACCATCACGATGAGATGGAGGTGGACTACGCCGA
AAATGAGGGGAGCAGCTCCGAGGACGAGGACACTGAGAGCTCGTCGGTCTCCGAGGATGGAGATAGCTCAGAAATGGATGATGAAGACTG
TGAAAGAAGAAGAATGGAATGTTTGGATGAAATGTCCAATCTTGAAAAACAGTTTACCGATCTCAAAGATCAACTTTATAAAGAACGATT
AAGTCAGGTGGATGCAAAACTACAAGAAGTCATAGCTGGAAAAGCACCAGAATACTTGGAACCGCTGGCAACTTTACAGGAAAATATGCA
AATTCGTACAAAGGTAGCAGGAATCTATAGAGAGCTCTGCTTAGAATCTGTAAAGAACAAATATGAATGTGAAATTCAAGCTTCTCGCCA
GCATTGTGAGGTTGCTGAGTCATTAGGAATCACAGAATTCCTACGGAAGAAAGAAATACACCCAGACAACCTTGGACCCAAGCACCTCAG
CCGAGACATGGATGGGGAGCAGCTAGAGGGAGCTAGCAGCGAGAAGAGGGAACGTGAGGCTGCGGAGGAGGGACTGGCCTCAGTGAAAAG
GCCCAGAAGAGAAGCCCTGTCCAACGATACCACTGAATCTCTTGCTGCCAACAGCAGAGGCCGGGAGAAGCCCAGGCCCTTGCATGCTTT
GGCCGCTGGTGAGGGTTTTTCCCCTCCAGTAAATGTGACTGTCTCTCCCCGTTCTGAAGAAAGCCATACAACGACGGTTTCTGGTGGCAA
TGGGAGCGTGTTCCAGGCGGGCCCGCAGCTTCAGGCACTGGCTAACTTAGAAGCCAGGAGGGGGTCTATAGGTGCTGCTCTCTCATCCCG
GGATGTCAGTGGGCTGCCTGTTTATGCTCAGTCAGGAGAGCCTAGGAGGCTGACCCAGGCACAGGTGGCAGCGTTTCCTGGAGAGAATGC
TTTGGAACACTCTTCAGACCAGGACACCTGGGACAGCCTGAGGAGCCCGGGTTTCTGCAGCCCTTTGTCATCTGGTGGTGGAGCAGAGTC
CCTGCCGCCTGGGGGGCCTGGACATGCAGAGGCAGGACACCTCGGCAAGGTTTGTGACTTCCACCTGAACCACCAGCAGCCCAGCCCCAC
CAGCGTCCTGCCTACAGAGGTGGCAGCCCCTCCGCTTGAGAAAATTTTGTCTGTGGATAGCGTGGCAGTGGACTGTGCCTACAGGACTGT
GCCCAAGCCAGGGCCTCAGCCTGGCCCACATGGATCACTATTGACTGAAGGGTGTCTCAGAAGCCTTTCGGGGGACTTGAACCGGTTCCC
CTGTGGGATGGAGGTGCACTCTGGCCAGAGAGAACTGGAGAGCGTGGTTGCTGTCGGCGAAGCCATGGCTTTTGAAATTTCCAATGGGAG
CCATGAGTTACTGTCTCAGGGACAGAAGCAGATTTTTATTCAGACTTCCGATGGGCTTATCTTGTCCCCTCCAGGTACAATAGTGTCTCA
GGAGGAGGACATTGTCACAGTGACTGATGCAGAGGGGCGTGCCTGCGGATGGGCCCGCTAGAAGGAGTTCCTCTAGAAGCTGTGGAGTCG
GTCGTCACCGTGGAGCCAGAGCCCTCACAGTGAAGTGGAGTCAGATCCTAGATTCGTCTGATTTTATCCAGAGAAGGTCTATGGCAAGCA
ATGTATATTTTTCTAATGTGAATATTGCACAGATGAACCTTTTATTTATAAAGAATAATGTCTTTCTGCCCTGCTGTCTACATTTTTCTA
TGGAGCTTGTCATAATAATAGCAGATATTACCTGATCAGGAATCCCTGTGGCGCGTCTGACGCTCATGAGTTTTTCATGATGGTGATGAG
TAGCACTGCACTGTCACCTGATGATTGGCCCTGCTCCGTTTCCCTTCTCTCCTGGGAGATATGCTGCTTTTCCACCAGACTTGCTCCATA
CTAGAAGCTTCTTTTGGGTTCAATTAAAAAGAAAATAAGCTAGTCATTCTGGGCAGCATTTTATTGATAGAAGGGGGAAAAAGTCATTTC

>In-frame_BRMS1L_ENST00000543183_chr14_36304129_+_ZNF839_ENST00000558850_chr14_102805153_+_1940nt
GTTCCGCGCGCCCTTCATTGAAGCGGCGGTGGCCGGGCTGGGCGCCGGTAGTGGAAAGCGACGGCGCGGCTGGAAAATGCCAGTCCATTC
CCGAGGGGATAAGAAGGAGACCAACCATCACGATGAGATGGAGGTGGACTACGCCGAAAATGAGGGGAGCAGCTCCGAGGACGAGGACAC
TGAGAGCTCGTCGGTCTCCGAGGATGGAGATAGCTCAGTTTGACTTTTATTTGATGAAGATCAAGATGCAGATCATTTTGTGCTTCAGTT
ATTTTGATGAATGAATATATGTGATATGAACATAGAAAATGTGGACTATAGGACAGACCTGAAATGGATGATGAAGACTGTGAAAGAAGA
AGAATGGAATGTTTGGATGAAATGTCCAATCTTGAAAAACAGTTTACCGATCTCAAAGATCAACTTTATAAAGAACGATTAAGTCAGGTG
GATGCAAAACTACAAGAAGTCATAGCTGGAAAAGCACCAGAATACTTGGAACCGCTGGCAACTTTACAGGAAAATATGCAAATTCGTACA
AAGGTAGCAGGAATCTATAGAGAGCTCTGCTTAGAATCTGTAAAGAACAAATATGAATGTGAAATTCAAGCTTCTCGCCAGCATTGTGAG
GTTGCTGAGTCATTAGGAATCACAGAATTCCTACGGAAGAAAGAAATACACCCAGACAACCTTGGACCCAAGCACCTCAGCCGAGACATG
GATGGGGAGCAGCTAGAGGGAGCTAGCAGCGAGAAGAGGGAACGTGAGGCTGCGGAGGAGGGACTGGCCTCAGTGAAAAGGCCCAGAAGA
GAAGCCCTGTCCAACGATACCACTGAATCTCTTGCTGCCAACAGCAGAGGCCGGGAGAAGCCCAGGCCCTTGCATGCTTTGGCCGCTGGT
TTTTCCCCTCCAGTAAATGTGACTGTCTCTCCCCGTTCTGAAGAAAGCCATACAACGACGGTTTCTGGTGGCAATGGGAGCGTGTTCCAG
GCGGGCCCGCAGCTTCAGGCACTGGCTAACTTAGAAGCCAGGAGGGGGTCTATAGGTGCTGCTCTCTCATCCCGGGATGTCAGTGGGCTG
CCTGTTTATGCTCAGTCAGGAGAGCCTAGGAGGCTGACCCAGGCACAGGTGGCAGCGTTTCCTGGAGAGAATGCTTTGGAACACTCTTCA
GACCAGGACACCTGGGACAGCCTGAGGAGCCCGGGTTTCTGCAGCCCTTTGTCATCTGGTGGTGGAGCAGAGTCCCTGCCGCCTGGGGGG
CCTGGACATGCAGAGGCAGGACACCTCGGCAAGGTTTGTGACTTCCACCTGAACCACCAGCAGCCCAGCCCCACCAGCGTCCTGCCTACA
GAGGTGGCAGCCCCTCCGCTTGAGAAAATTTTGTCTGTGGATAGCGTGGCAGTGGACTGTGCCTACAGGACTGTGCCCAAGCCAGGGCCT
CAGCCTGGCCCACATGGATCACTATTGACTGAAGGGTGTCTCAGAAGCCTTTCGGGGGACTTGAACCGGTTCCCCTGTGGGATGGAGGTG
CACTCTGGCCAGAGAGAACTGGAGAGCGTGGTTGCTGTCGGCGAAGCCATGGCTTTTGAAATTTCCAATGGGAGCCATGAGTTACTGTCT
CAGGGACAGAAGCAGATTTTTATTCAGACTTCCGATGGGCTTATCTTGTCCCCTCCAGGTACAATAGTGTCTCAGGAGGAGGACATTGTC
ACAGTGACTGATGCAGAGGGGCGTGCCTGCGGATGGGCCCGCTAGAAGGAGTTCCTCTAGAAGCTGTGGAGTCGGTCGTCACCGTGGAGC
CAGAGCCCTCACAGTGAAGTGGAGTCAGATCCTAGATTCGTCTGATTTTATCCAGAGAAGGTCTATGGCAAGCAATGTATATTTTTCTAA

>In-frame_BRMS1L_ENST00000543183_chr14_36304129_+_ZNF839_ENST00000559185_chr14_102805153_+_1943nt
GTTCCGCGCGCCCTTCATTGAAGCGGCGGTGGCCGGGCTGGGCGCCGGTAGTGGAAAGCGACGGCGCGGCTGGAAAATGCCAGTCCATTC
CCGAGGGGATAAGAAGGAGACCAACCATCACGATGAGATGGAGGTGGACTACGCCGAAAATGAGGGGAGCAGCTCCGAGGACGAGGACAC
TGAGAGCTCGTCGGTCTCCGAGGATGGAGATAGCTCAGTTTGACTTTTATTTGATGAAGATCAAGATGCAGATCATTTTGTGCTTCAGTT
ATTTTGATGAATGAATATATGTGATATGAACATAGAAAATGTGGACTATAGGACAGACCTGAAATGGATGATGAAGACTGTGAAAGAAGA
AGAATGGAATGTTTGGATGAAATGTCCAATCTTGAAAAACAGTTTACCGATCTCAAAGATCAACTTTATAAAGAACGATTAAGTCAGGTG
GATGCAAAACTACAAGAAGTCATAGCTGGAAAAGCACCAGAATACTTGGAACCGCTGGCAACTTTACAGGAAAATATGCAAATTCGTACA
AAGGTAGCAGGAATCTATAGAGAGCTCTGCTTAGAATCTGTAAAGAACAAATATGAATGTGAAATTCAAGCTTCTCGCCAGCATTGTGAG
GTTGCTGAGTCATTAGGAATCACAGAATTCCTACGGAAGAAAGAAATACACCCAGACAACCTTGGACCCAAGCACCTCAGCCGAGACATG
GATGGGGAGCAGCTAGAGGGAGCTAGCAGCGAGAAGAGGGAACGTGAGGCTGCGGAGGAGGGACTGGCCTCAGTGAAAAGGCCCAGAAGA
GAAGCCCTGTCCAACGATACCACTGAATCTCTTGCTGCCAACAGCAGAGGCCGGGAGAAGCCCAGGCCCTTGCATGCTTTGGCCGCTGGT
TTTTCCCCTCCAGTAAATGTGACTGTCTCTCCCCGTTCTGAAGAAAGCCATACAACGACGGTTTCTGGTGGCAATGGGAGCGTGTTCCAG
GCGGGCCCGCAGCTTCAGGCACTGGCTAACTTAGAAGCCAGGAGGGGGTCTATAGGTGCTGCTCTCTCATCCCGGGATGTCAGTGGGCTG
CCTGTTTATGCTCAGTCAGGAGAGCCTAGGAGGCTGACCCAGGCACAGGTGGCAGCGTTTCCTGGAGAGAATGCTTTGGAACACTCTTCA
GACCAGGACACCTGGGACAGCCTGAGGAGCCCGGGTTTCTGCAGCCCTTTGTCATCTGGTGGTGGAGCAGAGTCCCTGCCGCCTGGGGGG
CCTGGACATGCAGAGGCAGGACACCTCGGCAAGGTTTGTGACTTCCACCTGAACCACCAGCAGCCCAGCCCCACCAGCGTCCTGCCTACA
GAGGTGGCAGCCCCTCCGCTTGAGAAAATTTTGTCTGTGGATAGCGTGGCAGTGGACTGTGCCTACAGGACTGTGCCCAAGCCAGGGCCT
CAGCCTGGCCCACATGGATCACTATTGACTGAAGGGTGTCTCAGAAGCCTTTCGGGGGACTTGAACCGGTTCCCCTGTGGGATGGAGGTG
CACTCTGGCCAGAGAGAACTGGAGAGCGTGGTTGCTGTCGGCGAAGCCATGGCTTTTGAAATTTCCAATGGGAGCCATGAGTTACTGTCT
CAGGGACAGAAGCAGATTTTTATTCAGACTTCCGATGGGCTTATCTTGTCCCCTCCAGGTACAATAGTGTCTCAGGAGGAGGACATTGTC
ACAGTGACTGATGCAGAGGGGCGTGCCTGCGGATGGGCCCGCTAGAAGGAGTTCCTCTAGAAGCTGTGGAGTCGGTCGTCACCGTGGAGC
CAGAGCCCTCACAGTGAAGTGGAGTCAGATCCTAGATTCGTCTGATTTTATCCAGAGAAGGTCTATGGCAAGCAATGTATATTTTTCTAA

>In-frame_BRMS1L_ENST00000543183_chr14_36304129_+_ZNF839_ENST00000442396_chr14_102805153_+_1943nt
GTTCCGCGCGCCCTTCATTGAAGCGGCGGTGGCCGGGCTGGGCGCCGGTAGTGGAAAGCGACGGCGCGGCTGGAAAATGCCAGTCCATTC
CCGAGGGGATAAGAAGGAGACCAACCATCACGATGAGATGGAGGTGGACTACGCCGAAAATGAGGGGAGCAGCTCCGAGGACGAGGACAC
TGAGAGCTCGTCGGTCTCCGAGGATGGAGATAGCTCAGTTTGACTTTTATTTGATGAAGATCAAGATGCAGATCATTTTGTGCTTCAGTT
ATTTTGATGAATGAATATATGTGATATGAACATAGAAAATGTGGACTATAGGACAGACCTGAAATGGATGATGAAGACTGTGAAAGAAGA
AGAATGGAATGTTTGGATGAAATGTCCAATCTTGAAAAACAGTTTACCGATCTCAAAGATCAACTTTATAAAGAACGATTAAGTCAGGTG
GATGCAAAACTACAAGAAGTCATAGCTGGAAAAGCACCAGAATACTTGGAACCGCTGGCAACTTTACAGGAAAATATGCAAATTCGTACA
AAGGTAGCAGGAATCTATAGAGAGCTCTGCTTAGAATCTGTAAAGAACAAATATGAATGTGAAATTCAAGCTTCTCGCCAGCATTGTGAG
GTTGCTGAGTCATTAGGAATCACAGAATTCCTACGGAAGAAAGAAATACACCCAGACAACCTTGGACCCAAGCACCTCAGCCGAGACATG
GATGGGGAGCAGCTAGAGGGAGCTAGCAGCGAGAAGAGGGAACGTGAGGCTGCGGAGGAGGGACTGGCCTCAGTGAAAAGGCCCAGAAGA
GAAGCCCTGTCCAACGATACCACTGAATCTCTTGCTGCCAACAGCAGAGGCCGGGAGAAGCCCAGGCCCTTGCATGCTTTGGCCGCTGGT
TTTTCCCCTCCAGTAAATGTGACTGTCTCTCCCCGTTCTGAAGAAAGCCATACAACGACGGTTTCTGGTGGCAATGGGAGCGTGTTCCAG
GCGGGCCCGCAGCTTCAGGCACTGGCTAACTTAGAAGCCAGGAGGGGGTCTATAGGTGCTGCTCTCTCATCCCGGGATGTCAGTGGGCTG
CCTGTTTATGCTCAGTCAGGAGAGCCTAGGAGGCTGACCCAGGCACAGGTGGCAGCGTTTCCTGGAGAGAATGCTTTGGAACACTCTTCA
