FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 43846

FusionGeneSummary for ZSCAN25_CUX1

check button Fusion gene summary
Fusion gene informationFusion gene name: ZSCAN25_CUX1
Fusion gene ID: 43846
HgeneTgene
Gene symbol

ZSCAN25

CUX1

Gene ID

221785

1523

Gene namezinc finger and SCAN domain containing 25cut like homeobox 1
SynonymsZNF498CASP|CDP|CDP/Cut|CDP1|COY1|CUTL1|CUX|Clox|Cux/CDP|GOLIM6|Nbla10317|p100|p110|p200|p75
Cytomap

7q22.1

7q22.1

Type of geneprotein-codingprotein-coding
Descriptionzinc finger and SCAN domain-containing protein 25zinc finger protein 498protein CASPCCAAT displacement proteincut homologgolgi integral membrane protein 6homeobox protein cux-1putative protein product of Nbla10317
Modification date2018051920180523
UniProtAcc

Q6NSZ9

Q13948

Ensembl transtripts involved in fusion geneENST00000394152, ENST00000334715, 
ENST00000262941, ENST00000466948, 
ENST00000437600, ENST00000292538, 
ENST00000393824, ENST00000547394, 
ENST00000360264, ENST00000425244, 
ENST00000292535, ENST00000549414, 
ENST00000556210, ENST00000550008, 
ENST00000546411, ENST00000560541, 
Fusion gene scores* DoF score2 X 2 X 1=412 X 13 X 5=780
# samples 214
** MAII scorelog2(2/4*10)=2.32192809488736log2(14/780*10)=-2.47804729680464
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ZSCAN25 [Title/Abstract] AND CUX1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1BC036852ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000394152ENST00000437600ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
In-frameENST00000394152ENST00000292538ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
In-frameENST00000394152ENST00000393824ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
In-frameENST00000394152ENST00000547394ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
5CDS-intronENST00000394152ENST00000360264ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
5CDS-intronENST00000394152ENST00000425244ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
5CDS-intronENST00000394152ENST00000292535ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
5CDS-intronENST00000394152ENST00000549414ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
5CDS-intronENST00000394152ENST00000556210ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
5CDS-intronENST00000394152ENST00000550008ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
5CDS-intronENST00000394152ENST00000546411ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
5CDS-3UTRENST00000394152ENST00000560541ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
In-frameENST00000334715ENST00000437600ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
In-frameENST00000334715ENST00000292538ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
In-frameENST00000334715ENST00000393824ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
In-frameENST00000334715ENST00000547394ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
5CDS-intronENST00000334715ENST00000360264ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
5CDS-intronENST00000334715ENST00000425244ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
5CDS-intronENST00000334715ENST00000292535ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
5CDS-intronENST00000334715ENST00000549414ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
5CDS-intronENST00000334715ENST00000556210ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
5CDS-intronENST00000334715ENST00000550008ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
5CDS-intronENST00000334715ENST00000546411ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
5CDS-3UTRENST00000334715ENST00000560541ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-3CDSENST00000262941ENST00000437600ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-3CDSENST00000262941ENST00000292538ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-3CDSENST00000262941ENST00000393824ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-3CDSENST00000262941ENST00000547394ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-intronENST00000262941ENST00000360264ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-intronENST00000262941ENST00000425244ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-intronENST00000262941ENST00000292535ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-intronENST00000262941ENST00000549414ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-intronENST00000262941ENST00000556210ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-intronENST00000262941ENST00000550008ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-intronENST00000262941ENST00000546411ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-3UTRENST00000262941ENST00000560541ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-3CDSENST00000466948ENST00000437600ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-3CDSENST00000466948ENST00000292538ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-3CDSENST00000466948ENST00000393824ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-3CDSENST00000466948ENST00000547394ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-intronENST00000466948ENST00000360264ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-intronENST00000466948ENST00000425244ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-intronENST00000466948ENST00000292535ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-intronENST00000466948ENST00000549414ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-intronENST00000466948ENST00000556210ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-intronENST00000466948ENST00000550008ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-intronENST00000466948ENST00000546411ZSCAN25chr7

99221804

+CUX1chr7

101916634

+
intron-3UTRENST00000466948ENST00000560541ZSCAN25chr7

99221804

+CUX1chr7

101916634

+

Top

FusionProtFeatures for ZSCAN25_CUX1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZSCAN25

Q6NSZ9

CUX1

Q13948

May be involved in intra-Golgi retrograde transport.{ECO:0000269|PubMed:15718469}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000334715+4542_124268545DomainSCAN box
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000394152+7842_124268545DomainSCAN box
TgeneCUX1chr7:99221804chr7:101916634ENST00000292535+02456_407-131506Coiled coilOntology_term=ECO:0000255
TgeneCUX1chr7:99221804chr7:101916634ENST00000292538+1323502_556418679Coiled coilOntology_term=ECO:0000255
TgeneCUX1chr7:99221804chr7:101916634ENST00000360264+02456_407-71517Coiled coilOntology_term=ECO:0000255
TgeneCUX1chr7:99221804chr7:101916634ENST00000393824+1222502_556379640Coiled coilOntology_term=ECO:0000255
TgeneCUX1chr7:99221804chr7:101916634ENST00000437600+1323502_556416677Coiled coilOntology_term=ECO:0000255
TgeneCUX1chr7:99221804chr7:101916634ENST00000546411+02456_40701404Coiled coilOntology_term=ECO:0000255
TgeneCUX1chr7:99221804chr7:101916634ENST00000547394+1222502_556402663Coiled coilOntology_term=ECO:0000255
TgeneCUX1chr7:99221804chr7:101916634ENST00000549414+02356_40701484Coiled coilOntology_term=ECO:0000255
TgeneCUX1chr7:99221804chr7:101916634ENST00000550008+02256_40701450Coiled coilOntology_term=ECO:0000255
TgeneCUX1chr7:99221804chr7:101916634ENST00000556210+02256_40701348Coiled coilOntology_term=ECO:0000255
TgeneCUX1chr7:99221804chr7:101916634ENST00000292535+0241406_1438-131506Compositional biasNote=Ala-rich
TgeneCUX1chr7:99221804chr7:101916634ENST00000360264+0241406_1438-71517Compositional biasNote=Ala-rich
TgeneCUX1chr7:99221804chr7:101916634ENST00000425244+12221406_1438372633Compositional biasNote=Ala-rich
TgeneCUX1chr7:99221804chr7:101916634ENST00000546411+0241406_143801404Compositional biasNote=Ala-rich
TgeneCUX1chr7:99221804chr7:101916634ENST00000549414+0231406_143801484Compositional biasNote=Ala-rich
TgeneCUX1chr7:99221804chr7:101916634ENST00000550008+0221406_143801450Compositional biasNote=Ala-rich
TgeneCUX1chr7:99221804chr7:101916634ENST00000556210+0221406_143801348Compositional biasNote=Ala-rich
TgeneCUX1chr7:99221804chr7:101916634ENST00000292535+0241117_1204-131506DNA bindingCUT 3
TgeneCUX1chr7:99221804chr7:101916634ENST00000292535+0241244_1303-131506DNA bindingHomeobox
TgeneCUX1chr7:99221804chr7:101916634ENST00000292535+024542_629-131506DNA bindingCUT 1
TgeneCUX1chr7:99221804chr7:101916634ENST00000292535+024934_1021-131506DNA bindingCUT 2
TgeneCUX1chr7:99221804chr7:101916634ENST00000360264+0241117_1204-71517DNA bindingCUT 3
TgeneCUX1chr7:99221804chr7:101916634ENST00000360264+0241244_1303-71517DNA bindingHomeobox
TgeneCUX1chr7:99221804chr7:101916634ENST00000360264+024542_629-71517DNA bindingCUT 1
TgeneCUX1chr7:99221804chr7:101916634ENST00000360264+024934_1021-71517DNA bindingCUT 2
TgeneCUX1chr7:99221804chr7:101916634ENST00000425244+12221117_1204372633DNA bindingCUT 3
TgeneCUX1chr7:99221804chr7:101916634ENST00000425244+12221244_1303372633DNA bindingHomeobox
TgeneCUX1chr7:99221804chr7:101916634ENST00000425244+1222542_629372633DNA bindingCUT 1
TgeneCUX1chr7:99221804chr7:101916634ENST00000425244+1222934_1021372633DNA bindingCUT 2
TgeneCUX1chr7:99221804chr7:101916634ENST00000546411+0241117_120401404DNA bindingCUT 3
TgeneCUX1chr7:99221804chr7:101916634ENST00000546411+0241244_130301404DNA bindingHomeobox
TgeneCUX1chr7:99221804chr7:101916634ENST00000546411+024542_62901404DNA bindingCUT 1
TgeneCUX1chr7:99221804chr7:101916634ENST00000546411+024934_102101404DNA bindingCUT 2
TgeneCUX1chr7:99221804chr7:101916634ENST00000549414+0231117_120401484DNA bindingCUT 3
TgeneCUX1chr7:99221804chr7:101916634ENST00000549414+0231244_130301484DNA bindingHomeobox
TgeneCUX1chr7:99221804chr7:101916634ENST00000549414+023542_62901484DNA bindingCUT 1
TgeneCUX1chr7:99221804chr7:101916634ENST00000549414+023934_102101484DNA bindingCUT 2
TgeneCUX1chr7:99221804chr7:101916634ENST00000550008+0221117_120401450DNA bindingCUT 3
TgeneCUX1chr7:99221804chr7:101916634ENST00000550008+0221244_130301450DNA bindingHomeobox
TgeneCUX1chr7:99221804chr7:101916634ENST00000550008+022542_62901450DNA bindingCUT 1
TgeneCUX1chr7:99221804chr7:101916634ENST00000550008+022934_102101450DNA bindingCUT 2
TgeneCUX1chr7:99221804chr7:101916634ENST00000556210+0221117_120401348DNA bindingCUT 3
TgeneCUX1chr7:99221804chr7:101916634ENST00000556210+0221244_130301348DNA bindingHomeobox
TgeneCUX1chr7:99221804chr7:101916634ENST00000556210+022542_62901348DNA bindingCUT 1
TgeneCUX1chr7:99221804chr7:101916634ENST00000556210+022934_102101348DNA bindingCUT 2
TgeneCUX1chr7:99221804chr7:101916634ENST00000292538+1323641_678418679Topological domainLumenal
TgeneCUX1chr7:99221804chr7:101916634ENST00000393824+1222641_678379640Topological domainLumenal
TgeneCUX1chr7:99221804chr7:101916634ENST00000437600+1323641_678416677Topological domainLumenal
TgeneCUX1chr7:99221804chr7:101916634ENST00000547394+1222641_678402663Topological domainLumenal
TgeneCUX1chr7:99221804chr7:101916634ENST00000292538+1323620_640418679TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneCUX1chr7:99221804chr7:101916634ENST00000393824+1222620_640379640TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneCUX1chr7:99221804chr7:101916634ENST00000437600+1323620_640416677TransmembraneHelical%3B Anchor for type IV membrane protein
TgeneCUX1chr7:99221804chr7:101916634ENST00000547394+1222620_640402663TransmembraneHelical%3B Anchor for type IV membrane protein

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000262941+1342_1240473DomainSCAN box
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000262941+13348_3700473Zinc fingerC2H2-type 1
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000262941+13375_3970473Zinc fingerC2H2-type 2
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000262941+13403_4250473Zinc fingerC2H2-type 3
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000262941+13431_4530473Zinc fingerC2H2-type 4
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000262941+13459_4800473Zinc fingerC2H2-type 5
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000262941+13486_5080473Zinc fingerC2H2-type 6
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000262941+13514_5360473Zinc fingerC2H2-type 7%3B degenerate
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000334715+45348_370268545Zinc fingerC2H2-type 1
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000334715+45375_397268545Zinc fingerC2H2-type 2
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000334715+45403_425268545Zinc fingerC2H2-type 3
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000334715+45431_453268545Zinc fingerC2H2-type 4
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000334715+45459_480268545Zinc fingerC2H2-type 5
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000334715+45486_508268545Zinc fingerC2H2-type 6
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000334715+45514_536268545Zinc fingerC2H2-type 7%3B degenerate
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000394152+78348_370268545Zinc fingerC2H2-type 1
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000394152+78375_397268545Zinc fingerC2H2-type 2
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000394152+78403_425268545Zinc fingerC2H2-type 3
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000394152+78431_453268545Zinc fingerC2H2-type 4
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000394152+78459_480268545Zinc fingerC2H2-type 5
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000394152+78486_508268545Zinc fingerC2H2-type 6
HgeneZSCAN25chr7:99221804chr7:101916634ENST00000394152+78514_536268545Zinc fingerC2H2-type 7%3B degenerate
TgeneCUX1chr7:99221804chr7:101916634ENST00000292538+132367_450418679Coiled coilOntology_term=ECO:0000255
TgeneCUX1chr7:99221804chr7:101916634ENST00000393824+122267_450379640Coiled coilOntology_term=ECO:0000255
TgeneCUX1chr7:99221804chr7:101916634ENST00000425244+122256_407372633Coiled coilOntology_term=ECO:0000255
TgeneCUX1chr7:99221804chr7:101916634ENST00000437600+132367_450416677Coiled coilOntology_term=ECO:0000255
TgeneCUX1chr7:99221804chr7:101916634ENST00000547394+122267_450402663Coiled coilOntology_term=ECO:0000255
TgeneCUX1chr7:99221804chr7:101916634ENST00000292538+13231_619418679Topological domainCytoplasmic
TgeneCUX1chr7:99221804chr7:101916634ENST00000393824+12221_619379640Topological domainCytoplasmic
TgeneCUX1chr7:99221804chr7:101916634ENST00000437600+13231_619416677Topological domainCytoplasmic
TgeneCUX1chr7:99221804chr7:101916634ENST00000547394+12221_619402663Topological domainCytoplasmic


Top

FusionGeneSequence for ZSCAN25_CUX1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZSCAN25_ENST00000334715_chr7_99221804_+_CUX1_ENST00000437600_chr7_101916634_+_529aa
MLKEHPEMAEAPQQQLGIPVVKLEKELPWGRGREDPSPETFRLRFRQFRYQEAAGPQEALRELQELCRRWLRPELHTKEQILELLVLEQF
LTILPREFYAWIREHGPESGKALAAMVEDLTERALEAKAVPCHRQGEQEETALCRGAWEPGIQLGPVEVKPEWGMPPGEGVQGPDPGTEE
QLSQDPGDETRAFQEQALPVLQAGPGLPAVNPRDQEMAAGFFTAGSQGLGPFKDMALAFPEEEWRHVTPAQIDCFGEYVEPQDCRVSPGR
CAELQVRITEAVATATEQRELIARLEQDLSIIQSIQRPDAEGAAEHRLEKIPEPIKEATALFYGPAAPASGALPEGQVDSLLSIISSQRE
RFRARNQELEAENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPW

>In-frame_ZSCAN25_ENST00000334715_chr7_99221804_+_CUX1_ENST00000292538_chr7_101916634_+_529aa
MLKEHPEMAEAPQQQLGIPVVKLEKELPWGRGREDPSPETFRLRFRQFRYQEAAGPQEALRELQELCRRWLRPELHTKEQILELLVLEQF
LTILPREFYAWIREHGPESGKALAAMVEDLTERALEAKAVPCHRQGEQEETALCRGAWEPGIQLGPVEVKPEWGMPPGEGVQGPDPGTEE
QLSQDPGDETRAFQEQALPVLQAGPGLPAVNPRDQEMAAGFFTAGSQGLGPFKDMALAFPEEEWRHVTPAQIDCFGEYVEPQDCRVSPGR
CAELQVRITEAVATATEQRELIARLEQDLSIIQSIQRPDAEGAAEHRLEKIPEPIKEATALFYGPAAPASGALPEGQVDSLLSIISSQRE
RFRARNQELEAENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPW

>In-frame_ZSCAN25_ENST00000334715_chr7_99221804_+_CUX1_ENST00000393824_chr7_101916634_+_529aa
MLKEHPEMAEAPQQQLGIPVVKLEKELPWGRGREDPSPETFRLRFRQFRYQEAAGPQEALRELQELCRRWLRPELHTKEQILELLVLEQF
LTILPREFYAWIREHGPESGKALAAMVEDLTERALEAKAVPCHRQGEQEETALCRGAWEPGIQLGPVEVKPEWGMPPGEGVQGPDPGTEE
QLSQDPGDETRAFQEQALPVLQAGPGLPAVNPRDQEMAAGFFTAGSQGLGPFKDMALAFPEEEWRHVTPAQIDCFGEYVEPQDCRVSPGR
CAELQVRITEAVATATEQRELIARLEQDLSIIQSIQRPDAEGAAEHRLEKIPEPIKEATALFYGPAAPASGALPEGQVDSLLSIISSQRE
RFRARNQELEAENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPW

>In-frame_ZSCAN25_ENST00000334715_chr7_99221804_+_CUX1_ENST00000547394_chr7_101916634_+_529aa
MLKEHPEMAEAPQQQLGIPVVKLEKELPWGRGREDPSPETFRLRFRQFRYQEAAGPQEALRELQELCRRWLRPELHTKEQILELLVLEQF
LTILPREFYAWIREHGPESGKALAAMVEDLTERALEAKAVPCHRQGEQEETALCRGAWEPGIQLGPVEVKPEWGMPPGEGVQGPDPGTEE
QLSQDPGDETRAFQEQALPVLQAGPGLPAVNPRDQEMAAGFFTAGSQGLGPFKDMALAFPEEEWRHVTPAQIDCFGEYVEPQDCRVSPGR
CAELQVRITEAVATATEQRELIARLEQDLSIIQSIQRPDAEGAAEHRLEKIPEPIKEATALFYGPAAPASGALPEGQVDSLLSIISSQRE
RFRARNQELEAENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZSCAN25_ENST00000334715_chr7_99221804_+_CUX1_ENST00000437600_chr7_101916634_+_1587nt
ATGCTTAAAGAGCATCCAGAGATGGCGGAAGCTCCTCAGCAGCAGTTGGGTATTCCTGTGGTGAAACTGGAGAAAGAGTTGCCATGGGGC
AGAGGAAGGGAGGACCCTAGTCCAGAGACTTTTCGGCTGAGGTTTCGGCAGTTCCGCTACCAGGAGGCAGCTGGACCCCAGGAAGCTCTT
AGGGAGCTCCAGGAGCTCTGTCGTCGGTGGCTGAGGCCCGAGTTGCACACCAAGGAGCAGATCCTGGAGCTGCTGGTGCTGGAGCAGTTC
CTCACTATCCTGCCCCGCGAGTTCTACGCCTGGATCCGGGAGCATGGCCCAGAGAGTGGCAAGGCCCTGGCCGCCATGGTGGAGGACCTG
ACAGAAAGAGCACTGGAGGCCAAGGCGGTTCCATGCCACAGGCAGGGAGAGCAGGAGGAAACAGCACTTTGCAGAGGCGCTTGGGAGCCA
GGCATCCAGCTGGGGCCAGTGGAGGTCAAGCCTGAATGGGGGATGCCCCCTGGGGAAGGAGTTCAAGGTCCAGACCCAGGTACCGAGGAG
CAGCTCAGTCAGGACCCTGGAGATGAGACACGGGCCTTCCAGGAGCAAGCACTACCTGTTCTGCAGGCGGGTCCTGGCCTCCCCGCAGTG
AATCCCAGAGACCAAGAGATGGCAGCTGGGTTCTTTACTGCTGGATCGCAGGGGTTGGGGCCATTTAAAGATATGGCCCTGGCCTTCCCT
GAGGAGGAGTGGAGGCATGTGACCCCAGCCCAGATAGACTGCTTTGGGGAGTATGTGGAACCGCAGGACTGCAGGGTCTCTCCAGGACGC
TGTGCAGAGCTGCAAGTCCGTATCACTGAGGCTGTGGCCACAGCCACTGAGCAGAGAGAGCTGATCGCCCGCCTGGAGCAGGACCTGAGC
ATCATTCAGTCCATCCAGCGGCCCGATGCCGAGGGTGCCGCTGAGCACCGCCTGGAGAAGATCCCAGAGCCCATCAAAGAGGCCACTGCC
CTATTCTACGGACCTGCAGCACCAGCCAGCGGTGCCCTCCCAGAGGGCCAGGTGGATTCACTGCTTTCCATCATCTCCAGCCAGAGGGAG
CGCTTCCGTGCCCGGAACCAGGAGCTTGAGGCCGAGAACCGCCTGGCCCAGCACACCCTCCAGGCCCTGCAGAGTGAGCTGGACAGCCTG
CGCGCCGACAACATCAAGCTCTTTGAGAAGATCAAGTTCCTGCAGAGCTACCCTGGCCGGGGCAGCGGCAGTGATGACACGGAGCTGCGG
TACTCGTCCCAGTACGAGGAGCGCCTGGACCCCTTCTCCTCCTTCAGCAAGCGGGAGCGGCAGAGGAAGTACCTGAGCTTGAGTCCCTGG
GACAAGGCCACCCTCAGCATGGGGCGTCTGGTTCTCTCCAACAAGATGGCGCGCACCATCGGCTTCTTCTACACACTGTTCCTGCACTGC
CTGGTCTTCCTGGTGCTCTACAAGCTGGCATGGAGCGAGAGCATGGAGAGGGACTGTGCCACCTTCTGCGCCAAGAAGTTCGCTGACCAC

>In-frame_ZSCAN25_ENST00000334715_chr7_99221804_+_CUX1_ENST00000292538_chr7_101916634_+_1587nt
ATGCTTAAAGAGCATCCAGAGATGGCGGAAGCTCCTCAGCAGCAGTTGGGTATTCCTGTGGTGAAACTGGAGAAAGAGTTGCCATGGGGC
AGAGGAAGGGAGGACCCTAGTCCAGAGACTTTTCGGCTGAGGTTTCGGCAGTTCCGCTACCAGGAGGCAGCTGGACCCCAGGAAGCTCTT
AGGGAGCTCCAGGAGCTCTGTCGTCGGTGGCTGAGGCCCGAGTTGCACACCAAGGAGCAGATCCTGGAGCTGCTGGTGCTGGAGCAGTTC
CTCACTATCCTGCCCCGCGAGTTCTACGCCTGGATCCGGGAGCATGGCCCAGAGAGTGGCAAGGCCCTGGCCGCCATGGTGGAGGACCTG
ACAGAAAGAGCACTGGAGGCCAAGGCGGTTCCATGCCACAGGCAGGGAGAGCAGGAGGAAACAGCACTTTGCAGAGGCGCTTGGGAGCCA
GGCATCCAGCTGGGGCCAGTGGAGGTCAAGCCTGAATGGGGGATGCCCCCTGGGGAAGGAGTTCAAGGTCCAGACCCAGGTACCGAGGAG
CAGCTCAGTCAGGACCCTGGAGATGAGACACGGGCCTTCCAGGAGCAAGCACTACCTGTTCTGCAGGCGGGTCCTGGCCTCCCCGCAGTG
AATCCCAGAGACCAAGAGATGGCAGCTGGGTTCTTTACTGCTGGATCGCAGGGGTTGGGGCCATTTAAAGATATGGCCCTGGCCTTCCCT
GAGGAGGAGTGGAGGCATGTGACCCCAGCCCAGATAGACTGCTTTGGGGAGTATGTGGAACCGCAGGACTGCAGGGTCTCTCCAGGACGC
TGTGCAGAGCTGCAAGTCCGTATCACTGAGGCTGTGGCCACAGCCACTGAGCAGAGAGAGCTGATCGCCCGCCTGGAGCAGGACCTGAGC
ATCATTCAGTCCATCCAGCGGCCCGATGCCGAGGGTGCCGCTGAGCACCGCCTGGAGAAGATCCCAGAGCCCATCAAAGAGGCCACTGCC
CTATTCTACGGACCTGCAGCACCAGCCAGCGGTGCCCTCCCAGAGGGCCAGGTGGATTCACTGCTTTCCATCATCTCCAGCCAGAGGGAG
CGCTTCCGTGCCCGGAACCAGGAGCTTGAGGCCGAGAACCGCCTGGCCCAGCACACCCTCCAGGCCCTGCAGAGTGAGCTGGACAGCCTG
CGCGCCGACAACATCAAGCTCTTTGAGAAGATCAAGTTCCTGCAGAGCTACCCTGGCCGGGGCAGCGGCAGTGATGACACGGAGCTGCGG
TACTCGTCCCAGTACGAGGAGCGCCTGGACCCCTTCTCCTCCTTCAGCAAGCGGGAGCGGCAGAGGAAGTACCTGAGCTTGAGTCCCTGG
GACAAGGCCACCCTCAGCATGGGGCGTCTGGTTCTCTCCAACAAGATGGCGCGCACCATCGGCTTCTTCTACACACTGTTCCTGCACTGC
CTGGTCTTCCTGGTGCTCTACAAGCTGGCATGGAGCGAGAGCATGGAGAGGGACTGTGCCACCTTCTGCGCCAAGAAGTTCGCTGACCAC

>In-frame_ZSCAN25_ENST00000334715_chr7_99221804_+_CUX1_ENST00000393824_chr7_101916634_+_1587nt
ATGCTTAAAGAGCATCCAGAGATGGCGGAAGCTCCTCAGCAGCAGTTGGGTATTCCTGTGGTGAAACTGGAGAAAGAGTTGCCATGGGGC
AGAGGAAGGGAGGACCCTAGTCCAGAGACTTTTCGGCTGAGGTTTCGGCAGTTCCGCTACCAGGAGGCAGCTGGACCCCAGGAAGCTCTT
AGGGAGCTCCAGGAGCTCTGTCGTCGGTGGCTGAGGCCCGAGTTGCACACCAAGGAGCAGATCCTGGAGCTGCTGGTGCTGGAGCAGTTC
CTCACTATCCTGCCCCGCGAGTTCTACGCCTGGATCCGGGAGCATGGCCCAGAGAGTGGCAAGGCCCTGGCCGCCATGGTGGAGGACCTG
ACAGAAAGAGCACTGGAGGCCAAGGCGGTTCCATGCCACAGGCAGGGAGAGCAGGAGGAAACAGCACTTTGCAGAGGCGCTTGGGAGCCA
GGCATCCAGCTGGGGCCAGTGGAGGTCAAGCCTGAATGGGGGATGCCCCCTGGGGAAGGAGTTCAAGGTCCAGACCCAGGTACCGAGGAG
CAGCTCAGTCAGGACCCTGGAGATGAGACACGGGCCTTCCAGGAGCAAGCACTACCTGTTCTGCAGGCGGGTCCTGGCCTCCCCGCAGTG
AATCCCAGAGACCAAGAGATGGCAGCTGGGTTCTTTACTGCTGGATCGCAGGGGTTGGGGCCATTTAAAGATATGGCCCTGGCCTTCCCT
GAGGAGGAGTGGAGGCATGTGACCCCAGCCCAGATAGACTGCTTTGGGGAGTATGTGGAACCGCAGGACTGCAGGGTCTCTCCAGGACGC
TGTGCAGAGCTGCAAGTCCGTATCACTGAGGCTGTGGCCACAGCCACTGAGCAGAGAGAGCTGATCGCCCGCCTGGAGCAGGACCTGAGC
ATCATTCAGTCCATCCAGCGGCCCGATGCCGAGGGTGCCGCTGAGCACCGCCTGGAGAAGATCCCAGAGCCCATCAAAGAGGCCACTGCC
CTATTCTACGGACCTGCAGCACCAGCCAGCGGTGCCCTCCCAGAGGGCCAGGTGGATTCACTGCTTTCCATCATCTCCAGCCAGAGGGAG
CGCTTCCGTGCCCGGAACCAGGAGCTTGAGGCCGAGAACCGCCTGGCCCAGCACACCCTCCAGGCCCTGCAGAGTGAGCTGGACAGCCTG
CGCGCCGACAACATCAAGCTCTTTGAGAAGATCAAGTTCCTGCAGAGCTACCCTGGCCGGGGCAGCGGCAGTGATGACACGGAGCTGCGG
TACTCGTCCCAGTACGAGGAGCGCCTGGACCCCTTCTCCTCCTTCAGCAAGCGGGAGCGGCAGAGGAAGTACCTGAGCTTGAGTCCCTGG
GACAAGGCCACCCTCAGCATGGGGCGTCTGGTTCTCTCCAACAAGATGGCGCGCACCATCGGCTTCTTCTACACACTGTTCCTGCACTGC
CTGGTCTTCCTGGTGCTCTACAAGCTGGCATGGAGCGAGAGCATGGAGAGGGACTGTGCCACCTTCTGCGCCAAGAAGTTCGCTGACCAC

>In-frame_ZSCAN25_ENST00000334715_chr7_99221804_+_CUX1_ENST00000547394_chr7_101916634_+_1587nt
ATGCTTAAAGAGCATCCAGAGATGGCGGAAGCTCCTCAGCAGCAGTTGGGTATTCCTGTGGTGAAACTGGAGAAAGAGTTGCCATGGGGC
AGAGGAAGGGAGGACCCTAGTCCAGAGACTTTTCGGCTGAGGTTTCGGCAGTTCCGCTACCAGGAGGCAGCTGGACCCCAGGAAGCTCTT
AGGGAGCTCCAGGAGCTCTGTCGTCGGTGGCTGAGGCCCGAGTTGCACACCAAGGAGCAGATCCTGGAGCTGCTGGTGCTGGAGCAGTTC
CTCACTATCCTGCCCCGCGAGTTCTACGCCTGGATCCGGGAGCATGGCCCAGAGAGTGGCAAGGCCCTGGCCGCCATGGTGGAGGACCTG
ACAGAAAGAGCACTGGAGGCCAAGGCGGTTCCATGCCACAGGCAGGGAGAGCAGGAGGAAACAGCACTTTGCAGAGGCGCTTGGGAGCCA
GGCATCCAGCTGGGGCCAGTGGAGGTCAAGCCTGAATGGGGGATGCCCCCTGGGGAAGGAGTTCAAGGTCCAGACCCAGGTACCGAGGAG
CAGCTCAGTCAGGACCCTGGAGATGAGACACGGGCCTTCCAGGAGCAAGCACTACCTGTTCTGCAGGCGGGTCCTGGCCTCCCCGCAGTG
AATCCCAGAGACCAAGAGATGGCAGCTGGGTTCTTTACTGCTGGATCGCAGGGGTTGGGGCCATTTAAAGATATGGCCCTGGCCTTCCCT
GAGGAGGAGTGGAGGCATGTGACCCCAGCCCAGATAGACTGCTTTGGGGAGTATGTGGAACCGCAGGACTGCAGGGTCTCTCCAGGACGC
TGTGCAGAGCTGCAAGTCCGTATCACTGAGGCTGTGGCCACAGCCACTGAGCAGAGAGAGCTGATCGCCCGCCTGGAGCAGGACCTGAGC
ATCATTCAGTCCATCCAGCGGCCCGATGCCGAGGGTGCCGCTGAGCACCGCCTGGAGAAGATCCCAGAGCCCATCAAAGAGGCCACTGCC
CTATTCTACGGACCTGCAGCACCAGCCAGCGGTGCCCTCCCAGAGGGCCAGGTGGATTCACTGCTTTCCATCATCTCCAGCCAGAGGGAG
CGCTTCCGTGCCCGGAACCAGGAGCTTGAGGCCGAGAACCGCCTGGCCCAGCACACCCTCCAGGCCCTGCAGAGTGAGCTGGACAGCCTG
CGCGCCGACAACATCAAGCTCTTTGAGAAGATCAAGTTCCTGCAGAGCTACCCTGGCCGGGGCAGCGGCAGTGATGACACGGAGCTGCGG
TACTCGTCCCAGTACGAGGAGCGCCTGGACCCCTTCTCCTCCTTCAGCAAGCGGGAGCGGCAGAGGAAGTACCTGAGCTTGAGTCCCTGG
GACAAGGCCACCCTCAGCATGGGGCGTCTGGTTCTCTCCAACAAGATGGCGCGCACCATCGGCTTCTTCTACACACTGTTCCTGCACTGC
CTGGTCTTCCTGGTGCTCTACAAGCTGGCATGGAGCGAGAGCATGGAGAGGGACTGTGCCACCTTCTGCGCCAAGAAGTTCGCTGACCAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZSCAN25_ENST00000394152_chr7_99221804_+_CUX1_ENST00000437600_chr7_101916634_+_2781nt
AGCTCACTTCCGGACCGCGGATAGCACTGGCGACCCTAGCGGGTGAGAGGCCCTTCAGGGCCGCGGCGGGTTGAGCGCACCATCACATCT
AAGCCATCAGCAAGTTTGTTGGTTTTAATCTCCAAAATACGTCTTGATTTTGTCTGACTCTTTGCCACCACCCTGATCTAAGCCCTTATC
ATCTGCTTGAATCACTAACTTGTCTCCACTTGCAGTTTTTAAAAGAGTTGCTTCCATTTGACTTTTTCTGTCTGCTGTACCAGCATATGA
GTTTCAGGAGGGGTCATTGATGCAGTCATTCTCAGTCTCCTCGGAGGGAGTCTGAAGATGCTTAAAGAGCATCCAGAGATGGCGGAAGCT
CCTCAGCAGCAGTTGGGTATTCCTGTGGTGAAACTGGAGAAAGAGTTGCCATGGGGCAGAGGAAGGGAGGACCCTAGTCCAGAGACTTTT
CGGCTGAGGTTTCGGCAGTTCCGCTACCAGGAGGCAGCTGGACCCCAGGAAGCTCTTAGGGAGCTCCAGGAGCTCTGTCGTCGGTGGCTG
AGGCCCGAGTTGCACACCAAGGAGCAGATCCTGGAGCTGCTGGTGCTGGAGCAGTTCCTCACTATCCTGCCCCGCGAGTTCTACGCCTGG
ATCCGGGAGCATGGCCCAGAGAGTGGCAAGGCCCTGGCCGCCATGGTGGAGGACCTGACAGAAAGAGCACTGGAGGCCAAGGCGGTTCCA
TGCCACAGGCAGGGAGAGCAGGAGGAAACAGCACTTTGCAGAGGCGCTTGGGAGCCAGGCATCCAGCTGGGGCCAGTGGAGGTCAAGCCT
GAATGGGGGATGCCCCCTGGGGAAGGAGTTCAAGGTCCAGACCCAGGTACCGAGGAGCAGCTCAGTCAGGACCCTGGAGATGAGACACGG
GCCTTCCAGGAGCAAGCACTACCTGTTCTGCAGGCGGGTCCTGGCCTCCCCGCAGTGAATCCCAGAGACCAAGAGATGGCAGCTGGGTTC
TTTACTGCTGGATCGCAGGGGTTGGGGCCATTTAAAGATATGGCCCTGGCCTTCCCTGAGGAGGAGTGGAGGCATGTGACCCCAGCCCAG
ATAGACTGCTTTGGGGAGTATGTGGAACCGCAGGACTGCAGGGTCTCTCCAGGACGCTGTGCAGAGCTGCAAGTCCGTATCACTGAGGCT
GTGGCCACAGCCACTGAGCAGAGAGAGCTGATCGCCCGCCTGGAGCAGGACCTGAGCATCATTCAGTCCATCCAGCGGCCCGATGCCGAG
GGTGCCGCTGAGCACCGCCTGGAGAAGATCCCAGAGCCCATCAAAGAGGCCACTGCCCTATTCTACGGACCTGCAGCACCAGCCAGCGGT
GCCCTCCCAGAGGGCCAGGTGGATTCACTGCTTTCCATCATCTCCAGCCAGAGGGAGCGCTTCCGTGCCCGGAACCAGGAGCTTGAGGCC
GAGAACCGCCTGGCCCAGCACACCCTCCAGGCCCTGCAGAGTGAGCTGGACAGCCTGCGCGCCGACAACATCAAGCTCTTTGAGAAGATC
AAGTTCCTGCAGAGCTACCCTGGCCGGGGCAGCGGCAGTGATGACACGGAGCTGCGGTACTCGTCCCAGTACGAGGAGCGCCTGGACCCC
TTCTCCTCCTTCAGCAAGCGGGAGCGGCAGAGGAAGTACCTGAGCTTGAGTCCCTGGGACAAGGCCACCCTCAGCATGGGGCGTCTGGTT
CTCTCCAACAAGATGGCGCGCACCATCGGCTTCTTCTACACACTGTTCCTGCACTGCCTGGTCTTCCTGGTGCTCTACAAGCTGGCATGG
AGCGAGAGCATGGAGAGGGACTGTGCCACCTTCTGCGCCAAGAAGTTCGCTGACCACCTGCACAAGTTCCACGAGAATGACAACGGGGCT
GCGGCTGGTGACTTGTGGCAGTGATACCCCGGGGCCTCCCCCGTGACAGTGACGGCTGCGCCTCCACCCCGACTGCTCAGTGCATCTAAT
CACTTAGACTCCCCTGAAGAATCCCCCATGGAAACTGCCCTTATCCGCTGTCCAGCAGCTGCCAGAGGCCCCAGGTCACCTCGGGTCCCC
TTGAAAGAATGTCTCGGTCACATCAGGCCCGCTAGGTCCAGAGAGCGAGCCCCCAATGCCCGGCCAGGCTAAGCCGCAGAGACCCTCTCA
GCCCCCACCTCAGGTTAGGGCTCTGCCCGCAGCCTGACCTCTAGCCCTGGTGGCAGAGGTCCCTCAGCTGCGAGGCTAATTGGGTGACCA
CCGATTCCAGCTGCGGTTAATCCAGCTTGGGCCTGTCTGCACTGCGATCCTCTTGGGCTCTCCTAGGATCCCCCCATGCCCCGTAAGAGG
TGGAAGACGCTTCCTTCCAGGACAGCAGGCTTTGAGTCCAGCACCCCCAGCCTGCCTTTGCCACCAGCCCCACCCTGCAGAGTATATGAG
GCTTGACAGAGTCTGCCCCCTCCCCCACTGCACCCCAAGAGAGAGAGCCCCAGCCAGCGGAACAGTTTCTATTACCCCCTCCCTGCCCCC
AGACCCATGTGATTTCTGCTTTCTTCTTTAGCAAGATATTCTGGTTTCTAGATAAGGAAGAGTCTCTAATGAGCCCCCGAGCCCCAGTCT
CTTCAGACTCATGGATTGGTCTGAGGGGTCTGAACGTCTCCTAGCCAATCAGAACTGGCTGTGGACCACCCTAGCACGGCCACCTCTCAG

>In-frame_ZSCAN25_ENST00000394152_chr7_99221804_+_CUX1_ENST00000292538_chr7_101916634_+_2781nt
AGCTCACTTCCGGACCGCGGATAGCACTGGCGACCCTAGCGGGTGAGAGGCCCTTCAGGGCCGCGGCGGGTTGAGCGCACCATCACATCT
AAGCCATCAGCAAGTTTGTTGGTTTTAATCTCCAAAATACGTCTTGATTTTGTCTGACTCTTTGCCACCACCCTGATCTAAGCCCTTATC
ATCTGCTTGAATCACTAACTTGTCTCCACTTGCAGTTTTTAAAAGAGTTGCTTCCATTTGACTTTTTCTGTCTGCTGTACCAGCATATGA
GTTTCAGGAGGGGTCATTGATGCAGTCATTCTCAGTCTCCTCGGAGGGAGTCTGAAGATGCTTAAAGAGCATCCAGAGATGGCGGAAGCT
CCTCAGCAGCAGTTGGGTATTCCTGTGGTGAAACTGGAGAAAGAGTTGCCATGGGGCAGAGGAAGGGAGGACCCTAGTCCAGAGACTTTT
CGGCTGAGGTTTCGGCAGTTCCGCTACCAGGAGGCAGCTGGACCCCAGGAAGCTCTTAGGGAGCTCCAGGAGCTCTGTCGTCGGTGGCTG
AGGCCCGAGTTGCACACCAAGGAGCAGATCCTGGAGCTGCTGGTGCTGGAGCAGTTCCTCACTATCCTGCCCCGCGAGTTCTACGCCTGG
ATCCGGGAGCATGGCCCAGAGAGTGGCAAGGCCCTGGCCGCCATGGTGGAGGACCTGACAGAAAGAGCACTGGAGGCCAAGGCGGTTCCA
TGCCACAGGCAGGGAGAGCAGGAGGAAACAGCACTTTGCAGAGGCGCTTGGGAGCCAGGCATCCAGCTGGGGCCAGTGGAGGTCAAGCCT
GAATGGGGGATGCCCCCTGGGGAAGGAGTTCAAGGTCCAGACCCAGGTACCGAGGAGCAGCTCAGTCAGGACCCTGGAGATGAGACACGG
GCCTTCCAGGAGCAAGCACTACCTGTTCTGCAGGCGGGTCCTGGCCTCCCCGCAGTGAATCCCAGAGACCAAGAGATGGCAGCTGGGTTC
TTTACTGCTGGATCGCAGGGGTTGGGGCCATTTAAAGATATGGCCCTGGCCTTCCCTGAGGAGGAGTGGAGGCATGTGACCCCAGCCCAG
ATAGACTGCTTTGGGGAGTATGTGGAACCGCAGGACTGCAGGGTCTCTCCAGGACGCTGTGCAGAGCTGCAAGTCCGTATCACTGAGGCT
GTGGCCACAGCCACTGAGCAGAGAGAGCTGATCGCCCGCCTGGAGCAGGACCTGAGCATCATTCAGTCCATCCAGCGGCCCGATGCCGAG
GGTGCCGCTGAGCACCGCCTGGAGAAGATCCCAGAGCCCATCAAAGAGGCCACTGCCCTATTCTACGGACCTGCAGCACCAGCCAGCGGT
GCCCTCCCAGAGGGCCAGGTGGATTCACTGCTTTCCATCATCTCCAGCCAGAGGGAGCGCTTCCGTGCCCGGAACCAGGAGCTTGAGGCC
GAGAACCGCCTGGCCCAGCACACCCTCCAGGCCCTGCAGAGTGAGCTGGACAGCCTGCGCGCCGACAACATCAAGCTCTTTGAGAAGATC
AAGTTCCTGCAGAGCTACCCTGGCCGGGGCAGCGGCAGTGATGACACGGAGCTGCGGTACTCGTCCCAGTACGAGGAGCGCCTGGACCCC
TTCTCCTCCTTCAGCAAGCGGGAGCGGCAGAGGAAGTACCTGAGCTTGAGTCCCTGGGACAAGGCCACCCTCAGCATGGGGCGTCTGGTT
CTCTCCAACAAGATGGCGCGCACCATCGGCTTCTTCTACACACTGTTCCTGCACTGCCTGGTCTTCCTGGTGCTCTACAAGCTGGCATGG
AGCGAGAGCATGGAGAGGGACTGTGCCACCTTCTGCGCCAAGAAGTTCGCTGACCACCTGCACAAGTTCCACGAGAATGACAACGGGGCT
GCGGCTGGTGACTTGTGGCAGTGATACCCCGGGGCCTCCCCCGTGACAGTGACGGCTGCGCCTCCACCCCGACTGCTCAGTGCATCTAAT
CACTTAGACTCCCCTGAAGAATCCCCCATGGAAACTGCCCTTATCCGCTGTCCAGCAGCTGCCAGAGGCCCCAGGTCACCTCGGGTCCCC
TTGAAAGAATGTCTCGGTCACATCAGGCCCGCTAGGTCCAGAGAGCGAGCCCCCAATGCCCGGCCAGGCTAAGCCGCAGAGACCCTCTCA
GCCCCCACCTCAGGTTAGGGCTCTGCCCGCAGCCTGACCTCTAGCCCTGGTGGCAGAGGTCCCTCAGCTGCGAGGCTAATTGGGTGACCA
CCGATTCCAGCTGCGGTTAATCCAGCTTGGGCCTGTCTGCACTGCGATCCTCTTGGGCTCTCCTAGGATCCCCCCATGCCCCGTAAGAGG
TGGAAGACGCTTCCTTCCAGGACAGCAGGCTTTGAGTCCAGCACCCCCAGCCTGCCTTTGCCACCAGCCCCACCCTGCAGAGTATATGAG
GCTTGACAGAGTCTGCCCCCTCCCCCACTGCACCCCAAGAGAGAGAGCCCCAGCCAGCGGAACAGTTTCTATTACCCCCTCCCTGCCCCC
AGACCCATGTGATTTCTGCTTTCTTCTTTAGCAAGATATTCTGGTTTCTAGATAAGGAAGAGTCTCTAATGAGCCCCCGAGCCCCAGTCT
CTTCAGACTCATGGATTGGTCTGAGGGGTCTGAACGTCTCCTAGCCAATCAGAACTGGCTGTGGACCACCCTAGCACGGCCACCTCTCAG

>In-frame_ZSCAN25_ENST00000394152_chr7_99221804_+_CUX1_ENST00000393824_chr7_101916634_+_2302nt
AGCTCACTTCCGGACCGCGGATAGCACTGGCGACCCTAGCGGGTGAGAGGCCCTTCAGGGCCGCGGCGGGTTGAGCGCACCATCACATCT
AAGCCATCAGCAAGTTTGTTGGTTTTAATCTCCAAAATACGTCTTGATTTTGTCTGACTCTTTGCCACCACCCTGATCTAAGCCCTTATC
ATCTGCTTGAATCACTAACTTGTCTCCACTTGCAGTTTTTAAAAGAGTTGCTTCCATTTGACTTTTTCTGTCTGCTGTACCAGCATATGA
GTTTCAGGAGGGGTCATTGATGCAGTCATTCTCAGTCTCCTCGGAGGGAGTCTGAAGATGCTTAAAGAGCATCCAGAGATGGCGGAAGCT
CCTCAGCAGCAGTTGGGTATTCCTGTGGTGAAACTGGAGAAAGAGTTGCCATGGGGCAGAGGAAGGGAGGACCCTAGTCCAGAGACTTTT
CGGCTGAGGTTTCGGCAGTTCCGCTACCAGGAGGCAGCTGGACCCCAGGAAGCTCTTAGGGAGCTCCAGGAGCTCTGTCGTCGGTGGCTG
AGGCCCGAGTTGCACACCAAGGAGCAGATCCTGGAGCTGCTGGTGCTGGAGCAGTTCCTCACTATCCTGCCCCGCGAGTTCTACGCCTGG
ATCCGGGAGCATGGCCCAGAGAGTGGCAAGGCCCTGGCCGCCATGGTGGAGGACCTGACAGAAAGAGCACTGGAGGCCAAGGCGGTTCCA
TGCCACAGGCAGGGAGAGCAGGAGGAAACAGCACTTTGCAGAGGCGCTTGGGAGCCAGGCATCCAGCTGGGGCCAGTGGAGGTCAAGCCT
GAATGGGGGATGCCCCCTGGGGAAGGAGTTCAAGGTCCAGACCCAGGTACCGAGGAGCAGCTCAGTCAGGACCCTGGAGATGAGACACGG
GCCTTCCAGGAGCAAGCACTACCTGTTCTGCAGGCGGGTCCTGGCCTCCCCGCAGTGAATCCCAGAGACCAAGAGATGGCAGCTGGGTTC
TTTACTGCTGGATCGCAGGGGTTGGGGCCATTTAAAGATATGGCCCTGGCCTTCCCTGAGGAGGAGTGGAGGCATGTGACCCCAGCCCAG
ATAGACTGCTTTGGGGAGTATGTGGAACCGCAGGACTGCAGGGTCTCTCCAGGACGCTGTGCAGAGCTGCAAGTCCGTATCACTGAGGCT
GTGGCCACAGCCACTGAGCAGAGAGAGCTGATCGCCCGCCTGGAGCAGGACCTGAGCATCATTCAGTCCATCCAGCGGCCCGATGCCGAG
GGTGCCGCTGAGCACCGCCTGGAGAAGATCCCAGAGCCCATCAAAGAGGCCACTGCCCTATTCTACGGACCTGCAGCACCAGCCAGCGGT
GCCCTCCCAGAGGGCCAGGTGGATTCACTGCTTTCCATCATCTCCAGCCAGAGGGAGCGCTTCCGTGCCCGGAACCAGGAGCTTGAGGCC
GAGAACCGCCTGGCCCAGCACACCCTCCAGGCCCTGCAGAGTGAGCTGGACAGCCTGCGCGCCGACAACATCAAGCTCTTTGAGAAGATC
AAGTTCCTGCAGAGCTACCCTGGCCGGGGCAGCGGCAGTGATGACACGGAGCTGCGGTACTCGTCCCAGTACGAGGAGCGCCTGGACCCC
TTCTCCTCCTTCAGCAAGCGGGAGCGGCAGAGGAAGTACCTGAGCTTGAGTCCCTGGGACAAGGCCACCCTCAGCATGGGGCGTCTGGTT
CTCTCCAACAAGATGGCGCGCACCATCGGCTTCTTCTACACACTGTTCCTGCACTGCCTGGTCTTCCTGGTGCTCTACAAGCTGGCATGG
AGCGAGAGCATGGAGAGGGACTGTGCCACCTTCTGCGCCAAGAAGTTCGCTGACCACCTGCACAAGTTCCACGAGAATGACAACGGGGCT
GCGGCTGGTGACTTGTGGCAGTGATACCCCGGGGCCTCCCCCGTGACAGTGACGGCTGCGCCTCCACCCCGACTGCTCAGTGCATCTAAT
CACTTAGACTCCCCTGAAGAATCCCCCATGGAAACTGCCCTTATCCGCTGTCCAGCAGCTGCCAGAGGCCCCAGGTCACCTCGGGTCCCC
TTGAAAGAATGTCTCGGTCACATCAGGCCCGCTAGGTCCAGAGAGCGAGCCCCCAATGCCCGGCCAGGCTAAGCCGCAGAGACCCTCTCA
GCCCCCACCTCAGGTTAGGGCTCTGCCCGCAGCCTGACCTCTAGCCCTGGTGGCAGAGGTCCCTCAGCTGCGAGGCTAATTGGGTGACCA

>In-frame_ZSCAN25_ENST00000394152_chr7_99221804_+_CUX1_ENST00000547394_chr7_101916634_+_2781nt
AGCTCACTTCCGGACCGCGGATAGCACTGGCGACCCTAGCGGGTGAGAGGCCCTTCAGGGCCGCGGCGGGTTGAGCGCACCATCACATCT
AAGCCATCAGCAAGTTTGTTGGTTTTAATCTCCAAAATACGTCTTGATTTTGTCTGACTCTTTGCCACCACCCTGATCTAAGCCCTTATC
ATCTGCTTGAATCACTAACTTGTCTCCACTTGCAGTTTTTAAAAGAGTTGCTTCCATTTGACTTTTTCTGTCTGCTGTACCAGCATATGA
GTTTCAGGAGGGGTCATTGATGCAGTCATTCTCAGTCTCCTCGGAGGGAGTCTGAAGATGCTTAAAGAGCATCCAGAGATGGCGGAAGCT
CCTCAGCAGCAGTTGGGTATTCCTGTGGTGAAACTGGAGAAAGAGTTGCCATGGGGCAGAGGAAGGGAGGACCCTAGTCCAGAGACTTTT
CGGCTGAGGTTTCGGCAGTTCCGCTACCAGGAGGCAGCTGGACCCCAGGAAGCTCTTAGGGAGCTCCAGGAGCTCTGTCGTCGGTGGCTG
AGGCCCGAGTTGCACACCAAGGAGCAGATCCTGGAGCTGCTGGTGCTGGAGCAGTTCCTCACTATCCTGCCCCGCGAGTTCTACGCCTGG
ATCCGGGAGCATGGCCCAGAGAGTGGCAAGGCCCTGGCCGCCATGGTGGAGGACCTGACAGAAAGAGCACTGGAGGCCAAGGCGGTTCCA
TGCCACAGGCAGGGAGAGCAGGAGGAAACAGCACTTTGCAGAGGCGCTTGGGAGCCAGGCATCCAGCTGGGGCCAGTGGAGGTCAAGCCT
GAATGGGGGATGCCCCCTGGGGAAGGAGTTCAAGGTCCAGACCCAGGTACCGAGGAGCAGCTCAGTCAGGACCCTGGAGATGAGACACGG
GCCTTCCAGGAGCAAGCACTACCTGTTCTGCAGGCGGGTCCTGGCCTCCCCGCAGTGAATCCCAGAGACCAAGAGATGGCAGCTGGGTTC
TTTACTGCTGGATCGCAGGGGTTGGGGCCATTTAAAGATATGGCCCTGGCCTTCCCTGAGGAGGAGTGGAGGCATGTGACCCCAGCCCAG
ATAGACTGCTTTGGGGAGTATGTGGAACCGCAGGACTGCAGGGTCTCTCCAGGACGCTGTGCAGAGCTGCAAGTCCGTATCACTGAGGCT
GTGGCCACAGCCACTGAGCAGAGAGAGCTGATCGCCCGCCTGGAGCAGGACCTGAGCATCATTCAGTCCATCCAGCGGCCCGATGCCGAG
GGTGCCGCTGAGCACCGCCTGGAGAAGATCCCAGAGCCCATCAAAGAGGCCACTGCCCTATTCTACGGACCTGCAGCACCAGCCAGCGGT
GCCCTCCCAGAGGGCCAGGTGGATTCACTGCTTTCCATCATCTCCAGCCAGAGGGAGCGCTTCCGTGCCCGGAACCAGGAGCTTGAGGCC
GAGAACCGCCTGGCCCAGCACACCCTCCAGGCCCTGCAGAGTGAGCTGGACAGCCTGCGCGCCGACAACATCAAGCTCTTTGAGAAGATC
AAGTTCCTGCAGAGCTACCCTGGCCGGGGCAGCGGCAGTGATGACACGGAGCTGCGGTACTCGTCCCAGTACGAGGAGCGCCTGGACCCC
TTCTCCTCCTTCAGCAAGCGGGAGCGGCAGAGGAAGTACCTGAGCTTGAGTCCCTGGGACAAGGCCACCCTCAGCATGGGGCGTCTGGTT
CTCTCCAACAAGATGGCGCGCACCATCGGCTTCTTCTACACACTGTTCCTGCACTGCCTGGTCTTCCTGGTGCTCTACAAGCTGGCATGG
AGCGAGAGCATGGAGAGGGACTGTGCCACCTTCTGCGCCAAGAAGTTCGCTGACCACCTGCACAAGTTCCACGAGAATGACAACGGGGCT
GCGGCTGGTGACTTGTGGCAGTGATACCCCGGGGCCTCCCCCGTGACAGTGACGGCTGCGCCTCCACCCCGACTGCTCAGTGCATCTAAT
CACTTAGACTCCCCTGAAGAATCCCCCATGGAAACTGCCCTTATCCGCTGTCCAGCAGCTGCCAGAGGCCCCAGGTCACCTCGGGTCCCC
TTGAAAGAATGTCTCGGTCACATCAGGCCCGCTAGGTCCAGAGAGCGAGCCCCCAATGCCCGGCCAGGCTAAGCCGCAGAGACCCTCTCA
GCCCCCACCTCAGGTTAGGGCTCTGCCCGCAGCCTGACCTCTAGCCCTGGTGGCAGAGGTCCCTCAGCTGCGAGGCTAATTGGGTGACCA
CCGATTCCAGCTGCGGTTAATCCAGCTTGGGCCTGTCTGCACTGCGATCCTCTTGGGCTCTCCTAGGATCCCCCCATGCCCCGTAAGAGG
TGGAAGACGCTTCCTTCCAGGACAGCAGGCTTTGAGTCCAGCACCCCCAGCCTGCCTTTGCCACCAGCCCCACCCTGCAGAGTATATGAG
GCTTGACAGAGTCTGCCCCCTCCCCCACTGCACCCCAAGAGAGAGAGCCCCAGCCAGCGGAACAGTTTCTATTACCCCCTCCCTGCCCCC
AGACCCATGTGATTTCTGCTTTCTTCTTTAGCAAGATATTCTGGTTTCTAGATAAGGAAGAGTCTCTAATGAGCCCCCGAGCCCCAGTCT
CTTCAGACTCATGGATTGGTCTGAGGGGTCTGAACGTCTCCTAGCCAATCAGAACTGGCTGTGGACCACCCTAGCACGGCCACCTCTCAG

>In-frame_ZSCAN25_ENST00000334715_chr7_99221804_+_CUX1_ENST00000437600_chr7_101916634_+_2511nt
GTTCTCAAAAGGGTCATTGATGCAGTCATTCTCAGTCTCCTCGGAGGGAGTCTGAAGATGCTTAAAGAGCATCCAGAGATGGCGGAAGCT
CCTCAGCAGCAGTTGGGTATTCCTGTGGTGAAACTGGAGAAAGAGTTGCCATGGGGCAGAGGAAGGGAGGACCCTAGTCCAGAGACTTTT
CGGCTGAGGTTTCGGCAGTTCCGCTACCAGGAGGCAGCTGGACCCCAGGAAGCTCTTAGGGAGCTCCAGGAGCTCTGTCGTCGGTGGCTG
AGGCCCGAGTTGCACACCAAGGAGCAGATCCTGGAGCTGCTGGTGCTGGAGCAGTTCCTCACTATCCTGCCCCGCGAGTTCTACGCCTGG
ATCCGGGAGCATGGCCCAGAGAGTGGCAAGGCCCTGGCCGCCATGGTGGAGGACCTGACAGAAAGAGCACTGGAGGCCAAGGCGGTTCCA
TGCCACAGGCAGGGAGAGCAGGAGGAAACAGCACTTTGCAGAGGCGCTTGGGAGCCAGGCATCCAGCTGGGGCCAGTGGAGGTCAAGCCT
GAATGGGGGATGCCCCCTGGGGAAGGAGTTCAAGGTCCAGACCCAGGTACCGAGGAGCAGCTCAGTCAGGACCCTGGAGATGAGACACGG
GCCTTCCAGGAGCAAGCACTACCTGTTCTGCAGGCGGGTCCTGGCCTCCCCGCAGTGAATCCCAGAGACCAAGAGATGGCAGCTGGGTTC
TTTACTGCTGGATCGCAGGGGTTGGGGCCATTTAAAGATATGGCCCTGGCCTTCCCTGAGGAGGAGTGGAGGCATGTGACCCCAGCCCAG
ATAGACTGCTTTGGGGAGTATGTGGAACCGCAGGACTGCAGGGTCTCTCCAGGACGCTGTGCAGAGCTGCAAGTCCGTATCACTGAGGCT
GTGGCCACAGCCACTGAGCAGAGAGAGCTGATCGCCCGCCTGGAGCAGGACCTGAGCATCATTCAGTCCATCCAGCGGCCCGATGCCGAG
GGTGCCGCTGAGCACCGCCTGGAGAAGATCCCAGAGCCCATCAAAGAGGCCACTGCCCTATTCTACGGACCTGCAGCACCAGCCAGCGGT
GCCCTCCCAGAGGGCCAGGTGGATTCACTGCTTTCCATCATCTCCAGCCAGAGGGAGCGCTTCCGTGCCCGGAACCAGGAGCTTGAGGCC
GAGAACCGCCTGGCCCAGCACACCCTCCAGGCCCTGCAGAGTGAGCTGGACAGCCTGCGCGCCGACAACATCAAGCTCTTTGAGAAGATC
AAGTTCCTGCAGAGCTACCCTGGCCGGGGCAGCGGCAGTGATGACACGGAGCTGCGGTACTCGTCCCAGTACGAGGAGCGCCTGGACCCC
TTCTCCTCCTTCAGCAAGCGGGAGCGGCAGAGGAAGTACCTGAGCTTGAGTCCCTGGGACAAGGCCACCCTCAGCATGGGGCGTCTGGTT
CTCTCCAACAAGATGGCGCGCACCATCGGCTTCTTCTACACACTGTTCCTGCACTGCCTGGTCTTCCTGGTGCTCTACAAGCTGGCATGG
AGCGAGAGCATGGAGAGGGACTGTGCCACCTTCTGCGCCAAGAAGTTCGCTGACCACCTGCACAAGTTCCACGAGAATGACAACGGGGCT
GCGGCTGGTGACTTGTGGCAGTGATACCCCGGGGCCTCCCCCGTGACAGTGACGGCTGCGCCTCCACCCCGACTGCTCAGTGCATCTAAT
CACTTAGACTCCCCTGAAGAATCCCCCATGGAAACTGCCCTTATCCGCTGTCCAGCAGCTGCCAGAGGCCCCAGGTCACCTCGGGTCCCC
TTGAAAGAATGTCTCGGTCACATCAGGCCCGCTAGGTCCAGAGAGCGAGCCCCCAATGCCCGGCCAGGCTAAGCCGCAGAGACCCTCTCA
GCCCCCACCTCAGGTTAGGGCTCTGCCCGCAGCCTGACCTCTAGCCCTGGTGGCAGAGGTCCCTCAGCTGCGAGGCTAATTGGGTGACCA
CCGATTCCAGCTGCGGTTAATCCAGCTTGGGCCTGTCTGCACTGCGATCCTCTTGGGCTCTCCTAGGATCCCCCCATGCCCCGTAAGAGG
TGGAAGACGCTTCCTTCCAGGACAGCAGGCTTTGAGTCCAGCACCCCCAGCCTGCCTTTGCCACCAGCCCCACCCTGCAGAGTATATGAG
GCTTGACAGAGTCTGCCCCCTCCCCCACTGCACCCCAAGAGAGAGAGCCCCAGCCAGCGGAACAGTTTCTATTACCCCCTCCCTGCCCCC
AGACCCATGTGATTTCTGCTTTCTTCTTTAGCAAGATATTCTGGTTTCTAGATAAGGAAGAGTCTCTAATGAGCCCCCGAGCCCCAGTCT
CTTCAGACTCATGGATTGGTCTGAGGGGTCTGAACGTCTCCTAGCCAATCAGAACTGGCTGTGGACCACCCTAGCACGGCCACCTCTCAG

>In-frame_ZSCAN25_ENST00000334715_chr7_99221804_+_CUX1_ENST00000292538_chr7_101916634_+_2511nt
GTTCTCAAAAGGGTCATTGATGCAGTCATTCTCAGTCTCCTCGGAGGGAGTCTGAAGATGCTTAAAGAGCATCCAGAGATGGCGGAAGCT
CCTCAGCAGCAGTTGGGTATTCCTGTGGTGAAACTGGAGAAAGAGTTGCCATGGGGCAGAGGAAGGGAGGACCCTAGTCCAGAGACTTTT
CGGCTGAGGTTTCGGCAGTTCCGCTACCAGGAGGCAGCTGGACCCCAGGAAGCTCTTAGGGAGCTCCAGGAGCTCTGTCGTCGGTGGCTG
AGGCCCGAGTTGCACACCAAGGAGCAGATCCTGGAGCTGCTGGTGCTGGAGCAGTTCCTCACTATCCTGCCCCGCGAGTTCTACGCCTGG
ATCCGGGAGCATGGCCCAGAGAGTGGCAAGGCCCTGGCCGCCATGGTGGAGGACCTGACAGAAAGAGCACTGGAGGCCAAGGCGGTTCCA
TGCCACAGGCAGGGAGAGCAGGAGGAAACAGCACTTTGCAGAGGCGCTTGGGAGCCAGGCATCCAGCTGGGGCCAGTGGAGGTCAAGCCT
GAATGGGGGATGCCCCCTGGGGAAGGAGTTCAAGGTCCAGACCCAGGTACCGAGGAGCAGCTCAGTCAGGACCCTGGAGATGAGACACGG
GCCTTCCAGGAGCAAGCACTACCTGTTCTGCAGGCGGGTCCTGGCCTCCCCGCAGTGAATCCCAGAGACCAAGAGATGGCAGCTGGGTTC
TTTACTGCTGGATCGCAGGGGTTGGGGCCATTTAAAGATATGGCCCTGGCCTTCCCTGAGGAGGAGTGGAGGCATGTGACCCCAGCCCAG
ATAGACTGCTTTGGGGAGTATGTGGAACCGCAGGACTGCAGGGTCTCTCCAGGACGCTGTGCAGAGCTGCAAGTCCGTATCACTGAGGCT
GTGGCCACAGCCACTGAGCAGAGAGAGCTGATCGCCCGCCTGGAGCAGGACCTGAGCATCATTCAGTCCATCCAGCGGCCCGATGCCGAG
GGTGCCGCTGAGCACCGCCTGGAGAAGATCCCAGAGCCCATCAAAGAGGCCACTGCCCTATTCTACGGACCTGCAGCACCAGCCAGCGGT
GCCCTCCCAGAGGGCCAGGTGGATTCACTGCTTTCCATCATCTCCAGCCAGAGGGAGCGCTTCCGTGCCCGGAACCAGGAGCTTGAGGCC
GAGAACCGCCTGGCCCAGCACACCCTCCAGGCCCTGCAGAGTGAGCTGGACAGCCTGCGCGCCGACAACATCAAGCTCTTTGAGAAGATC
AAGTTCCTGCAGAGCTACCCTGGCCGGGGCAGCGGCAGTGATGACACGGAGCTGCGGTACTCGTCCCAGTACGAGGAGCGCCTGGACCCC
TTCTCCTCCTTCAGCAAGCGGGAGCGGCAGAGGAAGTACCTGAGCTTGAGTCCCTGGGACAAGGCCACCCTCAGCATGGGGCGTCTGGTT
CTCTCCAACAAGATGGCGCGCACCATCGGCTTCTTCTACACACTGTTCCTGCACTGCCTGGTCTTCCTGGTGCTCTACAAGCTGGCATGG
AGCGAGAGCATGGAGAGGGACTGTGCCACCTTCTGCGCCAAGAAGTTCGCTGACCACCTGCACAAGTTCCACGAGAATGACAACGGGGCT
GCGGCTGGTGACTTGTGGCAGTGATACCCCGGGGCCTCCCCCGTGACAGTGACGGCTGCGCCTCCACCCCGACTGCTCAGTGCATCTAAT
CACTTAGACTCCCCTGAAGAATCCCCCATGGAAACTGCCCTTATCCGCTGTCCAGCAGCTGCCAGAGGCCCCAGGTCACCTCGGGTCCCC
TTGAAAGAATGTCTCGGTCACATCAGGCCCGCTAGGTCCAGAGAGCGAGCCCCCAATGCCCGGCCAGGCTAAGCCGCAGAGACCCTCTCA
GCCCCCACCTCAGGTTAGGGCTCTGCCCGCAGCCTGACCTCTAGCCCTGGTGGCAGAGGTCCCTCAGCTGCGAGGCTAATTGGGTGACCA
CCGATTCCAGCTGCGGTTAATCCAGCTTGGGCCTGTCTGCACTGCGATCCTCTTGGGCTCTCCTAGGATCCCCCCATGCCCCGTAAGAGG
TGGAAGACGCTTCCTTCCAGGACAGCAGGCTTTGAGTCCAGCACCCCCAGCCTGCCTTTGCCACCAGCCCCACCCTGCAGAGTATATGAG
GCTTGACAGAGTCTGCCCCCTCCCCCACTGCACCCCAAGAGAGAGAGCCCCAGCCAGCGGAACAGTTTCTATTACCCCCTCCCTGCCCCC
AGACCCATGTGATTTCTGCTTTCTTCTTTAGCAAGATATTCTGGTTTCTAGATAAGGAAGAGTCTCTAATGAGCCCCCGAGCCCCAGTCT
CTTCAGACTCATGGATTGGTCTGAGGGGTCTGAACGTCTCCTAGCCAATCAGAACTGGCTGTGGACCACCCTAGCACGGCCACCTCTCAG

>In-frame_ZSCAN25_ENST00000334715_chr7_99221804_+_CUX1_ENST00000393824_chr7_101916634_+_2032nt
GTTCTCAAAAGGGTCATTGATGCAGTCATTCTCAGTCTCCTCGGAGGGAGTCTGAAGATGCTTAAAGAGCATCCAGAGATGGCGGAAGCT
CCTCAGCAGCAGTTGGGTATTCCTGTGGTGAAACTGGAGAAAGAGTTGCCATGGGGCAGAGGAAGGGAGGACCCTAGTCCAGAGACTTTT
CGGCTGAGGTTTCGGCAGTTCCGCTACCAGGAGGCAGCTGGACCCCAGGAAGCTCTTAGGGAGCTCCAGGAGCTCTGTCGTCGGTGGCTG
AGGCCCGAGTTGCACACCAAGGAGCAGATCCTGGAGCTGCTGGTGCTGGAGCAGTTCCTCACTATCCTGCCCCGCGAGTTCTACGCCTGG
ATCCGGGAGCATGGCCCAGAGAGTGGCAAGGCCCTGGCCGCCATGGTGGAGGACCTGACAGAAAGAGCACTGGAGGCCAAGGCGGTTCCA
TGCCACAGGCAGGGAGAGCAGGAGGAAACAGCACTTTGCAGAGGCGCTTGGGAGCCAGGCATCCAGCTGGGGCCAGTGGAGGTCAAGCCT
GAATGGGGGATGCCCCCTGGGGAAGGAGTTCAAGGTCCAGACCCAGGTACCGAGGAGCAGCTCAGTCAGGACCCTGGAGATGAGACACGG
GCCTTCCAGGAGCAAGCACTACCTGTTCTGCAGGCGGGTCCTGGCCTCCCCGCAGTGAATCCCAGAGACCAAGAGATGGCAGCTGGGTTC
TTTACTGCTGGATCGCAGGGGTTGGGGCCATTTAAAGATATGGCCCTGGCCTTCCCTGAGGAGGAGTGGAGGCATGTGACCCCAGCCCAG
ATAGACTGCTTTGGGGAGTATGTGGAACCGCAGGACTGCAGGGTCTCTCCAGGACGCTGTGCAGAGCTGCAAGTCCGTATCACTGAGGCT
GTGGCCACAGCCACTGAGCAGAGAGAGCTGATCGCCCGCCTGGAGCAGGACCTGAGCATCATTCAGTCCATCCAGCGGCCCGATGCCGAG
GGTGCCGCTGAGCACCGCCTGGAGAAGATCCCAGAGCCCATCAAAGAGGCCACTGCCCTATTCTACGGACCTGCAGCACCAGCCAGCGGT
GCCCTCCCAGAGGGCCAGGTGGATTCACTGCTTTCCATCATCTCCAGCCAGAGGGAGCGCTTCCGTGCCCGGAACCAGGAGCTTGAGGCC
GAGAACCGCCTGGCCCAGCACACCCTCCAGGCCCTGCAGAGTGAGCTGGACAGCCTGCGCGCCGACAACATCAAGCTCTTTGAGAAGATC
AAGTTCCTGCAGAGCTACCCTGGCCGGGGCAGCGGCAGTGATGACACGGAGCTGCGGTACTCGTCCCAGTACGAGGAGCGCCTGGACCCC
TTCTCCTCCTTCAGCAAGCGGGAGCGGCAGAGGAAGTACCTGAGCTTGAGTCCCTGGGACAAGGCCACCCTCAGCATGGGGCGTCTGGTT
CTCTCCAACAAGATGGCGCGCACCATCGGCTTCTTCTACACACTGTTCCTGCACTGCCTGGTCTTCCTGGTGCTCTACAAGCTGGCATGG
AGCGAGAGCATGGAGAGGGACTGTGCCACCTTCTGCGCCAAGAAGTTCGCTGACCACCTGCACAAGTTCCACGAGAATGACAACGGGGCT
GCGGCTGGTGACTTGTGGCAGTGATACCCCGGGGCCTCCCCCGTGACAGTGACGGCTGCGCCTCCACCCCGACTGCTCAGTGCATCTAAT
CACTTAGACTCCCCTGAAGAATCCCCCATGGAAACTGCCCTTATCCGCTGTCCAGCAGCTGCCAGAGGCCCCAGGTCACCTCGGGTCCCC
TTGAAAGAATGTCTCGGTCACATCAGGCCCGCTAGGTCCAGAGAGCGAGCCCCCAATGCCCGGCCAGGCTAAGCCGCAGAGACCCTCTCA
GCCCCCACCTCAGGTTAGGGCTCTGCCCGCAGCCTGACCTCTAGCCCTGGTGGCAGAGGTCCCTCAGCTGCGAGGCTAATTGGGTGACCA

>In-frame_ZSCAN25_ENST00000334715_chr7_99221804_+_CUX1_ENST00000547394_chr7_101916634_+_2511nt
GTTCTCAAAAGGGTCATTGATGCAGTCATTCTCAGTCTCCTCGGAGGGAGTCTGAAGATGCTTAAAGAGCATCCAGAGATGGCGGAAGCT
CCTCAGCAGCAGTTGGGTATTCCTGTGGTGAAACTGGAGAAAGAGTTGCCATGGGGCAGAGGAAGGGAGGACCCTAGTCCAGAGACTTTT
CGGCTGAGGTTTCGGCAGTTCCGCTACCAGGAGGCAGCTGGACCCCAGGAAGCTCTTAGGGAGCTCCAGGAGCTCTGTCGTCGGTGGCTG
AGGCCCGAGTTGCACACCAAGGAGCAGATCCTGGAGCTGCTGGTGCTGGAGCAGTTCCTCACTATCCTGCCCCGCGAGTTCTACGCCTGG
ATCCGGGAGCATGGCCCAGAGAGTGGCAAGGCCCTGGCCGCCATGGTGGAGGACCTGACAGAAAGAGCACTGGAGGCCAAGGCGGTTCCA
TGCCACAGGCAGGGAGAGCAGGAGGAAACAGCACTTTGCAGAGGCGCTTGGGAGCCAGGCATCCAGCTGGGGCCAGTGGAGGTCAAGCCT
GAATGGGGGATGCCCCCTGGGGAAGGAGTTCAAGGTCCAGACCCAGGTACCGAGGAGCAGCTCAGTCAGGACCCTGGAGATGAGACACGG
GCCTTCCAGGAGCAAGCACTACCTGTTCTGCAGGCGGGTCCTGGCCTCCCCGCAGTGAATCCCAGAGACCAAGAGATGGCAGCTGGGTTC
TTTACTGCTGGATCGCAGGGGTTGGGGCCATTTAAAGATATGGCCCTGGCCTTCCCTGAGGAGGAGTGGAGGCATGTGACCCCAGCCCAG
ATAGACTGCTTTGGGGAGTATGTGGAACCGCAGGACTGCAGGGTCTCTCCAGGACGCTGTGCAGAGCTGCAAGTCCGTATCACTGAGGCT
GTGGCCACAGCCACTGAGCAGAGAGAGCTGATCGCCCGCCTGGAGCAGGACCTGAGCATCATTCAGTCCATCCAGCGGCCCGATGCCGAG
GGTGCCGCTGAGCACCGCCTGGAGAAGATCCCAGAGCCCATCAAAGAGGCCACTGCCCTATTCTACGGACCTGCAGCACCAGCCAGCGGT
GCCCTCCCAGAGGGCCAGGTGGATTCACTGCTTTCCATCATCTCCAGCCAGAGGGAGCGCTTCCGTGCCCGGAACCAGGAGCTTGAGGCC
GAGAACCGCCTGGCCCAGCACACCCTCCAGGCCCTGCAGAGTGAGCTGGACAGCCTGCGCGCCGACAACATCAAGCTCTTTGAGAAGATC
AAGTTCCTGCAGAGCTACCCTGGCCGGGGCAGCGGCAGTGATGACACGGAGCTGCGGTACTCGTCCCAGTACGAGGAGCGCCTGGACCCC
TTCTCCTCCTTCAGCAAGCGGGAGCGGCAGAGGAAGTACCTGAGCTTGAGTCCCTGGGACAAGGCCACCCTCAGCATGGGGCGTCTGGTT
CTCTCCAACAAGATGGCGCGCACCATCGGCTTCTTCTACACACTGTTCCTGCACTGCCTGGTCTTCCTGGTGCTCTACAAGCTGGCATGG
AGCGAGAGCATGGAGAGGGACTGTGCCACCTTCTGCGCCAAGAAGTTCGCTGACCACCTGCACAAGTTCCACGAGAATGACAACGGGGCT
GCGGCTGGTGACTTGTGGCAGTGATACCCCGGGGCCTCCCCCGTGACAGTGACGGCTGCGCCTCCACCCCGACTGCTCAGTGCATCTAAT
CACTTAGACTCCCCTGAAGAATCCCCCATGGAAACTGCCCTTATCCGCTGTCCAGCAGCTGCCAGAGGCCCCAGGTCACCTCGGGTCCCC
TTGAAAGAATGTCTCGGTCACATCAGGCCCGCTAGGTCCAGAGAGCGAGCCCCCAATGCCCGGCCAGGCTAAGCCGCAGAGACCCTCTCA
GCCCCCACCTCAGGTTAGGGCTCTGCCCGCAGCCTGACCTCTAGCCCTGGTGGCAGAGGTCCCTCAGCTGCGAGGCTAATTGGGTGACCA
CCGATTCCAGCTGCGGTTAATCCAGCTTGGGCCTGTCTGCACTGCGATCCTCTTGGGCTCTCCTAGGATCCCCCCATGCCCCGTAAGAGG
TGGAAGACGCTTCCTTCCAGGACAGCAGGCTTTGAGTCCAGCACCCCCAGCCTGCCTTTGCCACCAGCCCCACCCTGCAGAGTATATGAG
GCTTGACAGAGTCTGCCCCCTCCCCCACTGCACCCCAAGAGAGAGAGCCCCAGCCAGCGGAACAGTTTCTATTACCCCCTCCCTGCCCCC
AGACCCATGTGATTTCTGCTTTCTTCTTTAGCAAGATATTCTGGTTTCTAGATAAGGAAGAGTCTCTAATGAGCCCCCGAGCCCCAGTCT
CTTCAGACTCATGGATTGGTCTGAGGGGTCTGAACGTCTCCTAGCCAATCAGAACTGGCTGTGGACCACCCTAGCACGGCCACCTCTCAG


Top

FusionGenePPI for ZSCAN25_CUX1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZSCAN25HIST1H1A, RPL14, RPS2, RPS8, ZSCAN1, ZSCAN20, IPO8, PAPD5, E4F1, ZBTB48, ZNF169, SART3, CNBP, ZNF483, RPL30, ZNF2, PPAN, RBM34, H2AFX, ZNF324B, PGBD1, TRIM25CUX1RB1, CREBBP, KAT2B, BIN1, ELAC2, RECQL5, CDK7, CCNA1, CDK1, SATB1, TLE4, MAX, SOX2, KCND3, EHMT2, ECT2, TP53BP1, SUMO2, MAGEA10, HLA-DQA1, STX6, WDR83, PTH1R, GABRE, SLC39A4, NIT1, NTRK1, TACC3, SPATS2L, NFATC1, RBPJ, FOXD3, FOXE1, FOXG1, FOXJ2, GAN, FOXK2, FOXN1, FOXO1, FOXP1, FOXQ1, SLC39A12, EXT2, RAB30, LAMP1, POTEB3, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZSCAN25_CUX1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ZSCAN25_CUX1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneCUX1C0041696Unipolar Depression3PSYGENET
TgeneCUX1C1269683Major Depressive Disorder3PSYGENET
TgeneCUX1C0525045Mood Disorders1PSYGENET
TgeneCUX1C0596263Carcinogenesis1CTD_human