FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4368

FusionGeneSummary for BRAF_SND1

check button Fusion gene summary
Fusion gene informationFusion gene name: BRAF_SND1
Fusion gene ID: 4368
HgeneTgene
Gene symbol

BRAF

SND1

Gene ID

673

27044

Gene nameB-Raf proto-oncogene, serine/threonine kinasestaphylococcal nuclease and tudor domain containing 1
SynonymsB-RAF1|B-raf|BRAF1|NS7|RAFB1TDRD11|Tudor-SN|p100
Cytomap

7q34

7q32.1

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein kinase B-raf94 kDa B-raf proteinB-Raf proto-oncogene serine/threonine-protein kinase (p94)B-Raf serine/threonine-proteinmurine sarcoma viral (v-raf) oncogene homolog B1proto-oncogene B-Rafv-raf murine sarcoma viral oncogene staphylococcal nuclease domain-containing protein 1EBNA2 coactivator p100testis tissue sperm-binding protein Li 82Ptudor domain-containing protein 11
Modification date2018052720180523
UniProtAcc

P15056

Q7KZF4

Ensembl transtripts involved in fusion geneENST00000288602, ENST00000354725, 
ENST00000467238, 
Fusion gene scores* DoF score18 X 12 X 10=216020 X 15 X 10=3000
# samples 2221
** MAII scorelog2(22/2160*10)=-3.29545588352617
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(21/3000*10)=-3.83650126771712
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: BRAF [Title/Abstract] AND SND1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneBRAF

GO:0006468

protein phosphorylation

17563371

HgeneBRAF

GO:0010828

positive regulation of glucose transmembrane transport

23010278

HgeneBRAF

GO:0033138

positive regulation of peptidyl-serine phosphorylation

19667065

HgeneBRAF

GO:0043066

negative regulation of apoptotic process

19667065

HgeneBRAF

GO:0070374

positive regulation of ERK1 and ERK2 cascade

22065586

HgeneBRAF

GO:0071277

cellular response to calcium ion

18567582

HgeneBRAF

GO:0090150

establishment of protein localization to membrane

23010278


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVTHCATCGA-EL-A3ZK-01ABRAFchr7

140487348

-SND1chr7

127724776

+
TCGALDTHCATCGA-KS-A41I-01ABRAFchr7

140494108

-SND1chr7

127714554

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000288602ENST00000354725BRAFchr7

140487348

-SND1chr7

127724776

+
5CDS-intronENST00000288602ENST00000467238BRAFchr7

140487348

-SND1chr7

127724776

+
In-frameENST00000288602ENST00000354725BRAFchr7

140494108

-SND1chr7

127714554

+
5CDS-intronENST00000288602ENST00000467238BRAFchr7

140494108

-SND1chr7

127714554

+

Top

FusionProtFeatures for BRAF_SND1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BRAF

P15056

SND1

Q7KZF4

Functions as a bridging factor between STAT6 and thebasal transcription factor. Plays a role in PIM1 regulation of MYBactivity. Functions as a transcriptional coactivator for theEpstein-Barr virus nuclear antigen 2 (EBNA2).{ECO:0000269|PubMed:7651391}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBRAFchr7:140487348chr7:127724776ENST00000288602-918122_129392767Compositional biasNote=Poly-Ser
HgeneBRAFchr7:140487348chr7:127724776ENST00000288602-9186_11392767Compositional biasNote=Poly-Gly
HgeneBRAFchr7:140494108chr7:127714554ENST00000288602-818122_129380767Compositional biasNote=Poly-Ser
HgeneBRAFchr7:140494108chr7:127714554ENST00000288602-8186_11380767Compositional biasNote=Poly-Gly
HgeneBRAFchr7:140487348chr7:127724776ENST00000288602-918155_227392767DomainRBD
HgeneBRAFchr7:140494108chr7:127714554ENST00000288602-818155_227380767DomainRBD
HgeneBRAFchr7:140487348chr7:127724776ENST00000288602-918234_280392767Zinc fingerPhorbol-ester/DAG-type
HgeneBRAFchr7:140494108chr7:127714554ENST00000288602-818234_280380767Zinc fingerPhorbol-ester/DAG-type
TgeneSND1chr7:140487348chr7:127724776ENST00000354725+1724729_787703911DomainTudor
TgeneSND1chr7:140494108chr7:127714554ENST00000354725+1524729_787593911DomainTudor

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBRAFchr7:140487348chr7:127724776ENST00000288602-918428_432392767Compositional biasNote=Poly-Ser
HgeneBRAFchr7:140494108chr7:127714554ENST00000288602-818428_432380767Compositional biasNote=Poly-Ser
HgeneBRAFchr7:140487348chr7:127724776ENST00000288602-918457_717392767DomainProtein kinase
HgeneBRAFchr7:140494108chr7:127714554ENST00000288602-818457_717380767DomainProtein kinase
HgeneBRAFchr7:140487348chr7:127724776ENST00000288602-918463_471392767Nucleotide bindingATP
HgeneBRAFchr7:140494108chr7:127714554ENST00000288602-818463_471380767Nucleotide bindingATP
TgeneSND1chr7:140487348chr7:127724776ENST00000354725+172418_166703911DomainTNase-like 1
TgeneSND1chr7:140487348chr7:127724776ENST00000354725+1724193_328703911DomainTNase-like 2
TgeneSND1chr7:140487348chr7:127724776ENST00000354725+1724341_496703911DomainTNase-like 3
TgeneSND1chr7:140487348chr7:127724776ENST00000354725+1724525_660703911DomainTNase-like 4
TgeneSND1chr7:140494108chr7:127714554ENST00000354725+152418_166593911DomainTNase-like 1
TgeneSND1chr7:140494108chr7:127714554ENST00000354725+1524193_328593911DomainTNase-like 2
TgeneSND1chr7:140494108chr7:127714554ENST00000354725+1524341_496593911DomainTNase-like 3
TgeneSND1chr7:140494108chr7:127714554ENST00000354725+1524525_660593911DomainTNase-like 4
TgeneSND1chr7:140487348chr7:127724776ENST00000354725+1724321_325703911MotifNuclear localization signal
TgeneSND1chr7:140487348chr7:127724776ENST00000354725+1724388_392703911MotifNuclear localization signal
TgeneSND1chr7:140494108chr7:127714554ENST00000354725+1524321_325593911MotifNuclear localization signal
TgeneSND1chr7:140494108chr7:127714554ENST00000354725+1524388_392593911MotifNuclear localization signal


Top

FusionGeneSequence for BRAF_SND1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BRAF_ENST00000288602_chr7_140487348_-_SND1_ENST00000354725_chr7_127724776_+_600aa
MAALSGGGGGGAEPGQALFNGDMEPEAGAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLD
ALQQREQQLLESLGNGTDFSVSSSASMDTVTSSSSSSLSVLPSSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDS
LKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQ
RCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQR
DRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHV
FYIDYGNREVLPSTRLGTLSPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHVTLQFADSKGDV

>In-frame_BRAF_ENST00000288602_chr7_140494108_-_SND1_ENST00000354725_chr7_127714554_+_698aa
MAALSGGGGGGAEPGQALFNGDMEPEAGAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLD
ALQQREQQLLESLGNGTDFSVSSSASMDTVTSSSSSSLSVLPSSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDS
LKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQ
RCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQR
DRSSSAPNVHINTIEPVNIDVEVEVESMDKAGNFIGWLHIDGANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWAHYEE
QPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKV
ESPAKIHVFYIDYGNREVLPSTRLGTLSPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHVTLQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BRAF_ENST00000288602_chr7_140487348_-_SND1_ENST00000354725_chr7_127724776_+_1800nt
ATGGCGGCGCTGAGCGGTGGCGGTGGTGGCGGCGCGGAGCCGGGCCAGGCTCTGTTCAACGGGGACATGGAGCCCGAGGCCGGCGCCGGC
GCCGGCGCCGCGGCCTCTTCGGCTGCGGACCCTGCCATTCCGGAGGAGGTGTGGAATATCAAACAAATGATTAAGTTGACACAGGAACAT
ATAGAGGCCCTATTGGACAAATTTGGTGGGGAGCATAATCCACCATCAATATATCTGGAGGCCTATGAAGAATACACCAGCAAGCTAGAT
GCACTCCAACAAAGAGAACAACAGTTATTGGAATCTCTGGGGAACGGAACTGATTTTTCTGTTTCTAGCTCTGCATCAATGGATACCGTT
ACATCTTCTTCCTCTTCTAGCCTTTCAGTGCTACCTTCATCTCTTTCAGTTTTTCAAAATCCCACAGATGTGGCACGGAGCAACCCCAAG
TCACCACAAAAACCTATCGTTAGAGTCTTCCTGCCCAACAAACAGAGGACAGTGGTACCTGCAAGGTGTGGAGTTACAGTCCGAGACAGT
CTAAAGAAAGCACTGATGATGAGAGGTCTAATCCCAGAGTGCTGTGCTGTTTACAGAATTCAGGATGGAGAGAAGAAACCAATTGGTTGG
GACACTGATATTTCCTGGCTTACTGGAGAAGAATTGCATGTGGAAGTGTTGGAGAATGTTCCACTTACAACACACAACTTTGTACGAAAA
ACGTTTTTCACCTTAGCATTTTGTGACTTTTGTCGAAAGCTGCTTTTCCAGGGTTTCCGCTGTCAAACATGTGGTTATAAATTTCACCAG
CGTTGTAGTACAGAAGTTCCACTGATGTGTGTTAATTATGACCAACTTGATTTGCTGTTTGTCTCCAAGTTCTTTGAACACCACCCAATA
CCACAGGAAGAGGCGTCCTTAGCAGAGACTGCCCTAACATCTGGATCATCCCCTTCCGCACCCGCCTCGGACTCTATTGGGCCCCAAATT
CTCACCAGTCCGTCTCCTTCAAAATCCATTCCAATTCCACAGCCCTTCCGACCAGCAGATGAAGATCATCGAAATCAATTTGGGCAACGA
GACCGATCCTCATCAGCTCCCAATGTGCATATAAACACAATAGAACCTGTCAATATTGATGACTTGATTAGAGACCAAGGATTTCGTGGT
GATGGAGGCACCCAGTTGGAGAAGCTGATGGAGAACATGCGCAATGACATTGCCAGTCACCCCCCTGTAGAGGGCTCCTATGCCCCCCGC
AGGGGAGAGTTCTGCATTGCCAAATTTGTAGATGGAGAATGGTACCGTGCCCGAGTAGAGAAAGTCGAGTCTCCTGCCAAAATACATGTC
TTCTACATTGACTACGGCAACAGAGAGGTCCTGCCATCCACCCGCCTGGGTACCCTATCACCTGCCTTCAGCACTCGGGTGCTGCCAGCT
CAAGCCACGGAGTATGCCTTCGCCTTCATCCAGGTGCCCCAAGATGATGATGCCCGCACGGACGCCGTGGACAGCGTAGTTCGGGATATC
CAGAACACTCAGTGCCTGCTCAACGTGGAACACCTGAGTGCCGGCTGCCCCCATGTCACCCTGCAGTTTGCAGATTCCAAGGGCGATGTG
GGGCTGGGCTTGGTGAAGGAAGGGCTGGTCATGGTGGAGGTGCGCAAGGAGAAACAGTTCCAGAAAGTGATCACAGAATACCTGAATGCC
CAAGAGTCAGCCAAGAGCGCCAGGCTGAACCTGTGGCGCTATGGAGACTTTCGAGCTGATGATGCAGACGAATTTGGCTACAGCCGCTAA

>In-frame_BRAF_ENST00000288602_chr7_140494108_-_SND1_ENST00000354725_chr7_127714554_+_2094nt
ATGGCGGCGCTGAGCGGTGGCGGTGGTGGCGGCGCGGAGCCGGGCCAGGCTCTGTTCAACGGGGACATGGAGCCCGAGGCCGGCGCCGGC
GCCGGCGCCGCGGCCTCTTCGGCTGCGGACCCTGCCATTCCGGAGGAGGTGTGGAATATCAAACAAATGATTAAGTTGACACAGGAACAT
ATAGAGGCCCTATTGGACAAATTTGGTGGGGAGCATAATCCACCATCAATATATCTGGAGGCCTATGAAGAATACACCAGCAAGCTAGAT
GCACTCCAACAAAGAGAACAACAGTTATTGGAATCTCTGGGGAACGGAACTGATTTTTCTGTTTCTAGCTCTGCATCAATGGATACCGTT
ACATCTTCTTCCTCTTCTAGCCTTTCAGTGCTACCTTCATCTCTTTCAGTTTTTCAAAATCCCACAGATGTGGCACGGAGCAACCCCAAG
TCACCACAAAAACCTATCGTTAGAGTCTTCCTGCCCAACAAACAGAGGACAGTGGTACCTGCAAGGTGTGGAGTTACAGTCCGAGACAGT
CTAAAGAAAGCACTGATGATGAGAGGTCTAATCCCAGAGTGCTGTGCTGTTTACAGAATTCAGGATGGAGAGAAGAAACCAATTGGTTGG
GACACTGATATTTCCTGGCTTACTGGAGAAGAATTGCATGTGGAAGTGTTGGAGAATGTTCCACTTACAACACACAACTTTGTACGAAAA
ACGTTTTTCACCTTAGCATTTTGTGACTTTTGTCGAAAGCTGCTTTTCCAGGGTTTCCGCTGTCAAACATGTGGTTATAAATTTCACCAG
CGTTGTAGTACAGAAGTTCCACTGATGTGTGTTAATTATGACCAACTTGATTTGCTGTTTGTCTCCAAGTTCTTTGAACACCACCCAATA
CCACAGGAAGAGGCGTCCTTAGCAGAGACTGCCCTAACATCTGGATCATCCCCTTCCGCACCCGCCTCGGACTCTATTGGGCCCCAAATT
CTCACCAGTCCGTCTCCTTCAAAATCCATTCCAATTCCACAGCCCTTCCGACCAGCAGATGAAGATCATCGAAATCAATTTGGGCAACGA
GACCGATCCTCATCAGCTCCCAATGTGCATATAAACACAATAGAACCTGTCAATATTGATGTGGAGGTGGAGGTGGAGAGCATGGACAAG
GCCGGCAACTTTATCGGCTGGCTGCACATCGACGGTGCCAACCTGTCCGTCCTGCTGGTGGAGCACGCGCTCTCCAAGGTCCACTTCACC
GCCGAACGCAGCTCCTACTACAAGTCCCTGCTGTCTGCCGAGGAGGCCGCAAAGCAGAAGAAAGAGAAGGTCTGGGCCCACTATGAGGAG
CAGCCCGTGGAGGAGGTGATGCCAGTGCTGGAGGAGAAGGAGCGATCTGCTAGCTACAAGCCCGTGTTTGTGACTGAGATCACTGATGAC
CTGCACTTCTACGTGCAGGATGTGGAGACCGGCACCCAGTTGGAGAAGCTGATGGAGAACATGCGCAATGACATTGCCAGTCACCCCCCT
GTAGAGGGCTCCTATGCCCCCCGCAGGGGAGAGTTCTGCATTGCCAAATTTGTAGATGGAGAATGGTACCGTGCCCGAGTAGAGAAAGTC
GAGTCTCCTGCCAAAATACATGTCTTCTACATTGACTACGGCAACAGAGAGGTCCTGCCATCCACCCGCCTGGGTACCCTATCACCTGCC
TTCAGCACTCGGGTGCTGCCAGCTCAAGCCACGGAGTATGCCTTCGCCTTCATCCAGGTGCCCCAAGATGATGATGCCCGCACGGACGCC
GTGGACAGCGTAGTTCGGGATATCCAGAACACTCAGTGCCTGCTCAACGTGGAACACCTGAGTGCCGGCTGCCCCCATGTCACCCTGCAG
TTTGCAGATTCCAAGGGCGATGTGGGGCTGGGCTTGGTGAAGGAAGGGCTGGTCATGGTGGAGGTGCGCAAGGAGAAACAGTTCCAGAAA
GTGATCACAGAATACCTGAATGCCCAAGAGTCAGCCAAGAGCGCCAGGCTGAACCTGTGGCGCTATGGAGACTTTCGAGCTGATGATGCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_BRAF_ENST00000288602_chr7_140487348_-_SND1_ENST00000354725_chr7_127724776_+_2410nt
CGCCTCCCTTCCCCCTCCCCGCCCGACAGCGGCCGCTCGGGCCCCGGCTCTCGGTTATAAGATGGCGGCGCTGAGCGGTGGCGGTGGTGG
CGGCGCGGAGCCGGGCCAGGCTCTGTTCAACGGGGACATGGAGCCCGAGGCCGGCGCCGGCGCCGGCGCCGCGGCCTCTTCGGCTGCGGA
CCCTGCCATTCCGGAGGAGGTGTGGAATATCAAACAAATGATTAAGTTGACACAGGAACATATAGAGGCCCTATTGGACAAATTTGGTGG
GGAGCATAATCCACCATCAATATATCTGGAGGCCTATGAAGAATACACCAGCAAGCTAGATGCACTCCAACAAAGAGAACAACAGTTATT
GGAATCTCTGGGGAACGGAACTGATTTTTCTGTTTCTAGCTCTGCATCAATGGATACCGTTACATCTTCTTCCTCTTCTAGCCTTTCAGT
GCTACCTTCATCTCTTTCAGTTTTTCAAAATCCCACAGATGTGGCACGGAGCAACCCCAAGTCACCACAAAAACCTATCGTTAGAGTCTT
CCTGCCCAACAAACAGAGGACAGTGGTACCTGCAAGGTGTGGAGTTACAGTCCGAGACAGTCTAAAGAAAGCACTGATGATGAGAGGTCT
AATCCCAGAGTGCTGTGCTGTTTACAGAATTCAGGATGGAGAGAAGAAACCAATTGGTTGGGACACTGATATTTCCTGGCTTACTGGAGA
AGAATTGCATGTGGAAGTGTTGGAGAATGTTCCACTTACAACACACAACTTTGTACGAAAAACGTTTTTCACCTTAGCATTTTGTGACTT
TTGTCGAAAGCTGCTTTTCCAGGGTTTCCGCTGTCAAACATGTGGTTATAAATTTCACCAGCGTTGTAGTACAGAAGTTCCACTGATGTG
TGTTAATTATGACCAACTTGATTTGCTGTTTGTCTCCAAGTTCTTTGAACACCACCCAATACCACAGGAAGAGGCGTCCTTAGCAGAGAC
TGCCCTAACATCTGGATCATCCCCTTCCGCACCCGCCTCGGACTCTATTGGGCCCCAAATTCTCACCAGTCCGTCTCCTTCAAAATCCAT
TCCAATTCCACAGCCCTTCCGACCAGCAGATGAAGATCATCGAAATCAATTTGGGCAACGAGACCGATCCTCATCAGCTCCCAATGTGCA
TATAAACACAATAGAACCTGTCAATATTGATGACTTGATTAGAGACCAAGGATTTCGTGGTGATGGAGGCACCCAGTTGGAGAAGCTGAT
GGAGAACATGCGCAATGACATTGCCAGTCACCCCCCTGTAGAGGGCTCCTATGCCCCCCGCAGGGGAGAGTTCTGCATTGCCAAATTTGT
AGATGGAGAATGGTACCGTGCCCGAGTAGAGAAAGTCGAGTCTCCTGCCAAAATACATGTCTTCTACATTGACTACGGCAACAGAGAGGT
CCTGCCATCCACCCGCCTGGGTACCCTATCACCTGCCTTCAGCACTCGGGTGCTGCCAGCTCAAGCCACGGAGTATGCCTTCGCCTTCAT
CCAGGTGCCCCAAGATGATGATGCCCGCACGGACGCCGTGGACAGCGTAGTTCGGGATATCCAGAACACTCAGTGCCTGCTCAACGTGGA
ACACCTGAGTGCCGGCTGCCCCCATGTCACCCTGCAGTTTGCAGATTCCAAGGGCGATGTGGGGCTGGGCTTGGTGAAGGAAGGGCTGGT
CATGGTGGAGGTGCGCAAGGAGAAACAGTTCCAGAAAGTGATCACAGAATACCTGAATGCCCAAGAGTCAGCCAAGAGCGCCAGGCTGAA
CCTGTGGCGCTATGGAGACTTTCGAGCTGATGATGCAGACGAATTTGGCTACAGCCGCTAAGGAGGGGATCGGGTTTGGCCCCCAGCCCC
GCTCACGCCAGTCCCTCTTCCTCTGCCGGGAGGGTGTTTTCAACTCCAAACCCCAGAGAGGGGTTGTAGATTGGGTCCAGCTTTGCTTCA
GTGTGTGGAAATGTCTCGTGGGGTGGCATCGGGGCTGCGGGGTGGGGACCCCAAGGCTTTCTGGGGCAGACCCTTGTCCTCTGGGATGAT
GGGCACTGCTATCCACAGTCTCTGCCAGTTGGTTTTATTTGGAGGTTTGTGGGCTTTTTTTAAAAAAAAAAAGTCCTCAAATCAGGAAGA
AACATCAAAGACTATGTCCTAGTGGAGGGAGTAATCCTAACACCCAGGCTGGCCGCCAGCTGGCACCTGCCTCTATCCCAGACTGCCCTC
GTCCCAGCTCTCTGTCCAACTGTTGATTATGTGATTTTTCTGATACGTCCATTCTCAAATGCCAGTGTGTTCACATCTTCGCTCTGGCCA

>In-frame_BRAF_ENST00000288602_chr7_140494108_-_SND1_ENST00000354725_chr7_127714554_+_2704nt
CGCCTCCCTTCCCCCTCCCCGCCCGACAGCGGCCGCTCGGGCCCCGGCTCTCGGTTATAAGATGGCGGCGCTGAGCGGTGGCGGTGGTGG
CGGCGCGGAGCCGGGCCAGGCTCTGTTCAACGGGGACATGGAGCCCGAGGCCGGCGCCGGCGCCGGCGCCGCGGCCTCTTCGGCTGCGGA
CCCTGCCATTCCGGAGGAGGTGTGGAATATCAAACAAATGATTAAGTTGACACAGGAACATATAGAGGCCCTATTGGACAAATTTGGTGG
GGAGCATAATCCACCATCAATATATCTGGAGGCCTATGAAGAATACACCAGCAAGCTAGATGCACTCCAACAAAGAGAACAACAGTTATT
GGAATCTCTGGGGAACGGAACTGATTTTTCTGTTTCTAGCTCTGCATCAATGGATACCGTTACATCTTCTTCCTCTTCTAGCCTTTCAGT
GCTACCTTCATCTCTTTCAGTTTTTCAAAATCCCACAGATGTGGCACGGAGCAACCCCAAGTCACCACAAAAACCTATCGTTAGAGTCTT
CCTGCCCAACAAACAGAGGACAGTGGTACCTGCAAGGTGTGGAGTTACAGTCCGAGACAGTCTAAAGAAAGCACTGATGATGAGAGGTCT
AATCCCAGAGTGCTGTGCTGTTTACAGAATTCAGGATGGAGAGAAGAAACCAATTGGTTGGGACACTGATATTTCCTGGCTTACTGGAGA
AGAATTGCATGTGGAAGTGTTGGAGAATGTTCCACTTACAACACACAACTTTGTACGAAAAACGTTTTTCACCTTAGCATTTTGTGACTT
TTGTCGAAAGCTGCTTTTCCAGGGTTTCCGCTGTCAAACATGTGGTTATAAATTTCACCAGCGTTGTAGTACAGAAGTTCCACTGATGTG
TGTTAATTATGACCAACTTGATTTGCTGTTTGTCTCCAAGTTCTTTGAACACCACCCAATACCACAGGAAGAGGCGTCCTTAGCAGAGAC
TGCCCTAACATCTGGATCATCCCCTTCCGCACCCGCCTCGGACTCTATTGGGCCCCAAATTCTCACCAGTCCGTCTCCTTCAAAATCCAT
TCCAATTCCACAGCCCTTCCGACCAGCAGATGAAGATCATCGAAATCAATTTGGGCAACGAGACCGATCCTCATCAGCTCCCAATGTGCA
TATAAACACAATAGAACCTGTCAATATTGATGTGGAGGTGGAGGTGGAGAGCATGGACAAGGCCGGCAACTTTATCGGCTGGCTGCACAT
CGACGGTGCCAACCTGTCCGTCCTGCTGGTGGAGCACGCGCTCTCCAAGGTCCACTTCACCGCCGAACGCAGCTCCTACTACAAGTCCCT
GCTGTCTGCCGAGGAGGCCGCAAAGCAGAAGAAAGAGAAGGTCTGGGCCCACTATGAGGAGCAGCCCGTGGAGGAGGTGATGCCAGTGCT
GGAGGAGAAGGAGCGATCTGCTAGCTACAAGCCCGTGTTTGTGACTGAGATCACTGATGACCTGCACTTCTACGTGCAGGATGTGGAGAC
CGGCACCCAGTTGGAGAAGCTGATGGAGAACATGCGCAATGACATTGCCAGTCACCCCCCTGTAGAGGGCTCCTATGCCCCCCGCAGGGG
AGAGTTCTGCATTGCCAAATTTGTAGATGGAGAATGGTACCGTGCCCGAGTAGAGAAAGTCGAGTCTCCTGCCAAAATACATGTCTTCTA
CATTGACTACGGCAACAGAGAGGTCCTGCCATCCACCCGCCTGGGTACCCTATCACCTGCCTTCAGCACTCGGGTGCTGCCAGCTCAAGC
CACGGAGTATGCCTTCGCCTTCATCCAGGTGCCCCAAGATGATGATGCCCGCACGGACGCCGTGGACAGCGTAGTTCGGGATATCCAGAA
CACTCAGTGCCTGCTCAACGTGGAACACCTGAGTGCCGGCTGCCCCCATGTCACCCTGCAGTTTGCAGATTCCAAGGGCGATGTGGGGCT
GGGCTTGGTGAAGGAAGGGCTGGTCATGGTGGAGGTGCGCAAGGAGAAACAGTTCCAGAAAGTGATCACAGAATACCTGAATGCCCAAGA
GTCAGCCAAGAGCGCCAGGCTGAACCTGTGGCGCTATGGAGACTTTCGAGCTGATGATGCAGACGAATTTGGCTACAGCCGCTAAGGAGG
GGATCGGGTTTGGCCCCCAGCCCCGCTCACGCCAGTCCCTCTTCCTCTGCCGGGAGGGTGTTTTCAACTCCAAACCCCAGAGAGGGGTTG
TAGATTGGGTCCAGCTTTGCTTCAGTGTGTGGAAATGTCTCGTGGGGTGGCATCGGGGCTGCGGGGTGGGGACCCCAAGGCTTTCTGGGG
CAGACCCTTGTCCTCTGGGATGATGGGCACTGCTATCCACAGTCTCTGCCAGTTGGTTTTATTTGGAGGTTTGTGGGCTTTTTTTAAAAA
AAAAAAGTCCTCAAATCAGGAAGAAACATCAAAGACTATGTCCTAGTGGAGGGAGTAATCCTAACACCCAGGCTGGCCGCCAGCTGGCAC
CTGCCTCTATCCCAGACTGCCCTCGTCCCAGCTCTCTGTCCAACTGTTGATTATGTGATTTTTCTGATACGTCCATTCTCAAATGCCAGT
GTGTTCACATCTTCGCTCTGGCCAGCCCATTCTGTATTTAAAGCTTTTGAGGCCCAATAAAATAGTACGTGCTGTCTGCAGCCCTTATTG


Top

FusionGenePPI for BRAF_SND1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BRAFYWHAB, YWHAG, YWHAQ, YWHAZ, SFN, HRAS, AKT1, MAPK3, RAP1GAP, RAF1, MRAS, RAP1A, PAK2, TERF1, CCDC88A, NEDD4L, MAP2K1, RNF149, KSR1, BRAP, PRKCE, RPS6KB2, HSP90AA1, BRAF, YWHAE, HSPA5, MAP2K2, HSPA1A, HSPA8, YWHAH, HSPA9, ARAF, CDC37, HSP90AB1, PHKB, LIMK1, IQGAP1, MAPK1, BAD, LIPF, MUS81, FBXW7, FGFR2, BRCA2, VHL, FNTA, HDAC2, PIK3CA, EGFR, PTEN, FNIP1, FNIP2, RAB3GAP1, KRAS, KIAA0141, FKBPL, ARMCX3, KCNC4, RPTOR, CYLD, NRASSND1IKBKE, SNW1, RBPJ, GTF2E2, GTF2E1, MYB, PIM1, STAT6, POLR2A, USP22, PDPK1, PRKAA1, UBA5, LZTR1, DHX9, CREBBP, RBM39, SIRT7, CUL3, CDK2, CAND1, APP, RPS3, HNRNPM, TOMM22, RPL19, MYBBP1A, SMNDC1, RPS20, NENF, RPL4, VDAC2, ILF2, SRSF3, HNRNPU, RPN1, HNRNPR, SSR3, FN1, VCAM1, CSNK2A1, ITGA4, G3BP1, PRPF8, RNU1-1, RNU2-1, RNU4-1, RNU6-1, RNU5A-1, MAK, TARDBP, EIF3CL, RPS11, RPS2, RPS6, RPS9, DDX3X, RPL23A, RPL35, RPS16, RPS26, RPS27, RPS3A, SHFM1, LIN28A, HUWE1, RAPGEF2, MDM2, CUL7, OBSL1, CCDC8, UBE2I, ESR1, MMP28, TDRD3, TXNDC5, NTRK1, NPM1, RPL10, CNOT1, MCM2, U2AF2, CDH1, PTP4A1, MTDH, PA2G4, TRAP1, ANXA5, SNRPB2, EIF5B, GPI, IDH2, PDIA3, UBE2N, MRPL12, CRNN, ZNF207, CPNE3, CS, PYGL, SF3A3, DNAJC8, PLS3, CPSF6, NANS, SF3A1, ECHS1, SRP68, MYL12B, AIMP1, CYLD, DLD, DLST, PDHA1, SOD1, TRIM25, BRCA1, YAP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BRAF_SND1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneBRAFP15056DB08881VemurafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved
HgeneBRAFP15056DB08896RegorafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved
HgeneBRAFP15056DB00398SorafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved|investigational
HgeneBRAFP15056DB08912DabrafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved|investigational

Top

RelatedDiseases for BRAF_SND1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneBRAFC0025202melanoma21CTD_human
HgeneBRAFC1527249Colorectal Cancer8UNIPROT
HgeneBRAFC1275081Cardio-facio-cutaneous syndrome6CTD_human;ORPHANET;UNIPROT
HgeneBRAFC0009404Colorectal Neoplasms4CTD_human
HgeneBRAFC0040136Thyroid Neoplasm4CTD_human
HgeneBRAFC0024305Lymphoma, Non-Hodgkin3UNIPROT
HgeneBRAFC0684249Carcinoma of lung3UNIPROT
HgeneBRAFC3150970NOONAN SYNDROME 73CTD_human;UNIPROT
HgeneBRAFC0152013Adenocarcinoma of lung (disorder)2CTD_human
HgeneBRAFC0002448Ameloblastoma1CTD_human
HgeneBRAFC0004114Astrocytoma1CTD_human
HgeneBRAFC0010276Craniopharyngioma1CTD_human;ORPHANET
HgeneBRAFC0017638Glioma1CTD_human
HgeneBRAFC0022665Kidney Neoplasm1CTD_human
HgeneBRAFC0023903Liver neoplasms1CTD_human
HgeneBRAFC0024694Mandibular Neoplasms1CTD_human
HgeneBRAFC0028326Noonan Syndrome1CTD_human;ORPHANET
HgeneBRAFC0033578Prostatic Neoplasms1CTD_human
HgeneBRAFC0036920Sezary Syndrome1CTD_human
HgeneBRAFC0079773Lymphoma, T-Cell, Cutaneous1CTD_human
HgeneBRAFC0206686Adrenocortical carcinoma1CTD_human
HgeneBRAFC0206754Neuroendocrine Tumors1CTD_human
HgeneBRAFC0238463Papillary thyroid carcinoma1CTD_human;ORPHANET
HgeneBRAFC0587248Costello syndrome (disorder)1CTD_human
HgeneBRAFC0596263Carcinogenesis1CTD_human
HgeneBRAFC0920269Microsatellite Instability1CTD_human
HgeneBRAFC2239176Liver carcinoma1CTD_human
TgeneSND1C0004352Autistic Disorder1CTD_human
TgeneSND1C0024121Lung Neoplasms1CTD_human