GACCAGGACACCTGGGACAGCCTGAGGAGCCCGGGTTTCTGCAGCCCTTTGTCATCTGGTGGTGGAGCAGAGTCCCTGCCGCCTGGGGGG
CCTGGACATGCAGAGGCAGGACACCTCGGCAAGGTTTGTGACTTCCACCTGAACCACCAGCAGCCCAGCCCCACCAGCGTCCTGCCTACA
GAGGTGGCAGCCCCTCCGCTTGAGAAAATTTTGTCTGTGGATAGCGTGGCAGTGGACTGTGCCTACAGGACTGTGCCCAAGCCAGGGCCT
CAGCCTGGCCCACATGGATCACTATTGACTGAAGGGTGTCTCAGAAGCCTTTCGGGGGACTTGAACCGGTTCCCCTGTGGGATGGAGGTG
CACTCTGGCCAGAGAGAACTGGAGAGCGTGGTTGCTGTCGGCGAAGCCATGGCTTTTGAAATTTCCAATGGGAGCCATGAGTTACTGTCT
CAGGGACAGAAGCAGATTTTTATTCAGACTTCCGATGGGCTTATCTTGTCCCCTCCAGGTACAATAGTGTCTCAGGAGGAGGACATTGTC
ACAGTGACTGATGCAGAGGGGCGTGCCTGCGGATGGGCCCGCTAGAAGGAGTTCCTCTAGAAGCTGTGGAGTCGGTCGTCACCGTGGAGC
CAGAGCCCTCACAGTGAAGTGGAGTCAGATCCTAGATTCGTCTGATTTTATCCAGAGAAGGTCTATGGCAAGCAATGTATATTTTTCTAA

>In-frame_BRMS1L_ENST00000543183_chr14_36304129_+_ZNF839_ENST00000262236_chr14_102805153_+_2289nt
GTTCCGCGCGCCCTTCATTGAAGCGGCGGTGGCCGGGCTGGGCGCCGGTAGTGGAAAGCGACGGCGCGGCTGGAAAATGCCAGTCCATTC
CCGAGGGGATAAGAAGGAGACCAACCATCACGATGAGATGGAGGTGGACTACGCCGAAAATGAGGGGAGCAGCTCCGAGGACGAGGACAC
TGAGAGCTCGTCGGTCTCCGAGGATGGAGATAGCTCAGTTTGACTTTTATTTGATGAAGATCAAGATGCAGATCATTTTGTGCTTCAGTT
ATTTTGATGAATGAATATATGTGATATGAACATAGAAAATGTGGACTATAGGACAGACCTGAAATGGATGATGAAGACTGTGAAAGAAGA
AGAATGGAATGTTTGGATGAAATGTCCAATCTTGAAAAACAGTTTACCGATCTCAAAGATCAACTTTATAAAGAACGATTAAGTCAGGTG
GATGCAAAACTACAAGAAGTCATAGCTGGAAAAGCACCAGAATACTTGGAACCGCTGGCAACTTTACAGGAAAATATGCAAATTCGTACA
AAGGTAGCAGGAATCTATAGAGAGCTCTGCTTAGAATCTGTAAAGAACAAATATGAATGTGAAATTCAAGCTTCTCGCCAGCATTGTGAG
GTTGCTGAGTCATTAGGAATCACAGAATTCCTACGGAAGAAAGAAATACACCCAGACAACCTTGGACCCAAGCACCTCAGCCGAGACATG
GATGGGGAGCAGCTAGAGGGAGCTAGCAGCGAGAAGAGGGAACGTGAGGCTGCGGAGGAGGGACTGGCCTCAGTGAAAAGGCCCAGAAGA
GAAGCCCTGTCCAACGATACCACTGAATCTCTTGCTGCCAACAGCAGAGGCCGGGAGAAGCCCAGGCCCTTGCATGCTTTGGCCGCTGGT
GAGGGTTTTTCCCCTCCAGTAAATGTGACTGTCTCTCCCCGTTCTGAAGAAAGCCATACAACGACGGTTTCTGGTGGCAATGGGAGCGTG
TTCCAGGCGGGCCCGCAGCTTCAGGCACTGGCTAACTTAGAAGCCAGGAGGGGGTCTATAGGTGCTGCTCTCTCATCCCGGGATGTCAGT
GGGCTGCCTGTTTATGCTCAGTCAGGAGAGCCTAGGAGGCTGACCCAGGCACAGGTGGCAGCGTTTCCTGGAGAGAATGCTTTGGAACAC
TCTTCAGACCAGGACACCTGGGACAGCCTGAGGAGCCCGGGTTTCTGCAGCCCTTTGTCATCTGGTGGTGGAGCAGAGTCCCTGCCGCCT
GGGGGGCCTGGACATGCAGAGGCAGGACACCTCGGCAAGGTTTGTGACTTCCACCTGAACCACCAGCAGCCCAGCCCCACCAGCGTCCTG
CCTACAGAGGTGGCAGCCCCTCCGCTTGAGAAAATTTTGTCTGTGGATAGCGTGGCAGTGGACTGTGCCTACAGGACTGTGCCCAAGCCA
GGGCCTCAGCCTGGCCCACATGGATCACTATTGACTGAAGGGTGTCTCAGAAGCCTTTCGGGGGACTTGAACCGGTTCCCCTGTGGGATG
GAGGTGCACTCTGGCCAGAGAGAACTGGAGAGCGTGGTTGCTGTCGGCGAAGCCATGGCTTTTGAAATTTCCAATGGGAGCCATGAGTTA
CTGTCTCAGGGACAGAAGCAGATTTTTATTCAGACTTCCGATGGGCTTATCTTGTCCCCTCCAGGTACAATAGTGTCTCAGGAGGAGGAC
ATTGTCACAGTGACTGATGCAGAGGGGCGTGCCTGCGGATGGGCCCGCTAGAAGGAGTTCCTCTAGAAGCTGTGGAGTCGGTCGTCACCG
TGGAGCCAGAGCCCTCACAGTGAAGTGGAGTCAGATCCTAGATTCGTCTGATTTTATCCAGAGAAGGTCTATGGCAAGCAATGTATATTT
TTCTAATGTGAATATTGCACAGATGAACCTTTTATTTATAAAGAATAATGTCTTTCTGCCCTGCTGTCTACATTTTTCTATGGAGCTTGT
CATAATAATAGCAGATATTACCTGATCAGGAATCCCTGTGGCGCGTCTGACGCTCATGAGTTTTTCATGATGGTGATGAGTAGCACTGCA
CTGTCACCTGATGATTGGCCCTGCTCCGTTTCCCTTCTCTCCTGGGAGATATGCTGCTTTTCCACCAGACTTGCTCCATACTAGAAGCTT
CTTTTGGGTTCAATTAAAAAGAAAATAAGCTAGTCATTCTGGGCAGCATTTTATTGATAGAAGGGGGAAAAAGTCATTTCTACTTGCATG


Top

FusionGenePPI for BRMS1L_ZNF839


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BRMS1LING2, ING1, RBP1, SIN3A, HDAC1, HDAC2, RBBP7, RBBP4, BRMS1, SAP30, ACTN2, EXOC5, MID2, AMOTL2, CCDC67, MXD1, LACC1, FOXK1, FOXK2, GATAD1, FAM60A, ZNF704, MXD3, PHF23, DDX41ZNF839YWHAZ, YWHAE, APP, TP53


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BRMS1L_ZNF839


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for BRMS1L_ZNF839


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource