FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 43665

FusionGeneSummary for ZNF727_SND1

check button Fusion gene summary
Fusion gene informationFusion gene name: ZNF727_SND1
Fusion gene ID: 43665
HgeneTgene
Gene symbol

ZNF727

SND1

Gene ID

442319

27044

Gene namezinc finger protein 727staphylococcal nuclease and tudor domain containing 1
SynonymsZNF727PTDRD11|Tudor-SN|p100
Cytomap

7q11.21

7q32.1

Type of geneprotein-codingprotein-coding
Descriptionputative zinc finger protein 727zinc finger protein 727 pseudogenestaphylococcal nuclease domain-containing protein 1EBNA2 coactivator p100testis tissue sperm-binding protein Li 82Ptudor domain-containing protein 11
Modification date2018040320180523
UniProtAcc

A8MUV8

Q7KZF4

Ensembl transtripts involved in fusion geneENST00000550760, ENST00000354725, 
ENST00000467238, 
Fusion gene scores* DoF score2 X 2 X 2=820 X 15 X 10=3000
# samples 221
** MAII scorelog2(2/8*10)=1.32192809488736log2(21/3000*10)=-3.83650126771712
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ZNF727 [Title/Abstract] AND SND1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-55-7995-01AZNF727chr7

63506002

+SND1chr7

127714554

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000550760ENST00000354725ZNF727chr7

63506002

+SND1chr7

127714554

+
5CDS-intronENST00000550760ENST00000467238ZNF727chr7

63506002

+SND1chr7

127714554

+

Top

FusionProtFeatures for ZNF727_SND1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZNF727

A8MUV8

SND1

Q7KZF4

May be involved in transcriptional regulation.{ECO:0000250}. Functions as a bridging factor between STAT6 and thebasal transcription factor. Plays a role in PIM1 regulation of MYBactivity. Functions as a transcriptional coactivator for theEpstein-Barr virus nuclear antigen 2 (EBNA2).{ECO:0000269|PubMed:7651391}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSND1chr7:63506002chr7:127714554ENST00000354725+1524729_787593911DomainTudor

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZNF727chr7:63506002chr7:127714554ENST00000550760+144_751500DomainKRAB
HgeneZNF727chr7:63506002chr7:127714554ENST00000550760+14143_1671500Zinc fingerC2H2-type 1%3B degenerate
HgeneZNF727chr7:63506002chr7:127714554ENST00000550760+14200_2221500Zinc fingerC2H2-type 2
HgeneZNF727chr7:63506002chr7:127714554ENST00000550760+14228_2501500Zinc fingerC2H2-type 3
HgeneZNF727chr7:63506002chr7:127714554ENST00000550760+14256_2781500Zinc fingerC2H2-type 4
HgeneZNF727chr7:63506002chr7:127714554ENST00000550760+14284_3061500Zinc fingerC2H2-type 5
HgeneZNF727chr7:63506002chr7:127714554ENST00000550760+14312_3341500Zinc fingerC2H2-type 6
HgeneZNF727chr7:63506002chr7:127714554ENST00000550760+14340_3621500Zinc fingerC2H2-type 7
HgeneZNF727chr7:63506002chr7:127714554ENST00000550760+14368_3901500Zinc fingerC2H2-type 8
HgeneZNF727chr7:63506002chr7:127714554ENST00000550760+14396_4181500Zinc fingerC2H2-type 9
HgeneZNF727chr7:63506002chr7:127714554ENST00000550760+14424_4461500Zinc fingerC2H2-type 10
HgeneZNF727chr7:63506002chr7:127714554ENST00000550760+14452_4741500Zinc fingerC2H2-type 11
TgeneSND1chr7:63506002chr7:127714554ENST00000354725+152418_166593911DomainTNase-like 1
TgeneSND1chr7:63506002chr7:127714554ENST00000354725+1524193_328593911DomainTNase-like 2
TgeneSND1chr7:63506002chr7:127714554ENST00000354725+1524341_496593911DomainTNase-like 3
TgeneSND1chr7:63506002chr7:127714554ENST00000354725+1524525_660593911DomainTNase-like 4
TgeneSND1chr7:63506002chr7:127714554ENST00000354725+1524321_325593911MotifNuclear localization signal
TgeneSND1chr7:63506002chr7:127714554ENST00000354725+1524388_392593911MotifNuclear localization signal


Top

FusionGeneSequence for ZNF727_SND1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZNF727_ENST00000550760_chr7_63506002_+_SND1_ENST00000354725_chr7_127714554_+_319aa
MVEVEVESMDKAGNFIGWLHIDGANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWAHYEEQPVEEVMPVLEEKERSASY
KPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNREVL
PSTRLGTLSPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHVTLQFADSKGDVGLGLVKEGLVM


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZNF727_ENST00000550760_chr7_63506002_+_SND1_ENST00000354725_chr7_127714554_+_957nt
ATGGTGGAGGTGGAGGTGGAGAGCATGGACAAGGCCGGCAACTTTATCGGCTGGCTGCACATCGACGGTGCCAACCTGTCCGTCCTGCTG
GTGGAGCACGCGCTCTCCAAGGTCCACTTCACCGCCGAACGCAGCTCCTACTACAAGTCCCTGCTGTCTGCCGAGGAGGCCGCAAAGCAG
AAGAAAGAGAAGGTCTGGGCCCACTATGAGGAGCAGCCCGTGGAGGAGGTGATGCCAGTGCTGGAGGAGAAGGAGCGATCTGCTAGCTAC
AAGCCCGTGTTTGTGACTGAGATCACTGATGACCTGCACTTCTACGTGCAGGATGTGGAGACCGGCACCCAGTTGGAGAAGCTGATGGAG
AACATGCGCAATGACATTGCCAGTCACCCCCCTGTAGAGGGCTCCTATGCCCCCCGCAGGGGAGAGTTCTGCATTGCCAAATTTGTAGAT
GGAGAATGGTACCGTGCCCGAGTAGAGAAAGTCGAGTCTCCTGCCAAAATACATGTCTTCTACATTGACTACGGCAACAGAGAGGTCCTG
CCATCCACCCGCCTGGGTACCCTATCACCTGCCTTCAGCACTCGGGTGCTGCCAGCTCAAGCCACGGAGTATGCCTTCGCCTTCATCCAG
GTGCCCCAAGATGATGATGCCCGCACGGACGCCGTGGACAGCGTAGTTCGGGATATCCAGAACACTCAGTGCCTGCTCAACGTGGAACAC
CTGAGTGCCGGCTGCCCCCATGTCACCCTGCAGTTTGCAGATTCCAAGGGCGATGTGGGGCTGGGCTTGGTGAAGGAAGGGCTGGTCATG
GTGGAGGTGCGCAAGGAGAAACAGTTCCAGAAAGTGATCACAGAATACCTGAATGCCCAAGAGTCAGCCAAGAGCGCCAGGCTGAACCTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZNF727_ENST00000550760_chr7_63506002_+_SND1_ENST00000354725_chr7_127714554_+_1685nt
AATATGGCAAGGCCTTCGTCTCCTAGCTTCTAGGCTCTGAGTCCAGTACCCGTCTGTACTATTCCATCTCTTCCGCTCCATTAGCTCCTC
GGTGACTCCACCATAGCCCCTGTTATCCTGTGACCTGCAGGTACTGGGAGATCCATAGGGAAGAAGGCGGAACATCCGGAGGCTGGGAAA
TGGTGGAGGTGGAGGTGGAGAGCATGGACAAGGCCGGCAACTTTATCGGCTGGCTGCACATCGACGGTGCCAACCTGTCCGTCCTGCTGG
TGGAGCACGCGCTCTCCAAGGTCCACTTCACCGCCGAACGCAGCTCCTACTACAAGTCCCTGCTGTCTGCCGAGGAGGCCGCAAAGCAGA
AGAAAGAGAAGGTCTGGGCCCACTATGAGGAGCAGCCCGTGGAGGAGGTGATGCCAGTGCTGGAGGAGAAGGAGCGATCTGCTAGCTACA
AGCCCGTGTTTGTGACTGAGATCACTGATGACCTGCACTTCTACGTGCAGGATGTGGAGACCGGCACCCAGTTGGAGAAGCTGATGGAGA
ACATGCGCAATGACATTGCCAGTCACCCCCCTGTAGAGGGCTCCTATGCCCCCCGCAGGGGAGAGTTCTGCATTGCCAAATTTGTAGATG
GAGAATGGTACCGTGCCCGAGTAGAGAAAGTCGAGTCTCCTGCCAAAATACATGTCTTCTACATTGACTACGGCAACAGAGAGGTCCTGC
CATCCACCCGCCTGGGTACCCTATCACCTGCCTTCAGCACTCGGGTGCTGCCAGCTCAAGCCACGGAGTATGCCTTCGCCTTCATCCAGG
TGCCCCAAGATGATGATGCCCGCACGGACGCCGTGGACAGCGTAGTTCGGGATATCCAGAACACTCAGTGCCTGCTCAACGTGGAACACC
TGAGTGCCGGCTGCCCCCATGTCACCCTGCAGTTTGCAGATTCCAAGGGCGATGTGGGGCTGGGCTTGGTGAAGGAAGGGCTGGTCATGG
TGGAGGTGCGCAAGGAGAAACAGTTCCAGAAAGTGATCACAGAATACCTGAATGCCCAAGAGTCAGCCAAGAGCGCCAGGCTGAACCTGT
GGCGCTATGGAGACTTTCGAGCTGATGATGCAGACGAATTTGGCTACAGCCGCTAAGGAGGGGATCGGGTTTGGCCCCCAGCCCCGCTCA
CGCCAGTCCCTCTTCCTCTGCCGGGAGGGTGTTTTCAACTCCAAACCCCAGAGAGGGGTTGTAGATTGGGTCCAGCTTTGCTTCAGTGTG
TGGAAATGTCTCGTGGGGTGGCATCGGGGCTGCGGGGTGGGGACCCCAAGGCTTTCTGGGGCAGACCCTTGTCCTCTGGGATGATGGGCA
CTGCTATCCACAGTCTCTGCCAGTTGGTTTTATTTGGAGGTTTGTGGGCTTTTTTTAAAAAAAAAAAGTCCTCAAATCAGGAAGAAACAT
CAAAGACTATGTCCTAGTGGAGGGAGTAATCCTAACACCCAGGCTGGCCGCCAGCTGGCACCTGCCTCTATCCCAGACTGCCCTCGTCCC
AGCTCTCTGTCCAACTGTTGATTATGTGATTTTTCTGATACGTCCATTCTCAAATGCCAGTGTGTTCACATCTTCGCTCTGGCCAGCCCA


Top

FusionGenePPI for ZNF727_SND1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZNF727SND1IKBKE, SNW1, RBPJ, GTF2E2, GTF2E1, MYB, PIM1, STAT6, POLR2A, USP22, PDPK1, PRKAA1, UBA5, LZTR1, DHX9, CREBBP, RBM39, SIRT7, CUL3, CDK2, CAND1, APP, RPS3, HNRNPM, TOMM22, RPL19, MYBBP1A, SMNDC1, RPS20, NENF, RPL4, VDAC2, ILF2, SRSF3, HNRNPU, RPN1, HNRNPR, SSR3, FN1, VCAM1, CSNK2A1, ITGA4, G3BP1, PRPF8, RNU1-1, RNU2-1, RNU4-1, RNU6-1, RNU5A-1, MAK, TARDBP, EIF3CL, RPS11, RPS2, RPS6, RPS9, DDX3X, RPL23A, RPL35, RPS16, RPS26, RPS27, RPS3A, SHFM1, LIN28A, HUWE1, RAPGEF2, MDM2, CUL7, OBSL1, CCDC8, UBE2I, ESR1, MMP28, TDRD3, TXNDC5, NTRK1, NPM1, RPL10, CNOT1, MCM2, U2AF2, CDH1, PTP4A1, MTDH, PA2G4, TRAP1, ANXA5, SNRPB2, EIF5B, GPI, IDH2, PDIA3, UBE2N, MRPL12, CRNN, ZNF207, CPNE3, CS, PYGL, SF3A3, DNAJC8, PLS3, CPSF6, NANS, SF3A1, ECHS1, SRP68, MYL12B, AIMP1, CYLD, DLD, DLST, PDHA1, SOD1, TRIM25, BRCA1, YAP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZNF727_SND1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ZNF727_SND1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSND1C0004352Autistic Disorder1CTD_human
TgeneSND1C0024121Lung Neoplasms1CTD_human