FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 43658

FusionGeneSummary for ZNF720_POLN

check button Fusion gene summary
Fusion gene informationFusion gene name: ZNF720_POLN
Fusion gene ID: 43658
HgeneTgene
Gene symbol

ZNF720

POLN

Gene ID

124411

353497

Gene namezinc finger protein 720DNA polymerase nu
Synonyms-POL4P
Cytomap

16p11.2

4p16.3

Type of geneprotein-codingprotein-coding
Descriptionputative protein ZNF720DNA polymerase nuDNA polymerase NDNA polymerase POL4Ppolymerase (DNA directed) nupolymerase (DNA) nu
Modification date2018052220180523
UniProtAcc

Q7Z2F6

Q7Z5Q5

Ensembl transtripts involved in fusion geneENST00000539915, ENST00000316491, 
ENST00000531864, ENST00000399681, 
ENST00000398696, ENST00000534369, 
ENST00000382865, ENST00000511885, 
ENST00000515357, 
Fusion gene scores* DoF score2 X 2 X 2=812 X 7 X 9=756
# samples 212
** MAII scorelog2(2/8*10)=1.32192809488736log2(12/756*10)=-2.65535182861255
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ZNF720 [Title/Abstract] AND POLN [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationDDR (DNA damage repair) gene involved fusion gene, retained protein feature but frameshift.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgenePOLN

GO:0019985

translesion synthesis

20102227


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-69-A59K-01AZNF720chr16

31765221

+POLNchr4

2133017

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000539915ENST00000382865ZNF720chr16

31765221

+POLNchr4

2133017

-
Frame-shiftENST00000539915ENST00000511885ZNF720chr16

31765221

+POLNchr4

2133017

-
5CDS-intronENST00000539915ENST00000515357ZNF720chr16

31765221

+POLNchr4

2133017

-
Frame-shiftENST00000316491ENST00000382865ZNF720chr16

31765221

+POLNchr4

2133017

-
Frame-shiftENST00000316491ENST00000511885ZNF720chr16

31765221

+POLNchr4

2133017

-
5CDS-intronENST00000316491ENST00000515357ZNF720chr16

31765221

+POLNchr4

2133017

-
3UTR-3CDSENST00000531864ENST00000382865ZNF720chr16

31765221

+POLNchr4

2133017

-
3UTR-3CDSENST00000531864ENST00000511885ZNF720chr16

31765221

+POLNchr4

2133017

-
3UTR-intronENST00000531864ENST00000515357ZNF720chr16

31765221

+POLNchr4

2133017

-
Frame-shiftENST00000399681ENST00000382865ZNF720chr16

31765221

+POLNchr4

2133017

-
Frame-shiftENST00000399681ENST00000511885ZNF720chr16

31765221

+POLNchr4

2133017

-
5CDS-intronENST00000399681ENST00000515357ZNF720chr16

31765221

+POLNchr4

2133017

-
In-frameENST00000398696ENST00000382865ZNF720chr16

31765221

+POLNchr4

2133017

-
In-frameENST00000398696ENST00000511885ZNF720chr16

31765221

+POLNchr4

2133017

-
5CDS-intronENST00000398696ENST00000515357ZNF720chr16

31765221

+POLNchr4

2133017

-
intron-3CDSENST00000534369ENST00000382865ZNF720chr16

31765221

+POLNchr4

2133017

-
intron-3CDSENST00000534369ENST00000511885ZNF720chr16

31765221

+POLNchr4

2133017

-
intron-intronENST00000534369ENST00000515357ZNF720chr16

31765221

+POLNchr4

2133017

-

Top

FusionProtFeatures for ZNF720_POLN


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZNF720

Q7Z2F6

POLN

Q7Z5Q5

DNA polymerase with very low fidelity that catalyzesconsiderable misincorporation by inserting dTTP opposite a Gtemplate, and dGTP opposite a T template (PubMed:16787914,PubMed:17118716). Is the least accurate of the DNA polymerase Afamily (i.e. POLG, POLN and POLQ) (PubMed:17118716). Can performaccurate translesion DNA synthesis (TLS) past a 5S-thymine glycol.Can perform efficient strand displacement past a nick or a gap andgives rise to an amount of product similar to that on non-damagedtemplate. Has no exonuclease activity (PubMed:16787914). Error-prone DNA polymerase that preferentially misincorporates dTregardless of template sequence (PubMed:25775266). May play a rolein TLS during interstrand cross-link (ICL) repair(PubMed:19908865). May be involved in TLS when genomic replicationis blocked by extremely large major groove DNA lesions. Mayfunction in the bypass of some DNA-protein and DNA-DNA cross-links. May have a role in cellular tolerance to DNA cross-linkingagents (PubMed:20102227). Involved in the repair of DNA cross-links and double-strand break (DSB) resistance. Participates inFANCD2-mediated repair. Forms a complex with HELQ helicase thatparticipates in homologous recombination (HR) repair and isessential for cellular protection against DNA cross-links(PubMed:19995904). {ECO:0000269|PubMed:16787914,ECO:0000269|PubMed:17118716, ECO:0000269|PubMed:19908865,ECO:0000269|PubMed:19995904, ECO:0000269|PubMed:20102227,ECO:0000269|PubMed:25775266}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ZNF720_POLN


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZNF720_ENST00000398696_chr16_31765221_+_POLN_ENST00000382865_chr4_2133017_-_717aa
MVNVPDIFSHDTQGLLRKKLIEASFQKVILDGYGSCGPQNLNLRKEWESEGKCEGHNGYYDGHTKCKTTTYNKNLTVTGGQKHEKTQFMS
VAFSKPCVSVSKCQHQFLKLTFSFKGNLDNPNSDLVHVSNNHLNQLKYRTGVNVQSNISEKERFKNEEVISKYDQFDGSLLKVCFTNKXH
LVLPVINIERSSFIHHCLINVKEXIIWENITHIIKLXQPLGRTIPXIITSIFVLQRKISTINLIQHXAKAXAPEDIRKLIFYITIANVKN
VRKPFMNAPTMSIRVSLFKRSLPNVISVXKLLSSHQNILSLRESILEKSHTDVIMVRKSLVNCQVXENIRXSIMKRNLTNVKNVTKPLTI
VHTLLNIKXFILERNHTNVKNVAKPSILVHILLNIQGISKHPIQITTPKNFKGKEDKILTISPRAMFVSSKGHTFLAADFSQIELRILTH
LSGDPELLKLFQESERDDVFSTLTSQWKDVPVEQVTHADREQTKKVVYAVVYGAGKERLAACLGVPIQEAAQFLESFLQKYKKIKDFARA
AIAQCHQTGCVVSIMGRRRPLPRIHAHDQQLRAQAERQAVNFVVQGSAADLCKLAMIHVFTAVAASHTLTARLVAQIHDELLFEVEDPQI

>In-frame_ZNF720_ENST00000398696_chr16_31765221_+_POLN_ENST00000511885_chr4_2133017_-_717aa
MVNVPDIFSHDTQGLLRKKLIEASFQKVILDGYGSCGPQNLNLRKEWESEGKCEGHNGYYDGHTKCKTTTYNKNLTVTGGQKHEKTQFMS
VAFSKPCVSVSKCQHQFLKLTFSFKGNLDNPNSDLVHVSNNHLNQLKYRTGVNVQSNISEKERFKNEEVISKYDQFDGSLLKVCFTNKXH
LVLPVINIERSSFIHHCLINVKEXIIWENITHIIKLXQPLGRTIPXIITSIFVLQRKISTINLIQHXAKAXAPEDIRKLIFYITIANVKN
VRKPFMNAPTMSIRVSLFKRSLPNVISVXKLLSSHQNILSLRESILEKSHTDVIMVRKSLVNCQVXENIRXSIMKRNLTNVKNVTKPLTI
VHTLLNIKXFILERNHTNVKNVAKPSILVHILLNIQGISKHPIQITTPKNFKGKEDKILTISPRAMFVSSKGHTFLAADFSQIELRILTH
LSGDPELLKLFQESERDDVFSTLTSQWKDVPVEQVTHADREQTKKVVYAVVYGAGKERLAACLGVPIQEAAQFLESFLQKYKKIKDFARA
AIAQCHQTGCVVSIMGRRRPLPRIHAHDQQLRAQAERQAVNFVVQGSAADLCKLAMIHVFTAVAASHTLTARLVAQIHDELLFEVEDPQI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZNF720_ENST00000398696_chr16_31765221_+_POLN_ENST00000382865_chr4_2133017_-_2151nt
ATGGTGAATGTGCCAGATATCTTTTCTCATGATACTCAAGGCCTCTTAAGAAAGAAGCTTATAGAAGCATCATTCCAAAAAGTGATATTG
GATGGATATGGGAGCTGTGGCCCTCAGAATTTAAACTTAAGGAAAGAGTGGGAAAGTGAGGGTAAGTGTGAAGGTCACAATGGATATTAT
GATGGACATACAAAATGTAAGACAACTACCTATAACAAAAACCTCACTGTTACAGGAGGTCAAAAACATGAAAAAACTCAATTTATGTCA
GTTGCTTTTTCTAAACCATGTGTTTCTGTAAGTAAGTGTCAACATCAATTTTTGAAACTTACCTTTTCTTTTAAAGGAAATTTGGATAAT
CCGAATAGTGACTTAGTCCATGTTTCAAATAATCATTTAAACCAATTAAAATATAGAACTGGAGTAAATGTTCAGTCAAATATTTCTGAA
AAGGAGAGATTTAAAAACGAGGAGGTGATTTCTAAATATGATCAATTTGATGGATCTTTGTTAAAAGTTTGTTTCACCAACAAATAACAC
CTCGTTCTGCCTGTGATCAATATAGAAAGGTCTTCATTCATTCATCATTGCTTAATCAATGTCAAGGAATAGATAATTTGGGAAAATATC
ACACACATAATAAAACTTTGACAGCCTTTAGGCAGGACTATACCCTAAATAATTACCAGTATATTTGTGTTGCAGAGAAAAATCAGTACA
ATAAATCTGATACAACATTAAGCCAAGGCATAAGCCCCAGAAGACATCAGAAAACTCATTTTCTACATAACCATTGCAAACGTAAAAAAT
GTGAGAAAGCCTTTCATGAATGCACCAACCATGTCCATCAGAGTATCTTTATTCAAGAGAAGTCTGCCAAATGTAATAAGTGTATAGAAA
CTTTTATCCAGTCATCAAAACATACTCAGCCTCAGAGAATCCATATTGGAGAAAAGTCACACAGATGTAATAATGGTGAGAAAATCCTTA
GTAAATTGTCAAGTCTAAGAAAACATAAGATAATCCATAATGAAGAGAAACCTTACAAATGTAAAGAATGTGACAAAGCCTTTAACCATC
GTTCACACCTTACTCAACATCAAATAATTCATACTGGAGAGAAACCATACAAATGTAAAGAATGTGGCAAAGCCTTCAATTCTAGTTCAT
ATTTTACTAAATATCCAAGGTATCTCCAAGCACCCAATTCAGATTACTACACCTAAGAATTTTAAAGGTAAAGAAGACAAGATTCTCACG
ATCTCCCCGAGGGCCATGTTTGTTTCATCCAAAGGCCACACCTTTCTAGCAGCAGACTTTTCACAGATTGAATTGCGCATTCTTACACAT
TTATCTGGAGATCCGGAACTTCTGAAGTTATTCCAGGAATCTGAAAGAGATGATGTATTTTCTACTCTGACTTCACAGTGGAAGGATGTG
CCCGTGGAACAGGTGACACACGCAGACAGAGAGCAAACCAAGAAGGTGGTGTACGCGGTGGTCTATGGAGCAGGGAAGGAGCGGCTGGCT
GCTTGCCTTGGAGTTCCTATTCAGGAAGCTGCCCAGTTTTTGGAGAGTTTTTTGCAGAAGTACAAGAAAATCAAGGACTTCGCCCGAGCA
GCTATTGCCCAGTGTCACCAGACAGGCTGTGTGGTGTCCATCATGGGCAGAAGGAGACCCCTGCCAAGGATTCACGCTCATGACCAGCAA
CTCCGGGCACAAGCAGAGCGACAGGCAGTGAACTTCGTGGTGCAAGGCTCCGCTGCTGACCTCTGCAAGCTGGCCATGATCCATGTCTTC
ACTGCAGTGGCTGCTTCCCACACCTTGACGGCCAGGCTGGTGGCCCAGATCCATGATGAGCTGCTGTTTGAAGTGGAAGATCCGCAGATC
CCGGAGTGTGCAGCTCTCGTCAGGAGGACCATGGAGTCCTTGGAACAGGTGCAGGCATTGGAGCTGCAGCTTCAGGTACCCCTCAAGGTG
AGCCTGAGTGCCGGCCGCTCATGGGGACACCTGGTGCCACTGCAGGAGGCCTGGGGCCCTCCGCCAGGCCCATGTCGCACTGAGTCTCCC

>In-frame_ZNF720_ENST00000398696_chr16_31765221_+_POLN_ENST00000511885_chr4_2133017_-_2151nt
ATGGTGAATGTGCCAGATATCTTTTCTCATGATACTCAAGGCCTCTTAAGAAAGAAGCTTATAGAAGCATCATTCCAAAAAGTGATATTG
GATGGATATGGGAGCTGTGGCCCTCAGAATTTAAACTTAAGGAAAGAGTGGGAAAGTGAGGGTAAGTGTGAAGGTCACAATGGATATTAT
GATGGACATACAAAATGTAAGACAACTACCTATAACAAAAACCTCACTGTTACAGGAGGTCAAAAACATGAAAAAACTCAATTTATGTCA
GTTGCTTTTTCTAAACCATGTGTTTCTGTAAGTAAGTGTCAACATCAATTTTTGAAACTTACCTTTTCTTTTAAAGGAAATTTGGATAAT
CCGAATAGTGACTTAGTCCATGTTTCAAATAATCATTTAAACCAATTAAAATATAGAACTGGAGTAAATGTTCAGTCAAATATTTCTGAA
AAGGAGAGATTTAAAAACGAGGAGGTGATTTCTAAATATGATCAATTTGATGGATCTTTGTTAAAAGTTTGTTTCACCAACAAATAACAC
CTCGTTCTGCCTGTGATCAATATAGAAAGGTCTTCATTCATTCATCATTGCTTAATCAATGTCAAGGAATAGATAATTTGGGAAAATATC
ACACACATAATAAAACTTTGACAGCCTTTAGGCAGGACTATACCCTAAATAATTACCAGTATATTTGTGTTGCAGAGAAAAATCAGTACA
ATAAATCTGATACAACATTAAGCCAAGGCATAAGCCCCAGAAGACATCAGAAAACTCATTTTCTACATAACCATTGCAAACGTAAAAAAT
GTGAGAAAGCCTTTCATGAATGCACCAACCATGTCCATCAGAGTATCTTTATTCAAGAGAAGTCTGCCAAATGTAATAAGTGTATAGAAA
CTTTTATCCAGTCATCAAAACATACTCAGCCTCAGAGAATCCATATTGGAGAAAAGTCACACAGATGTAATAATGGTGAGAAAATCCTTA
GTAAATTGTCAAGTCTAAGAAAACATAAGATAATCCATAATGAAGAGAAACCTTACAAATGTAAAGAATGTGACAAAGCCTTTAACCATC
GTTCACACCTTACTCAACATCAAATAATTCATACTGGAGAGAAACCATACAAATGTAAAGAATGTGGCAAAGCCTTCAATTCTAGTTCAT
ATTTTACTAAATATCCAAGGTATCTCCAAGCACCCAATTCAGATTACTACACCTAAGAATTTTAAAGGTAAAGAAGACAAGATTCTCACG
ATCTCCCCGAGGGCCATGTTTGTTTCATCCAAAGGCCACACCTTTCTAGCAGCAGACTTTTCACAGATTGAATTGCGCATTCTTACACAT
TTATCTGGAGATCCGGAACTTCTGAAGTTATTCCAGGAATCTGAAAGAGATGATGTATTTTCTACTCTGACTTCACAGTGGAAGGATGTG
CCCGTGGAACAGGTGACACACGCAGACAGAGAGCAAACCAAGAAGGTGGTGTACGCGGTGGTCTATGGAGCAGGGAAGGAGCGGCTGGCT
GCTTGCCTTGGAGTTCCTATTCAGGAAGCTGCCCAGTTTTTGGAGAGTTTTTTGCAGAAGTACAAGAAAATCAAGGACTTCGCCCGAGCA
GCTATTGCCCAGTGTCACCAGACAGGCTGTGTGGTGTCCATCATGGGCAGAAGGAGACCCCTGCCAAGGATTCACGCTCATGACCAGCAA
CTCCGGGCACAAGCAGAGCGACAGGCAGTGAACTTCGTGGTGCAAGGCTCCGCTGCTGACCTCTGCAAGCTGGCCATGATCCATGTCTTC
ACTGCAGTGGCTGCTTCCCACACCTTGACGGCCAGGCTGGTGGCCCAGATCCATGATGAGCTGCTGTTTGAAGTGGAAGATCCGCAGATC
CCGGAGTGTGCAGCTCTCGTCAGGAGGACCATGGAGTCCTTGGAACAGGTGCAGGCATTGGAGCTGCAGCTTCAGGTACCCCTCAAGGTG
AGCCTGAGTGCCGGCCGCTCATGGGGACACCTGGTGCCACTGCAGGAGGCCTGGGGCCCTCCGCCAGGCCCATGTCGCACTGAGTCTCCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZNF720_ENST00000398696_chr16_31765221_+_POLN_ENST00000382865_chr4_2133017_-_2340nt
CAGGAGATGATATCTTTTCTCATGATACTCAAGGCCTCTTAAGAAAGAAGCTTATAGAAGCATCATTCCAAAAAGTGATATTGGATGGAT
ATGGGAGCTGTGGCCCTCAGAATTTAAACTTAAGGAAAGAGTGGGAAAGTGAGGGTAAGTGTGAAGGTCACAATGGATATTATGATGGAC
ATACAAAATGTAAGACAACTACCTATAACAAAAACCTCACTGTTACAGGAGGTCAAAAACATGAAAAAACTCAATTTATGTCAGTTGCTT
TTTCTAAACCATGTGTTTCTGTAAGTAAGTGTCAACATCAATTTTTGAAACTTACCTTTTCTTTTAAAGGAAATTTGGATAATCCGAATA
GTGACTTAGTCCATGTTTCAAATAATCATTTAAACCAATTAAAATATAGAACTGGAGTAAATGTTCAGTCAAATATTTCTGAAAAGGAGA
GATTTAAAAACGAGGAGGTGATTTCTAAATATGATCAATTTGATGGATCTTTGTTAAAAGTTTGTTTCACCAACAAATAACACCTCGTTC
TGCCTGTGATCAATATAGAAAGGTCTTCATTCATTCATCATTGCTTAATCAATGTCAAGGAATAGATAATTTGGGAAAATATCACACACA
TAATAAAACTTTGACAGCCTTTAGGCAGGACTATACCCTAAATAATTACCAGTATATTTGTGTTGCAGAGAAAAATCAGTACAATAAATC
TGATACAACATTAAGCCAAGGCATAAGCCCCAGAAGACATCAGAAAACTCATTTTCTACATAACCATTGCAAACGTAAAAAATGTGAGAA
AGCCTTTCATGAATGCACCAACCATGTCCATCAGAGTATCTTTATTCAAGAGAAGTCTGCCAAATGTAATAAGTGTATAGAAACTTTTAT
CCAGTCATCAAAACATACTCAGCCTCAGAGAATCCATATTGGAGAAAAGTCACACAGATGTAATAATGGTGAGAAAATCCTTAGTAAATT
GTCAAGTCTAAGAAAACATAAGATAATCCATAATGAAGAGAAACCTTACAAATGTAAAGAATGTGACAAAGCCTTTAACCATCGTTCACA
CCTTACTCAACATCAAATAATTCATACTGGAGAGAAACCATACAAATGTAAAGAATGTGGCAAAGCCTTCAATTCTAGTTCATATTTTAC
TAAATATCCAAGGTATCTCCAAGCACCCAATTCAGATTACTACACCTAAGAATTTTAAAGGTAAAGAAGACAAGATTCTCACGATCTCCC
CGAGGGCCATGTTTGTTTCATCCAAAGGCCACACCTTTCTAGCAGCAGACTTTTCACAGATTGAATTGCGCATTCTTACACATTTATCTG
GAGATCCGGAACTTCTGAAGTTATTCCAGGAATCTGAAAGAGATGATGTATTTTCTACTCTGACTTCACAGTGGAAGGATGTGCCCGTGG
AACAGGTGACACACGCAGACAGAGAGCAAACCAAGAAGGTGGTGTACGCGGTGGTCTATGGAGCAGGGAAGGAGCGGCTGGCTGCTTGCC
TTGGAGTTCCTATTCAGGAAGCTGCCCAGTTTTTGGAGAGTTTTTTGCAGAAGTACAAGAAAATCAAGGACTTCGCCCGAGCAGCTATTG
CCCAGTGTCACCAGACAGGCTGTGTGGTGTCCATCATGGGCAGAAGGAGACCCCTGCCAAGGATTCACGCTCATGACCAGCAACTCCGGG
CACAAGCAGAGCGACAGGCAGTGAACTTCGTGGTGCAAGGCTCCGCTGCTGACCTCTGCAAGCTGGCCATGATCCATGTCTTCACTGCAG
TGGCTGCTTCCCACACCTTGACGGCCAGGCTGGTGGCCCAGATCCATGATGAGCTGCTGTTTGAAGTGGAAGATCCGCAGATCCCGGAGT
GTGCAGCTCTCGTCAGGAGGACCATGGAGTCCTTGGAACAGGTGCAGGCATTGGAGCTGCAGCTTCAGGTACCCCTCAAGGTGAGCCTGA
GTGCCGGCCGCTCATGGGGACACCTGGTGCCACTGCAGGAGGCCTGGGGCCCTCCGCCAGGCCCATGTCGCACTGAGTCTCCCAGCAACA
GCCTGGCTGCCCCTGGGTCCCCTGCCAGCACCCAGCCCCCACCCCTGCATTTTTCGCCTTCATTTTGTCTGTAGCCCCAGGCAACAGTGG
GAGGAGAGAACTGGTTTCCAGCAGTCCATTGTGTGGCCTTCCCCAAGGTCACCAGCTCTGTACGCCCCAGGACGCATTAACCCTTTGGGG
CTGGGGTGGCCCGCCATCCCCTGGAGTAAATGCCTGTGCAAAGCCCTCCTCATCCTTGTCTGAGTGAATTCTTCCTGTGAGTGGGAAGTG

>In-frame_ZNF720_ENST00000398696_chr16_31765221_+_POLN_ENST00000511885_chr4_2133017_-_2340nt
CAGGAGATGATATCTTTTCTCATGATACTCAAGGCCTCTTAAGAAAGAAGCTTATAGAAGCATCATTCCAAAAAGTGATATTGGATGGAT
ATGGGAGCTGTGGCCCTCAGAATTTAAACTTAAGGAAAGAGTGGGAAAGTGAGGGTAAGTGTGAAGGTCACAATGGATATTATGATGGAC
ATACAAAATGTAAGACAACTACCTATAACAAAAACCTCACTGTTACAGGAGGTCAAAAACATGAAAAAACTCAATTTATGTCAGTTGCTT
TTTCTAAACCATGTGTTTCTGTAAGTAAGTGTCAACATCAATTTTTGAAACTTACCTTTTCTTTTAAAGGAAATTTGGATAATCCGAATA
GTGACTTAGTCCATGTTTCAAATAATCATTTAAACCAATTAAAATATAGAACTGGAGTAAATGTTCAGTCAAATATTTCTGAAAAGGAGA
GATTTAAAAACGAGGAGGTGATTTCTAAATATGATCAATTTGATGGATCTTTGTTAAAAGTTTGTTTCACCAACAAATAACACCTCGTTC
TGCCTGTGATCAATATAGAAAGGTCTTCATTCATTCATCATTGCTTAATCAATGTCAAGGAATAGATAATTTGGGAAAATATCACACACA
TAATAAAACTTTGACAGCCTTTAGGCAGGACTATACCCTAAATAATTACCAGTATATTTGTGTTGCAGAGAAAAATCAGTACAATAAATC
TGATACAACATTAAGCCAAGGCATAAGCCCCAGAAGACATCAGAAAACTCATTTTCTACATAACCATTGCAAACGTAAAAAATGTGAGAA
AGCCTTTCATGAATGCACCAACCATGTCCATCAGAGTATCTTTATTCAAGAGAAGTCTGCCAAATGTAATAAGTGTATAGAAACTTTTAT
CCAGTCATCAAAACATACTCAGCCTCAGAGAATCCATATTGGAGAAAAGTCACACAGATGTAATAATGGTGAGAAAATCCTTAGTAAATT
GTCAAGTCTAAGAAAACATAAGATAATCCATAATGAAGAGAAACCTTACAAATGTAAAGAATGTGACAAAGCCTTTAACCATCGTTCACA
CCTTACTCAACATCAAATAATTCATACTGGAGAGAAACCATACAAATGTAAAGAATGTGGCAAAGCCTTCAATTCTAGTTCATATTTTAC
TAAATATCCAAGGTATCTCCAAGCACCCAATTCAGATTACTACACCTAAGAATTTTAAAGGTAAAGAAGACAAGATTCTCACGATCTCCC
CGAGGGCCATGTTTGTTTCATCCAAAGGCCACACCTTTCTAGCAGCAGACTTTTCACAGATTGAATTGCGCATTCTTACACATTTATCTG
GAGATCCGGAACTTCTGAAGTTATTCCAGGAATCTGAAAGAGATGATGTATTTTCTACTCTGACTTCACAGTGGAAGGATGTGCCCGTGG
AACAGGTGACACACGCAGACAGAGAGCAAACCAAGAAGGTGGTGTACGCGGTGGTCTATGGAGCAGGGAAGGAGCGGCTGGCTGCTTGCC
TTGGAGTTCCTATTCAGGAAGCTGCCCAGTTTTTGGAGAGTTTTTTGCAGAAGTACAAGAAAATCAAGGACTTCGCCCGAGCAGCTATTG
CCCAGTGTCACCAGACAGGCTGTGTGGTGTCCATCATGGGCAGAAGGAGACCCCTGCCAAGGATTCACGCTCATGACCAGCAACTCCGGG
CACAAGCAGAGCGACAGGCAGTGAACTTCGTGGTGCAAGGCTCCGCTGCTGACCTCTGCAAGCTGGCCATGATCCATGTCTTCACTGCAG
TGGCTGCTTCCCACACCTTGACGGCCAGGCTGGTGGCCCAGATCCATGATGAGCTGCTGTTTGAAGTGGAAGATCCGCAGATCCCGGAGT
GTGCAGCTCTCGTCAGGAGGACCATGGAGTCCTTGGAACAGGTGCAGGCATTGGAGCTGCAGCTTCAGGTACCCCTCAAGGTGAGCCTGA
GTGCCGGCCGCTCATGGGGACACCTGGTGCCACTGCAGGAGGCCTGGGGCCCTCCGCCAGGCCCATGTCGCACTGAGTCTCCCAGCAACA
GCCTGGCTGCCCCTGGGTCCCCTGCCAGCACCCAGCCCCCACCCCTGCATTTTTCGCCTTCATTTTGTCTGTAGCCCCAGGCAACAGTGG
GAGGAGAGAACTGGTTTCCAGCAGTCCATTGTGTGGCCTTCCCCAAGGTCACCAGCTCTGTACGCCCCAGGACGCATTAACCCTTTGGGG
CTGGGGTGGCCCGCCATCCCCTGGAGTAAATGCCTGTGCAAAGCCCTCCTCATCCTTGTCTGAGTGAATTCTTCCTGTGAGTGGGAAGTG


Top

FusionGenePPI for ZNF720_POLN


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZNF720APP, TRIM28POLNATR, FANCD2, POLDIP2, FANCA, FANCG, PCNA, FANCI, RAD51, HELQ, RAD18, BRCA1, BARD1, PALB2, BRCA2, BRIP1, RBBP8


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZNF720_POLN


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ZNF720_POLN


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource