FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 43189

FusionGeneSummary for ZNF302_ANKRD27

check button Fusion gene summary
Fusion gene informationFusion gene name: ZNF302_ANKRD27
Fusion gene ID: 43189
HgeneTgene
Gene symbol

ZNF302

ANKRD27

Gene ID

55900

84079

Gene namezinc finger protein 302ankyrin repeat domain 27
SynonymsHSD16|MST154|MSTP154|ZNF135L|ZNF140L|ZNF327PP12899|VARP
Cytomap

19q13.11

19q13.11

Type of geneprotein-codingprotein-coding
Descriptionzinc finger protein 302zinc finger protein 327ankyrin repeat domain-containing protein 27VPS9 domain-containing proteinVPS9-ankyrin-repeat proteinVps9 domain and ankyrin-repeat-containing proteinankyrin repeat domain 27 (VPS9 domain)
Modification date2018052320180523
UniProtAcc

Q9NR11

Q96NW4

Ensembl transtripts involved in fusion geneENST00000509528, ENST00000457781, 
ENST00000505242, ENST00000423823, 
ENST00000507959, ENST00000446502, 
ENST00000505365, 
ENST00000306065, 
ENST00000587352, 
Fusion gene scores* DoF score3 X 2 X 3=184 X 5 X 3=60
# samples 37
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(7/60*10)=0.222392421336448
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ZNF302 [Title/Abstract] AND ANKRD27 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneANKRD27

GO:0035544

negative regulation of SNARE complex assembly

24856514

TgeneANKRD27

GO:0045022

early endosome to late endosome transport

16525121


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCECTCGA-D1-A3JP-01AZNF302chr19

35169718

+ANKRD27chr19

33098738

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000509528ENST00000306065ZNF302chr19

35169718

+ANKRD27chr19

33098738

-
5CDS-intronENST00000509528ENST00000587352ZNF302chr19

35169718

+ANKRD27chr19

33098738

-
In-frameENST00000457781ENST00000306065ZNF302chr19

35169718

+ANKRD27chr19

33098738

-
5CDS-intronENST00000457781ENST00000587352ZNF302chr19

35169718

+ANKRD27chr19

33098738

-
In-frameENST00000505242ENST00000306065ZNF302chr19

35169718

+ANKRD27chr19

33098738

-
5CDS-intronENST00000505242ENST00000587352ZNF302chr19

35169718

+ANKRD27chr19

33098738

-
In-frameENST00000423823ENST00000306065ZNF302chr19

35169718

+ANKRD27chr19

33098738

-
5CDS-intronENST00000423823ENST00000587352ZNF302chr19

35169718

+ANKRD27chr19

33098738

-
In-frameENST00000507959ENST00000306065ZNF302chr19

35169718

+ANKRD27chr19

33098738

-
5CDS-intronENST00000507959ENST00000587352ZNF302chr19

35169718

+ANKRD27chr19

33098738

-
In-frameENST00000446502ENST00000306065ZNF302chr19

35169718

+ANKRD27chr19

33098738

-
5CDS-intronENST00000446502ENST00000587352ZNF302chr19

35169718

+ANKRD27chr19

33098738

-
In-frameENST00000505365ENST00000306065ZNF302chr19

35169718

+ANKRD27chr19

33098738

-
5CDS-intronENST00000505365ENST00000587352ZNF302chr19

35169718

+ANKRD27chr19

33098738

-

Top

FusionProtFeatures for ZNF302_ANKRD27


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZNF302

Q9NR11

ANKRD27

Q96NW4

May be involved in transcriptional regulation. May be a guanine exchange factor (GEF) for Rab21, Rab32and Rab38 and regulate endosome dynamics (PubMed:16525121,PubMed:18477474). May regulate the participation of VAMP7 inmembrane fusion events; in vitro inhibits VAMP7-mediated SNAREcomplex formation by trapping VAMP7 in a closed, fusogenicallyinactive conformation (PubMed:23104059). Involved in peripheralmelanosomal distribution of TYRP1 in melanocytes; the function,which probably is implicating vesicle-trafficking, includescooperation with Rab32, Rab38 and VAMP7 (By similarity). Involvedin the regulation of neurite growth; the function seems to requireits GEF activity, probably towards Rab21, and VAMP7 but notRab32/38 (By similarity). Proposed to be involved in Golgi sortingof VAMP7 and transport of VAMP7 vesicles to the cell surface; thefunction seems to implicate kinesin heavy chain isoform 5proteins, GOLGA4, RAB21 and MACF1 (PubMed:22705394). Required forthe colocalization of VAMP7 and Rab21, probably on TGN sites(PubMed:19745841). Involved in GLUT1 endosome-to-plasma membranetrafficking; the function is dependent of association with VPS29(PubMed:24856514). Regulates the proper trafficking of melanogenicenzymes TYR, TYRP1 and DCT/TYRP2 to melanosomes in melanocytes (Bysimilarity). {ECO:0000250|UniProtKB:Q3UMR0,ECO:0000269|PubMed:23104059, ECO:0000269|PubMed:24856514,ECO:0000305|PubMed:16525121, ECO:0000305|PubMed:18477474,ECO:0000305|PubMed:22705394}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneANKRD27chr19:35169718chr19:33098738ENST00000306065-2129743_7727251051RepeatNote=ANK 8
TgeneANKRD27chr19:35169718chr19:33098738ENST00000306065-2129776_8057251051RepeatNote=ANK 9
TgeneANKRD27chr19:35169718chr19:33098738ENST00000306065-2129809_8387251051RepeatNote=ANK 10
TgeneANKRD27chr19:35169718chr19:33098738ENST00000306065-2129842_8717251051RepeatNote=ANK 11

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZNF302chr19:35169718chr19:33098738ENST00000423823+254_753400DomainKRAB
HgeneZNF302chr19:35169718chr19:33098738ENST00000457781+254_753400DomainKRAB
HgeneZNF302chr19:35169718chr19:33098738ENST00000505242+254_753400DomainKRAB
HgeneZNF302chr19:35169718chr19:33098738ENST00000423823+25280_3023400Zinc fingerC2H2-type 1
HgeneZNF302chr19:35169718chr19:33098738ENST00000423823+25308_3303400Zinc fingerC2H2-type 2
HgeneZNF302chr19:35169718chr19:33098738ENST00000423823+25336_3583400Zinc fingerC2H2-type 3
HgeneZNF302chr19:35169718chr19:33098738ENST00000423823+25364_3863400Zinc fingerC2H2-type 4
HgeneZNF302chr19:35169718chr19:33098738ENST00000423823+25392_4143400Zinc fingerC2H2-type 5
HgeneZNF302chr19:35169718chr19:33098738ENST00000423823+25420_4423400Zinc fingerC2H2-type 6
HgeneZNF302chr19:35169718chr19:33098738ENST00000423823+25448_4703400Zinc fingerC2H2-type 7
HgeneZNF302chr19:35169718chr19:33098738ENST00000457781+25280_3023400Zinc fingerC2H2-type 1
HgeneZNF302chr19:35169718chr19:33098738ENST00000457781+25308_3303400Zinc fingerC2H2-type 2
HgeneZNF302chr19:35169718chr19:33098738ENST00000457781+25336_3583400Zinc fingerC2H2-type 3
HgeneZNF302chr19:35169718chr19:33098738ENST00000457781+25364_3863400Zinc fingerC2H2-type 4
HgeneZNF302chr19:35169718chr19:33098738ENST00000457781+25392_4143400Zinc fingerC2H2-type 5
HgeneZNF302chr19:35169718chr19:33098738ENST00000457781+25420_4423400Zinc fingerC2H2-type 6
HgeneZNF302chr19:35169718chr19:33098738ENST00000457781+25448_4703400Zinc fingerC2H2-type 7
HgeneZNF302chr19:35169718chr19:33098738ENST00000505242+25280_3023400Zinc fingerC2H2-type 1
HgeneZNF302chr19:35169718chr19:33098738ENST00000505242+25308_3303400Zinc fingerC2H2-type 2
HgeneZNF302chr19:35169718chr19:33098738ENST00000505242+25336_3583400Zinc fingerC2H2-type 3
HgeneZNF302chr19:35169718chr19:33098738ENST00000505242+25364_3863400Zinc fingerC2H2-type 4
HgeneZNF302chr19:35169718chr19:33098738ENST00000505242+25392_4143400Zinc fingerC2H2-type 5
HgeneZNF302chr19:35169718chr19:33098738ENST00000505242+25420_4423400Zinc fingerC2H2-type 6
HgeneZNF302chr19:35169718chr19:33098738ENST00000505242+25448_4703400Zinc fingerC2H2-type 7
TgeneANKRD27chr19:35169718chr19:33098738ENST00000306065-2129233_3717251051DomainVPS9
TgeneANKRD27chr19:35169718chr19:33098738ENST00000306065-21291_3727251051RegionSufficient for GEF activity towards RAB21
TgeneANKRD27chr19:35169718chr19:33098738ENST00000306065-2129396_4267251051RepeatNote=ANK 1
TgeneANKRD27chr19:35169718chr19:33098738ENST00000306065-2129462_4917251051RepeatNote=ANK 2
TgeneANKRD27chr19:35169718chr19:33098738ENST00000306065-2129495_5247251051RepeatNote=ANK 3
TgeneANKRD27chr19:35169718chr19:33098738ENST00000306065-2129528_5607251051RepeatNote=ANK 4
TgeneANKRD27chr19:35169718chr19:33098738ENST00000306065-2129564_5937251051RepeatNote=ANK 5
TgeneANKRD27chr19:35169718chr19:33098738ENST00000306065-2129597_6277251051RepeatNote=ANK 6
TgeneANKRD27chr19:35169718chr19:33098738ENST00000306065-2129668_6987251051RepeatNote=ANK 7


Top

FusionGeneSequence for ZNF302_ANKRD27


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZNF302_ENST00000509528_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_329aa
MSQRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNT
PLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCVAS
LDDVAETDRKEYVTVKIRKKWNSKLYDLPDEPFTRQFYFVHSAGQFKGKTSREIMARDRSVPNLTEGSLHEPGRQSVTLRQNNLPAQSGS

>In-frame_ZNF302_ENST00000457781_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_329aa
MSQRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNT
PLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCVAS
LDDVAETDRKEYVTVKIRKKWNSKLYDLPDEPFTRQFYFVHSAGQFKGKTSREIMARDRSVPNLTEGSLHEPGRQSVTLRQNNLPAQSGS

>In-frame_ZNF302_ENST00000505242_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_329aa
MSQRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNT
PLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCVAS
LDDVAETDRKEYVTVKIRKKWNSKLYDLPDEPFTRQFYFVHSAGQFKGKTSREIMARDRSVPNLTEGSLHEPGRQSVTLRQNNLPAQSGS

>In-frame_ZNF302_ENST00000423823_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_329aa
MSQRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNT
PLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCVAS
LDDVAETDRKEYVTVKIRKKWNSKLYDLPDEPFTRQFYFVHSAGQFKGKTSREIMARDRSVPNLTEGSLHEPGRQSVTLRQNNLPAQSGS

>In-frame_ZNF302_ENST00000507959_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_329aa
MSQRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNT
PLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCVAS
LDDVAETDRKEYVTVKIRKKWNSKLYDLPDEPFTRQFYFVHSAGQFKGKTSREIMARDRSVPNLTEGSLHEPGRQSVTLRQNNLPAQSGS

>In-frame_ZNF302_ENST00000446502_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_329aa
MSQRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNT
PLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCVAS
LDDVAETDRKEYVTVKIRKKWNSKLYDLPDEPFTRQFYFVHSAGQFKGKTSREIMARDRSVPNLTEGSLHEPGRQSVTLRQNNLPAQSGS

>In-frame_ZNF302_ENST00000505365_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_329aa
MSQRLAKVPASGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNT
PLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCVAS
LDDVAETDRKEYVTVKIRKKWNSKLYDLPDEPFTRQFYFVHSAGQFKGKTSREIMARDRSVPNLTEGSLHEPGRQSVTLRQNNLPAQSGS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZNF302_ENST00000509528_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_987nt
ATGTCTCAGAGGCTGGCGAAGGTTCCTGCCAGTGGGCTTGGTGTGAACGTGACCAGCCAGGACGGCTCCTCCCCGCTGCATGTCGCCGCC
CTGCACGGCCGGGCGGACCTCATCCCCCTCCTGCTGAAGCACGGGGCCAACGCAGGTGCCAGGAACGCAGACCAAGCCGTCCCGCTCCAC
CTGGCCTGCCAGCAGGGCCACTTTCAGGTGGTGAAGTGTCTGTTAGATTCGAATGCAAAACCCAATAAGAAGGACCTCAGTGGAAACACG
CCCCTCATTTACGCCTGCTCCGGTGGCCATCACGAGCTTGTGGCACTGCTGCTACAGCACGGGGCCTCCATTAACGCTTCTAACAATAAG
GGCAACACAGCGCTGCACGAGGCTGTGATTGAAAAGCACGTCTTCGTGGTAGAGCTGCTTCTGCTCCACGGAGCGTCAGTTCAGGTGCTG
AACAAGCGGCAGCGCACGGCTGTAGACTGTGCTGAACAGAATTCAAAAATAATGGAATTGCTTCAGGTGGTACCAAGCTGTGTTGCTTCA
TTAGATGATGTGGCTGAAACTGACCGCAAGGAGTATGTCACTGTTAAGATCAGGAAAAAATGGAACTCAAAACTGTATGATCTACCAGAT
GAGCCTTTTACAAGACAGTTTTACTTTGTCCACTCAGCTGGTCAGTTTAAGGGAAAGACTTCAAGGGAGATTATGGCAAGAGATAGAAGT
GTCCCTAATTTAACCGAAGGTTCTTTGCATGAGCCAGGGAGGCAAAGTGTCACACTGAGACAGAATAACCTGCCAGCTCAGAGTGGATCT
CATGCTGCTGAGAAAGGCAACAGCGACTGGCCAGAGAGGCCTGGACTGACACAGACTGGCCCTGGACACAGACGGATGCTGCGGAGACAC

>In-frame_ZNF302_ENST00000457781_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_987nt
ATGTCTCAGAGGCTGGCGAAGGTTCCTGCCAGTGGGCTTGGTGTGAACGTGACCAGCCAGGACGGCTCCTCCCCGCTGCATGTCGCCGCC
CTGCACGGCCGGGCGGACCTCATCCCCCTCCTGCTGAAGCACGGGGCCAACGCAGGTGCCAGGAACGCAGACCAAGCCGTCCCGCTCCAC
CTGGCCTGCCAGCAGGGCCACTTTCAGGTGGTGAAGTGTCTGTTAGATTCGAATGCAAAACCCAATAAGAAGGACCTCAGTGGAAACACG
CCCCTCATTTACGCCTGCTCCGGTGGCCATCACGAGCTTGTGGCACTGCTGCTACAGCACGGGGCCTCCATTAACGCTTCTAACAATAAG
GGCAACACAGCGCTGCACGAGGCTGTGATTGAAAAGCACGTCTTCGTGGTAGAGCTGCTTCTGCTCCACGGAGCGTCAGTTCAGGTGCTG
AACAAGCGGCAGCGCACGGCTGTAGACTGTGCTGAACAGAATTCAAAAATAATGGAATTGCTTCAGGTGGTACCAAGCTGTGTTGCTTCA
TTAGATGATGTGGCTGAAACTGACCGCAAGGAGTATGTCACTGTTAAGATCAGGAAAAAATGGAACTCAAAACTGTATGATCTACCAGAT
GAGCCTTTTACAAGACAGTTTTACTTTGTCCACTCAGCTGGTCAGTTTAAGGGAAAGACTTCAAGGGAGATTATGGCAAGAGATAGAAGT
GTCCCTAATTTAACCGAAGGTTCTTTGCATGAGCCAGGGAGGCAAAGTGTCACACTGAGACAGAATAACCTGCCAGCTCAGAGTGGATCT
CATGCTGCTGAGAAAGGCAACAGCGACTGGCCAGAGAGGCCTGGACTGACACAGACTGGCCCTGGACACAGACGGATGCTGCGGAGACAC

>In-frame_ZNF302_ENST00000505242_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_987nt
ATGTCTCAGAGGCTGGCGAAGGTTCCTGCCAGTGGGCTTGGTGTGAACGTGACCAGCCAGGACGGCTCCTCCCCGCTGCATGTCGCCGCC
CTGCACGGCCGGGCGGACCTCATCCCCCTCCTGCTGAAGCACGGGGCCAACGCAGGTGCCAGGAACGCAGACCAAGCCGTCCCGCTCCAC
CTGGCCTGCCAGCAGGGCCACTTTCAGGTGGTGAAGTGTCTGTTAGATTCGAATGCAAAACCCAATAAGAAGGACCTCAGTGGAAACACG
CCCCTCATTTACGCCTGCTCCGGTGGCCATCACGAGCTTGTGGCACTGCTGCTACAGCACGGGGCCTCCATTAACGCTTCTAACAATAAG
GGCAACACAGCGCTGCACGAGGCTGTGATTGAAAAGCACGTCTTCGTGGTAGAGCTGCTTCTGCTCCACGGAGCGTCAGTTCAGGTGCTG
AACAAGCGGCAGCGCACGGCTGTAGACTGTGCTGAACAGAATTCAAAAATAATGGAATTGCTTCAGGTGGTACCAAGCTGTGTTGCTTCA
TTAGATGATGTGGCTGAAACTGACCGCAAGGAGTATGTCACTGTTAAGATCAGGAAAAAATGGAACTCAAAACTGTATGATCTACCAGAT
GAGCCTTTTACAAGACAGTTTTACTTTGTCCACTCAGCTGGTCAGTTTAAGGGAAAGACTTCAAGGGAGATTATGGCAAGAGATAGAAGT
GTCCCTAATTTAACCGAAGGTTCTTTGCATGAGCCAGGGAGGCAAAGTGTCACACTGAGACAGAATAACCTGCCAGCTCAGAGTGGATCT
CATGCTGCTGAGAAAGGCAACAGCGACTGGCCAGAGAGGCCTGGACTGACACAGACTGGCCCTGGACACAGACGGATGCTGCGGAGACAC

>In-frame_ZNF302_ENST00000423823_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_987nt
ATGTCTCAGAGGCTGGCGAAGGTTCCTGCCAGTGGGCTTGGTGTGAACGTGACCAGCCAGGACGGCTCCTCCCCGCTGCATGTCGCCGCC
CTGCACGGCCGGGCGGACCTCATCCCCCTCCTGCTGAAGCACGGGGCCAACGCAGGTGCCAGGAACGCAGACCAAGCCGTCCCGCTCCAC
CTGGCCTGCCAGCAGGGCCACTTTCAGGTGGTGAAGTGTCTGTTAGATTCGAATGCAAAACCCAATAAGAAGGACCTCAGTGGAAACACG
CCCCTCATTTACGCCTGCTCCGGTGGCCATCACGAGCTTGTGGCACTGCTGCTACAGCACGGGGCCTCCATTAACGCTTCTAACAATAAG
GGCAACACAGCGCTGCACGAGGCTGTGATTGAAAAGCACGTCTTCGTGGTAGAGCTGCTTCTGCTCCACGGAGCGTCAGTTCAGGTGCTG
AACAAGCGGCAGCGCACGGCTGTAGACTGTGCTGAACAGAATTCAAAAATAATGGAATTGCTTCAGGTGGTACCAAGCTGTGTTGCTTCA
TTAGATGATGTGGCTGAAACTGACCGCAAGGAGTATGTCACTGTTAAGATCAGGAAAAAATGGAACTCAAAACTGTATGATCTACCAGAT
GAGCCTTTTACAAGACAGTTTTACTTTGTCCACTCAGCTGGTCAGTTTAAGGGAAAGACTTCAAGGGAGATTATGGCAAGAGATAGAAGT
GTCCCTAATTTAACCGAAGGTTCTTTGCATGAGCCAGGGAGGCAAAGTGTCACACTGAGACAGAATAACCTGCCAGCTCAGAGTGGATCT
CATGCTGCTGAGAAAGGCAACAGCGACTGGCCAGAGAGGCCTGGACTGACACAGACTGGCCCTGGACACAGACGGATGCTGCGGAGACAC

>In-frame_ZNF302_ENST00000507959_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_987nt
ATGTCTCAGAGGCTGGCGAAGGTTCCTGCCAGTGGGCTTGGTGTGAACGTGACCAGCCAGGACGGCTCCTCCCCGCTGCATGTCGCCGCC
CTGCACGGCCGGGCGGACCTCATCCCCCTCCTGCTGAAGCACGGGGCCAACGCAGGTGCCAGGAACGCAGACCAAGCCGTCCCGCTCCAC
CTGGCCTGCCAGCAGGGCCACTTTCAGGTGGTGAAGTGTCTGTTAGATTCGAATGCAAAACCCAATAAGAAGGACCTCAGTGGAAACACG
CCCCTCATTTACGCCTGCTCCGGTGGCCATCACGAGCTTGTGGCACTGCTGCTACAGCACGGGGCCTCCATTAACGCTTCTAACAATAAG
GGCAACACAGCGCTGCACGAGGCTGTGATTGAAAAGCACGTCTTCGTGGTAGAGCTGCTTCTGCTCCACGGAGCGTCAGTTCAGGTGCTG
AACAAGCGGCAGCGCACGGCTGTAGACTGTGCTGAACAGAATTCAAAAATAATGGAATTGCTTCAGGTGGTACCAAGCTGTGTTGCTTCA
TTAGATGATGTGGCTGAAACTGACCGCAAGGAGTATGTCACTGTTAAGATCAGGAAAAAATGGAACTCAAAACTGTATGATCTACCAGAT
GAGCCTTTTACAAGACAGTTTTACTTTGTCCACTCAGCTGGTCAGTTTAAGGGAAAGACTTCAAGGGAGATTATGGCAAGAGATAGAAGT
GTCCCTAATTTAACCGAAGGTTCTTTGCATGAGCCAGGGAGGCAAAGTGTCACACTGAGACAGAATAACCTGCCAGCTCAGAGTGGATCT
CATGCTGCTGAGAAAGGCAACAGCGACTGGCCAGAGAGGCCTGGACTGACACAGACTGGCCCTGGACACAGACGGATGCTGCGGAGACAC

>In-frame_ZNF302_ENST00000446502_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_987nt
ATGTCTCAGAGGCTGGCGAAGGTTCCTGCCAGTGGGCTTGGTGTGAACGTGACCAGCCAGGACGGCTCCTCCCCGCTGCATGTCGCCGCC
CTGCACGGCCGGGCGGACCTCATCCCCCTCCTGCTGAAGCACGGGGCCAACGCAGGTGCCAGGAACGCAGACCAAGCCGTCCCGCTCCAC
CTGGCCTGCCAGCAGGGCCACTTTCAGGTGGTGAAGTGTCTGTTAGATTCGAATGCAAAACCCAATAAGAAGGACCTCAGTGGAAACACG
CCCCTCATTTACGCCTGCTCCGGTGGCCATCACGAGCTTGTGGCACTGCTGCTACAGCACGGGGCCTCCATTAACGCTTCTAACAATAAG
GGCAACACAGCGCTGCACGAGGCTGTGATTGAAAAGCACGTCTTCGTGGTAGAGCTGCTTCTGCTCCACGGAGCGTCAGTTCAGGTGCTG
AACAAGCGGCAGCGCACGGCTGTAGACTGTGCTGAACAGAATTCAAAAATAATGGAATTGCTTCAGGTGGTACCAAGCTGTGTTGCTTCA
TTAGATGATGTGGCTGAAACTGACCGCAAGGAGTATGTCACTGTTAAGATCAGGAAAAAATGGAACTCAAAACTGTATGATCTACCAGAT
GAGCCTTTTACAAGACAGTTTTACTTTGTCCACTCAGCTGGTCAGTTTAAGGGAAAGACTTCAAGGGAGATTATGGCAAGAGATAGAAGT
GTCCCTAATTTAACCGAAGGTTCTTTGCATGAGCCAGGGAGGCAAAGTGTCACACTGAGACAGAATAACCTGCCAGCTCAGAGTGGATCT
CATGCTGCTGAGAAAGGCAACAGCGACTGGCCAGAGAGGCCTGGACTGACACAGACTGGCCCTGGACACAGACGGATGCTGCGGAGACAC

>In-frame_ZNF302_ENST00000505365_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_987nt
ATGTCTCAGAGGCTGGCGAAGGTTCCTGCCAGTGGGCTTGGTGTGAACGTGACCAGCCAGGACGGCTCCTCCCCGCTGCATGTCGCCGCC
CTGCACGGCCGGGCGGACCTCATCCCCCTCCTGCTGAAGCACGGGGCCAACGCAGGTGCCAGGAACGCAGACCAAGCCGTCCCGCTCCAC
CTGGCCTGCCAGCAGGGCCACTTTCAGGTGGTGAAGTGTCTGTTAGATTCGAATGCAAAACCCAATAAGAAGGACCTCAGTGGAAACACG
CCCCTCATTTACGCCTGCTCCGGTGGCCATCACGAGCTTGTGGCACTGCTGCTACAGCACGGGGCCTCCATTAACGCTTCTAACAATAAG
GGCAACACAGCGCTGCACGAGGCTGTGATTGAAAAGCACGTCTTCGTGGTAGAGCTGCTTCTGCTCCACGGAGCGTCAGTTCAGGTGCTG
AACAAGCGGCAGCGCACGGCTGTAGACTGTGCTGAACAGAATTCAAAAATAATGGAATTGCTTCAGGTGGTACCAAGCTGTGTTGCTTCA
TTAGATGATGTGGCTGAAACTGACCGCAAGGAGTATGTCACTGTTAAGATCAGGAAAAAATGGAACTCAAAACTGTATGATCTACCAGAT
GAGCCTTTTACAAGACAGTTTTACTTTGTCCACTCAGCTGGTCAGTTTAAGGGAAAGACTTCAAGGGAGATTATGGCAAGAGATAGAAGT
GTCCCTAATTTAACCGAAGGTTCTTTGCATGAGCCAGGGAGGCAAAGTGTCACACTGAGACAGAATAACCTGCCAGCTCAGAGTGGATCT
CATGCTGCTGAGAAAGGCAACAGCGACTGGCCAGAGAGGCCTGGACTGACACAGACTGGCCCTGGACACAGACGGATGCTGCGGAGACAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZNF302_ENST00000509528_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_2403nt
GAAATGTGGTTCGCCGTGGGCGGTGCACTGGGTCAGTCCCGCGATAGCTTCAGGCCTGGCGGCGGCTTCCAAGCTAAGGAACGGTTTGGG
GCAGTGTCGTTCCCGGAGGTCGGCCGCCGTTACCCGCTCACCAGCTACGCGGCGCGTCAGGTCCGCGGAGGCGCGGGCTCGGGGCGCCTG
CGGGACGGTGAGGCCCTGCTGAGGACTCCGGACACTGCCCATCTCTAAGATAAGAACCTGGAAAGGGGACTCTGTTGGCCATTGGAAATT
GCAGAATAATGTCTCAGAGGCTGGCGAAGGTTCCTGCCAGTGGGCTTGGTGTGAACGTGACCAGCCAGGACGGCTCCTCCCCGCTGCATG
TCGCCGCCCTGCACGGCCGGGCGGACCTCATCCCCCTCCTGCTGAAGCACGGGGCCAACGCAGGTGCCAGGAACGCAGACCAAGCCGTCC
CGCTCCACCTGGCCTGCCAGCAGGGCCACTTTCAGGTGGTGAAGTGTCTGTTAGATTCGAATGCAAAACCCAATAAGAAGGACCTCAGTG
GAAACACGCCCCTCATTTACGCCTGCTCCGGTGGCCATCACGAGCTTGTGGCACTGCTGCTACAGCACGGGGCCTCCATTAACGCTTCTA
ACAATAAGGGCAACACAGCGCTGCACGAGGCTGTGATTGAAAAGCACGTCTTCGTGGTAGAGCTGCTTCTGCTCCACGGAGCGTCAGTTC
AGGTGCTGAACAAGCGGCAGCGCACGGCTGTAGACTGTGCTGAACAGAATTCAAAAATAATGGAATTGCTTCAGGTGGTACCAAGCTGTG
TTGCTTCATTAGATGATGTGGCTGAAACTGACCGCAAGGAGTATGTCACTGTTAAGATCAGGAAAAAATGGAACTCAAAACTGTATGATC
TACCAGATGAGCCTTTTACAAGACAGTTTTACTTTGTCCACTCAGCTGGTCAGTTTAAGGGAAAGACTTCAAGGGAGATTATGGCAAGAG
ATAGAAGTGTCCCTAATTTAACCGAAGGTTCTTTGCATGAGCCAGGGAGGCAAAGTGTCACACTGAGACAGAATAACCTGCCAGCTCAGA
GTGGATCTCATGCTGCTGAGAAAGGCAACAGCGACTGGCCAGAGAGGCCTGGACTGACACAGACTGGCCCTGGACACAGACGGATGCTGC
GGAGACACACGGTAGAGGATGCGGTCGTGTCCCAGGGCCCGGAGGCTGCTGGCCCCCTCTCCACTCCCCAAGAGGTTAGTGCTTCCCGGT
CCTAACAGGAATGAGGAGTTGTTGAACCCACTGCTAGGAAGCAAGGATGCAACAAGATGATGCTGAGCGTGAACACATCTGAGAACTAAA
TGTGCTTCCATGAGACTGGCTTGAGAAGTCTTCAGCACCAAGTTCCTGAAAGCTTTTCTGTGGCAGGAAAGAATGCAACAAAAAAGTTAA
CCACCACCATCTCTCTCCTCTTCAAAGCTAATGAATACAATTGAAACAGACAAAAATTCCAGTAGCATCCAGATCCTTAAGCCAGAGGTG
CATGCTTCTTTTTAAGTATGAGGGTTTGTTGGTCACAGTGGGAGAGGTTTCACCACCGCATTCTGACCTCCTCCTCCCAAAAGGTGCTAA
ACCTCTCTGACCTGTGTACATTCACAAACCACAGCTAGAATTCCTCCACCTAGGATTAAGCTGGAGAGAAGTAAGTAATTTAGGTTTCAT
GGTACTGTAGAGGCCAGGCTGAAATGTCATATCTGAAGGAAGAAAGCAGCAGCTGGACAATGTTTCTTTGCAAAGCAACACTCGAACCAA
AAGATGCCTCAATCCCATTTTGATATTCATTTTAGTGAAAGGATGCATCAGACCTGTTCCACATCATGCACATGGGAAAGGGTGGTTATC
ATTTTCCTTCTAACAAGTAGGTACAGATATTCGGTTACTACACGTGCACCTGTAGCAGTATTTCTAGAAACATCCCTTTTTGTTGAGAAC
CTCCCTTGAATGTCTGTCACACTCACACCTGACGGGATGGTTACTGGATTAGAGAGTAGATTTGGCACATCTTTTCTTAGTCTTTTGATT
CAAATTCAAAACTTAACAGCACAAACCAGGTCAGAGTTACTTTCGGTTAGAATTTATTGCCATTTATTCCTTTTTATAAATTTCTATAGA
TTATACTGTTATTTTTATGTTATTGGCCTAGAGCTACACGTATATGGGTTTGTCCTGAGTCCGTTTTCAAATGACCTTGTGATAGGGAAA
TGGTTTTGTCCATGTTCTTGGAAATACTTGTGTATGTACAGAAGGAAGGGAGGGATTATTTTTCTACAAAGTAATTTATGATTTCTAATT

>In-frame_ZNF302_ENST00000457781_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_2365nt
GTGGGCGGTGCACTGGGTCAGTCCCGCGATAGCTTCAGGCCTGGCGGCGGCTTCCAAGCTAAGGAACGGTTTGGGGCAGTGTCGTTCCCG
GAGGTCGGCCGCCGTTACCCGCTCACCAGCTACGCGGCGCGTCAGGTCCGCGGAGGCGCGGGCTCGGGGCGCCTGCGGGACGGACACTGC
CCATCTCTAAGATAAGAACCTGGAAAGGGGACTCTGTTGGCCATTGGAAATTGCAGAATAATGTCTCAGAGGCTGGCGAAGGTTCCTGCC
AGTGGGCTTGGTGTGAACGTGACCAGCCAGGACGGCTCCTCCCCGCTGCATGTCGCCGCCCTGCACGGCCGGGCGGACCTCATCCCCCTC
CTGCTGAAGCACGGGGCCAACGCAGGTGCCAGGAACGCAGACCAAGCCGTCCCGCTCCACCTGGCCTGCCAGCAGGGCCACTTTCAGGTG
GTGAAGTGTCTGTTAGATTCGAATGCAAAACCCAATAAGAAGGACCTCAGTGGAAACACGCCCCTCATTTACGCCTGCTCCGGTGGCCAT
CACGAGCTTGTGGCACTGCTGCTACAGCACGGGGCCTCCATTAACGCTTCTAACAATAAGGGCAACACAGCGCTGCACGAGGCTGTGATT
GAAAAGCACGTCTTCGTGGTAGAGCTGCTTCTGCTCCACGGAGCGTCAGTTCAGGTGCTGAACAAGCGGCAGCGCACGGCTGTAGACTGT
GCTGAACAGAATTCAAAAATAATGGAATTGCTTCAGGTGGTACCAAGCTGTGTTGCTTCATTAGATGATGTGGCTGAAACTGACCGCAAG
GAGTATGTCACTGTTAAGATCAGGAAAAAATGGAACTCAAAACTGTATGATCTACCAGATGAGCCTTTTACAAGACAGTTTTACTTTGTC
CACTCAGCTGGTCAGTTTAAGGGAAAGACTTCAAGGGAGATTATGGCAAGAGATAGAAGTGTCCCTAATTTAACCGAAGGTTCTTTGCAT
GAGCCAGGGAGGCAAAGTGTCACACTGAGACAGAATAACCTGCCAGCTCAGAGTGGATCTCATGCTGCTGAGAAAGGCAACAGCGACTGG
CCAGAGAGGCCTGGACTGACACAGACTGGCCCTGGACACAGACGGATGCTGCGGAGACACACGGTAGAGGATGCGGTCGTGTCCCAGGGC
CCGGAGGCTGCTGGCCCCCTCTCCACTCCCCAAGAGGTTAGTGCTTCCCGGTCCTAACAGGAATGAGGAGTTGTTGAACCCACTGCTAGG
AAGCAAGGATGCAACAAGATGATGCTGAGCGTGAACACATCTGAGAACTAAATGTGCTTCCATGAGACTGGCTTGAGAAGTCTTCAGCAC
CAAGTTCCTGAAAGCTTTTCTGTGGCAGGAAAGAATGCAACAAAAAAGTTAACCACCACCATCTCTCTCCTCTTCAAAGCTAATGAATAC
AATTGAAACAGACAAAAATTCCAGTAGCATCCAGATCCTTAAGCCAGAGGTGCATGCTTCTTTTTAAGTATGAGGGTTTGTTGGTCACAG
TGGGAGAGGTTTCACCACCGCATTCTGACCTCCTCCTCCCAAAAGGTGCTAAACCTCTCTGACCTGTGTACATTCACAAACCACAGCTAG
AATTCCTCCACCTAGGATTAAGCTGGAGAGAAGTAAGTAATTTAGGTTTCATGGTACTGTAGAGGCCAGGCTGAAATGTCATATCTGAAG
GAAGAAAGCAGCAGCTGGACAATGTTTCTTTGCAAAGCAACACTCGAACCAAAAGATGCCTCAATCCCATTTTGATATTCATTTTAGTGA
AAGGATGCATCAGACCTGTTCCACATCATGCACATGGGAAAGGGTGGTTATCATTTTCCTTCTAACAAGTAGGTACAGATATTCGGTTAC
TACACGTGCACCTGTAGCAGTATTTCTAGAAACATCCCTTTTTGTTGAGAACCTCCCTTGAATGTCTGTCACACTCACACCTGACGGGAT
GGTTACTGGATTAGAGAGTAGATTTGGCACATCTTTTCTTAGTCTTTTGATTCAAATTCAAAACTTAACAGCACAAACCAGGTCAGAGTT
ACTTTCGGTTAGAATTTATTGCCATTTATTCCTTTTTATAAATTTCTATAGATTATACTGTTATTTTTATGTTATTGGCCTAGAGCTACA
CGTATATGGGTTTGTCCTGAGTCCGTTTTCAAATGACCTTGTGATAGGGAAATGGTTTTGTCCATGTTCTTGGAAATACTTGTGTATGTA
CAGAAGGAAGGGAGGGATTATTTTTCTACAAAGTAATTTATGATTTCTAATTTTCTAATGTGCCTTGGATATGTGCCAAATGATGGAAAA

>In-frame_ZNF302_ENST00000505242_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_2619nt
GTCAGTCCCGCGATAGCTTCAGGCCTGGCGGCGGCTTCCAAGCTAAGGAACGGTTTGGGGCAGTGTCGTTCCCGGAGGTCGGCCGCCGTT
ACCCGCTCACCAGCTACGCGGCGCGTCAGGTCCGCGGAGGCGCGGGCTCGGGGCGCCTGCGGGACGGTGAGGCCCTGCTGAGGACTCCGG
CAAGTGTGGGTCGCGGCGACGGCGGGGCTAAGGCCCTGGGTCCGCGCGCGGTTTGACCACGGCCGGGGCCTTGGGCATTTCCTGGCCTTC
CTGTTGAGCCGTGTAAACGCGGGGTGATGACGGCGCCGACCTCTTGGCACTGTTGTGAGAGCGAAGTGGGCGCGAGAGCAGACGCCAGCT
ACAGTTTTTTTTGGGTTATGTCGTCATGAAGCCGGCGCTTTCAGTTGTGCAACCTTGAACAAATGGGACACTGCCCATCTCTAAGATAAG
AACCTGGAAAGGGGACTCTGTTGGCCATTGGAAATTGCAGAATAATGTCTCAGAGGCTGGCGAAGGTTCCTGCCAGTGGGCTTGGTGTGA
ACGTGACCAGCCAGGACGGCTCCTCCCCGCTGCATGTCGCCGCCCTGCACGGCCGGGCGGACCTCATCCCCCTCCTGCTGAAGCACGGGG
CCAACGCAGGTGCCAGGAACGCAGACCAAGCCGTCCCGCTCCACCTGGCCTGCCAGCAGGGCCACTTTCAGGTGGTGAAGTGTCTGTTAG
ATTCGAATGCAAAACCCAATAAGAAGGACCTCAGTGGAAACACGCCCCTCATTTACGCCTGCTCCGGTGGCCATCACGAGCTTGTGGCAC
TGCTGCTACAGCACGGGGCCTCCATTAACGCTTCTAACAATAAGGGCAACACAGCGCTGCACGAGGCTGTGATTGAAAAGCACGTCTTCG
TGGTAGAGCTGCTTCTGCTCCACGGAGCGTCAGTTCAGGTGCTGAACAAGCGGCAGCGCACGGCTGTAGACTGTGCTGAACAGAATTCAA
AAATAATGGAATTGCTTCAGGTGGTACCAAGCTGTGTTGCTTCATTAGATGATGTGGCTGAAACTGACCGCAAGGAGTATGTCACTGTTA
AGATCAGGAAAAAATGGAACTCAAAACTGTATGATCTACCAGATGAGCCTTTTACAAGACAGTTTTACTTTGTCCACTCAGCTGGTCAGT
TTAAGGGAAAGACTTCAAGGGAGATTATGGCAAGAGATAGAAGTGTCCCTAATTTAACCGAAGGTTCTTTGCATGAGCCAGGGAGGCAAA
GTGTCACACTGAGACAGAATAACCTGCCAGCTCAGAGTGGATCTCATGCTGCTGAGAAAGGCAACAGCGACTGGCCAGAGAGGCCTGGAC
TGACACAGACTGGCCCTGGACACAGACGGATGCTGCGGAGACACACGGTAGAGGATGCGGTCGTGTCCCAGGGCCCGGAGGCTGCTGGCC
CCCTCTCCACTCCCCAAGAGGTTAGTGCTTCCCGGTCCTAACAGGAATGAGGAGTTGTTGAACCCACTGCTAGGAAGCAAGGATGCAACA
AGATGATGCTGAGCGTGAACACATCTGAGAACTAAATGTGCTTCCATGAGACTGGCTTGAGAAGTCTTCAGCACCAAGTTCCTGAAAGCT
TTTCTGTGGCAGGAAAGAATGCAACAAAAAAGTTAACCACCACCATCTCTCTCCTCTTCAAAGCTAATGAATACAATTGAAACAGACAAA
AATTCCAGTAGCATCCAGATCCTTAAGCCAGAGGTGCATGCTTCTTTTTAAGTATGAGGGTTTGTTGGTCACAGTGGGAGAGGTTTCACC
ACCGCATTCTGACCTCCTCCTCCCAAAAGGTGCTAAACCTCTCTGACCTGTGTACATTCACAAACCACAGCTAGAATTCCTCCACCTAGG
ATTAAGCTGGAGAGAAGTAAGTAATTTAGGTTTCATGGTACTGTAGAGGCCAGGCTGAAATGTCATATCTGAAGGAAGAAAGCAGCAGCT
GGACAATGTTTCTTTGCAAAGCAACACTCGAACCAAAAGATGCCTCAATCCCATTTTGATATTCATTTTAGTGAAAGGATGCATCAGACC
TGTTCCACATCATGCACATGGGAAAGGGTGGTTATCATTTTCCTTCTAACAAGTAGGTACAGATATTCGGTTACTACACGTGCACCTGTA
GCAGTATTTCTAGAAACATCCCTTTTTGTTGAGAACCTCCCTTGAATGTCTGTCACACTCACACCTGACGGGATGGTTACTGGATTAGAG
AGTAGATTTGGCACATCTTTTCTTAGTCTTTTGATTCAAATTCAAAACTTAACAGCACAAACCAGGTCAGAGTTACTTTCGGTTAGAATT
TATTGCCATTTATTCCTTTTTATAAATTTCTATAGATTATACTGTTATTTTTATGTTATTGGCCTAGAGCTACACGTATATGGGTTTGTC
CTGAGTCCGTTTTCAAATGACCTTGTGATAGGGAAATGGTTTTGTCCATGTTCTTGGAAATACTTGTGTATGTACAGAAGGAAGGGAGGG
ATTATTTTTCTACAAAGTAATTTATGATTTCTAATTTTCTAATGTGCCTTGGATATGTGCCAAATGATGGAAAAGAAACAGTAAACTTTA

>In-frame_ZNF302_ENST00000423823_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_2361nt
GATAGCTTCAGGCCTGGCGGCGGCTTCCAAGCTAAGGAACGGTTTGGGGCAGTGTCGTTCCCGGAGGTCGGCCGCCGTTACCCGCTCACC
AGCTACGCGGCGCGTCAGGTCCGCGGAGGCGCGGGCTCGGGGCGCCTGCGGGACGGTGAGGCCCTGCTGAGGACTCCGGACACTGCCCAT
CTCTAAGATAAGAACCTGGAAAGGGGACTCTGTTGGCCATTGGAAATTGCAGAATAATGTCTCAGAGGCTGGCGAAGGTTCCTGCCAGTG
GGCTTGGTGTGAACGTGACCAGCCAGGACGGCTCCTCCCCGCTGCATGTCGCCGCCCTGCACGGCCGGGCGGACCTCATCCCCCTCCTGC
TGAAGCACGGGGCCAACGCAGGTGCCAGGAACGCAGACCAAGCCGTCCCGCTCCACCTGGCCTGCCAGCAGGGCCACTTTCAGGTGGTGA
AGTGTCTGTTAGATTCGAATGCAAAACCCAATAAGAAGGACCTCAGTGGAAACACGCCCCTCATTTACGCCTGCTCCGGTGGCCATCACG
AGCTTGTGGCACTGCTGCTACAGCACGGGGCCTCCATTAACGCTTCTAACAATAAGGGCAACACAGCGCTGCACGAGGCTGTGATTGAAA
AGCACGTCTTCGTGGTAGAGCTGCTTCTGCTCCACGGAGCGTCAGTTCAGGTGCTGAACAAGCGGCAGCGCACGGCTGTAGACTGTGCTG
AACAGAATTCAAAAATAATGGAATTGCTTCAGGTGGTACCAAGCTGTGTTGCTTCATTAGATGATGTGGCTGAAACTGACCGCAAGGAGT
ATGTCACTGTTAAGATCAGGAAAAAATGGAACTCAAAACTGTATGATCTACCAGATGAGCCTTTTACAAGACAGTTTTACTTTGTCCACT
CAGCTGGTCAGTTTAAGGGAAAGACTTCAAGGGAGATTATGGCAAGAGATAGAAGTGTCCCTAATTTAACCGAAGGTTCTTTGCATGAGC
CAGGGAGGCAAAGTGTCACACTGAGACAGAATAACCTGCCAGCTCAGAGTGGATCTCATGCTGCTGAGAAAGGCAACAGCGACTGGCCAG
AGAGGCCTGGACTGACACAGACTGGCCCTGGACACAGACGGATGCTGCGGAGACACACGGTAGAGGATGCGGTCGTGTCCCAGGGCCCGG
AGGCTGCTGGCCCCCTCTCCACTCCCCAAGAGGTTAGTGCTTCCCGGTCCTAACAGGAATGAGGAGTTGTTGAACCCACTGCTAGGAAGC
AAGGATGCAACAAGATGATGCTGAGCGTGAACACATCTGAGAACTAAATGTGCTTCCATGAGACTGGCTTGAGAAGTCTTCAGCACCAAG
TTCCTGAAAGCTTTTCTGTGGCAGGAAAGAATGCAACAAAAAAGTTAACCACCACCATCTCTCTCCTCTTCAAAGCTAATGAATACAATT
GAAACAGACAAAAATTCCAGTAGCATCCAGATCCTTAAGCCAGAGGTGCATGCTTCTTTTTAAGTATGAGGGTTTGTTGGTCACAGTGGG
AGAGGTTTCACCACCGCATTCTGACCTCCTCCTCCCAAAAGGTGCTAAACCTCTCTGACCTGTGTACATTCACAAACCACAGCTAGAATT
CCTCCACCTAGGATTAAGCTGGAGAGAAGTAAGTAATTTAGGTTTCATGGTACTGTAGAGGCCAGGCTGAAATGTCATATCTGAAGGAAG
AAAGCAGCAGCTGGACAATGTTTCTTTGCAAAGCAACACTCGAACCAAAAGATGCCTCAATCCCATTTTGATATTCATTTTAGTGAAAGG
ATGCATCAGACCTGTTCCACATCATGCACATGGGAAAGGGTGGTTATCATTTTCCTTCTAACAAGTAGGTACAGATATTCGGTTACTACA
CGTGCACCTGTAGCAGTATTTCTAGAAACATCCCTTTTTGTTGAGAACCTCCCTTGAATGTCTGTCACACTCACACCTGACGGGATGGTT
ACTGGATTAGAGAGTAGATTTGGCACATCTTTTCTTAGTCTTTTGATTCAAATTCAAAACTTAACAGCACAAACCAGGTCAGAGTTACTT
TCGGTTAGAATTTATTGCCATTTATTCCTTTTTATAAATTTCTATAGATTATACTGTTATTTTTATGTTATTGGCCTAGAGCTACACGTA
TATGGGTTTGTCCTGAGTCCGTTTTCAAATGACCTTGTGATAGGGAAATGGTTTTGTCCATGTTCTTGGAAATACTTGTGTATGTACAGA
AGGAAGGGAGGGATTATTTTTCTACAAAGTAATTTATGATTTCTAATTTTCTAATGTGCCTTGGATATGTGCCAAATGATGGAAAAGAAA

>In-frame_ZNF302_ENST00000507959_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_2348nt
CTGGCGGCGGCTTCCAAGCTAAGGAACGGTTTGGGGCAGTGTCGTTCCCGGAGGTCGGCCGCCGTTACCCGCTCACCAGCTACGCGGCGC
GTCAGGTCCGCGGAGGCGCGGGCTCGGGGCGCCTGCGGGACGGTGAGGCCCTGCTGAGGACTCCGGACACTGCCCATCTCTAAGATAAGA
ACCTGGAAAGGGGACTCTGTTGGCCATTGGAAATTGCAGAATAATGTCTCAGAGGCTGGCGAAGGTTCCTGCCAGTGGGCTTGGTGTGAA
CGTGACCAGCCAGGACGGCTCCTCCCCGCTGCATGTCGCCGCCCTGCACGGCCGGGCGGACCTCATCCCCCTCCTGCTGAAGCACGGGGC
CAACGCAGGTGCCAGGAACGCAGACCAAGCCGTCCCGCTCCACCTGGCCTGCCAGCAGGGCCACTTTCAGGTGGTGAAGTGTCTGTTAGA
TTCGAATGCAAAACCCAATAAGAAGGACCTCAGTGGAAACACGCCCCTCATTTACGCCTGCTCCGGTGGCCATCACGAGCTTGTGGCACT
GCTGCTACAGCACGGGGCCTCCATTAACGCTTCTAACAATAAGGGCAACACAGCGCTGCACGAGGCTGTGATTGAAAAGCACGTCTTCGT
GGTAGAGCTGCTTCTGCTCCACGGAGCGTCAGTTCAGGTGCTGAACAAGCGGCAGCGCACGGCTGTAGACTGTGCTGAACAGAATTCAAA
AATAATGGAATTGCTTCAGGTGGTACCAAGCTGTGTTGCTTCATTAGATGATGTGGCTGAAACTGACCGCAAGGAGTATGTCACTGTTAA
GATCAGGAAAAAATGGAACTCAAAACTGTATGATCTACCAGATGAGCCTTTTACAAGACAGTTTTACTTTGTCCACTCAGCTGGTCAGTT
TAAGGGAAAGACTTCAAGGGAGATTATGGCAAGAGATAGAAGTGTCCCTAATTTAACCGAAGGTTCTTTGCATGAGCCAGGGAGGCAAAG
TGTCACACTGAGACAGAATAACCTGCCAGCTCAGAGTGGATCTCATGCTGCTGAGAAAGGCAACAGCGACTGGCCAGAGAGGCCTGGACT
GACACAGACTGGCCCTGGACACAGACGGATGCTGCGGAGACACACGGTAGAGGATGCGGTCGTGTCCCAGGGCCCGGAGGCTGCTGGCCC
CCTCTCCACTCCCCAAGAGGTTAGTGCTTCCCGGTCCTAACAGGAATGAGGAGTTGTTGAACCCACTGCTAGGAAGCAAGGATGCAACAA
GATGATGCTGAGCGTGAACACATCTGAGAACTAAATGTGCTTCCATGAGACTGGCTTGAGAAGTCTTCAGCACCAAGTTCCTGAAAGCTT
TTCTGTGGCAGGAAAGAATGCAACAAAAAAGTTAACCACCACCATCTCTCTCCTCTTCAAAGCTAATGAATACAATTGAAACAGACAAAA
ATTCCAGTAGCATCCAGATCCTTAAGCCAGAGGTGCATGCTTCTTTTTAAGTATGAGGGTTTGTTGGTCACAGTGGGAGAGGTTTCACCA
CCGCATTCTGACCTCCTCCTCCCAAAAGGTGCTAAACCTCTCTGACCTGTGTACATTCACAAACCACAGCTAGAATTCCTCCACCTAGGA
TTAAGCTGGAGAGAAGTAAGTAATTTAGGTTTCATGGTACTGTAGAGGCCAGGCTGAAATGTCATATCTGAAGGAAGAAAGCAGCAGCTG
GACAATGTTTCTTTGCAAAGCAACACTCGAACCAAAAGATGCCTCAATCCCATTTTGATATTCATTTTAGTGAAAGGATGCATCAGACCT
GTTCCACATCATGCACATGGGAAAGGGTGGTTATCATTTTCCTTCTAACAAGTAGGTACAGATATTCGGTTACTACACGTGCACCTGTAG
CAGTATTTCTAGAAACATCCCTTTTTGTTGAGAACCTCCCTTGAATGTCTGTCACACTCACACCTGACGGGATGGTTACTGGATTAGAGA
GTAGATTTGGCACATCTTTTCTTAGTCTTTTGATTCAAATTCAAAACTTAACAGCACAAACCAGGTCAGAGTTACTTTCGGTTAGAATTT
ATTGCCATTTATTCCTTTTTATAAATTTCTATAGATTATACTGTTATTTTTATGTTATTGGCCTAGAGCTACACGTATATGGGTTTGTCC
TGAGTCCGTTTTCAAATGACCTTGTGATAGGGAAATGGTTTTGTCCATGTTCTTGGAAATACTTGTGTATGTACAGAAGGAAGGGAGGGA
TTATTTTTCTACAAAGTAATTTATGATTTCTAATTTTCTAATGTGCCTTGGATATGTGCCAAATGATGGAAAAGAAACAGTAAACTTTAT

>In-frame_ZNF302_ENST00000446502_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_2333nt
AAGCTAAGGAACGGTTTGGGGCAGTGTCGTTCCCGGAGGTCGGCCGCCGTTACCCGCTCACCAGCTACGCGGCGCGTCAGGTCCGCGGAG
GCGCGGGCTCGGGGCGCCTGCGGGACGGTGAGGCCCTGCTGAGGACTCCGGACACTGCCCATCTCTAAGATAAGAACCTGGAAAGGGGAC
TCTGTTGGCCATTGGAAATTGCAGAATAATGTCTCAGAGGCTGGCGAAGGTTCCTGCCAGTGGGCTTGGTGTGAACGTGACCAGCCAGGA
CGGCTCCTCCCCGCTGCATGTCGCCGCCCTGCACGGCCGGGCGGACCTCATCCCCCTCCTGCTGAAGCACGGGGCCAACGCAGGTGCCAG
GAACGCAGACCAAGCCGTCCCGCTCCACCTGGCCTGCCAGCAGGGCCACTTTCAGGTGGTGAAGTGTCTGTTAGATTCGAATGCAAAACC
CAATAAGAAGGACCTCAGTGGAAACACGCCCCTCATTTACGCCTGCTCCGGTGGCCATCACGAGCTTGTGGCACTGCTGCTACAGCACGG
GGCCTCCATTAACGCTTCTAACAATAAGGGCAACACAGCGCTGCACGAGGCTGTGATTGAAAAGCACGTCTTCGTGGTAGAGCTGCTTCT
GCTCCACGGAGCGTCAGTTCAGGTGCTGAACAAGCGGCAGCGCACGGCTGTAGACTGTGCTGAACAGAATTCAAAAATAATGGAATTGCT
TCAGGTGGTACCAAGCTGTGTTGCTTCATTAGATGATGTGGCTGAAACTGACCGCAAGGAGTATGTCACTGTTAAGATCAGGAAAAAATG
GAACTCAAAACTGTATGATCTACCAGATGAGCCTTTTACAAGACAGTTTTACTTTGTCCACTCAGCTGGTCAGTTTAAGGGAAAGACTTC
AAGGGAGATTATGGCAAGAGATAGAAGTGTCCCTAATTTAACCGAAGGTTCTTTGCATGAGCCAGGGAGGCAAAGTGTCACACTGAGACA
GAATAACCTGCCAGCTCAGAGTGGATCTCATGCTGCTGAGAAAGGCAACAGCGACTGGCCAGAGAGGCCTGGACTGACACAGACTGGCCC
TGGACACAGACGGATGCTGCGGAGACACACGGTAGAGGATGCGGTCGTGTCCCAGGGCCCGGAGGCTGCTGGCCCCCTCTCCACTCCCCA
AGAGGTTAGTGCTTCCCGGTCCTAACAGGAATGAGGAGTTGTTGAACCCACTGCTAGGAAGCAAGGATGCAACAAGATGATGCTGAGCGT
GAACACATCTGAGAACTAAATGTGCTTCCATGAGACTGGCTTGAGAAGTCTTCAGCACCAAGTTCCTGAAAGCTTTTCTGTGGCAGGAAA
GAATGCAACAAAAAAGTTAACCACCACCATCTCTCTCCTCTTCAAAGCTAATGAATACAATTGAAACAGACAAAAATTCCAGTAGCATCC
AGATCCTTAAGCCAGAGGTGCATGCTTCTTTTTAAGTATGAGGGTTTGTTGGTCACAGTGGGAGAGGTTTCACCACCGCATTCTGACCTC
CTCCTCCCAAAAGGTGCTAAACCTCTCTGACCTGTGTACATTCACAAACCACAGCTAGAATTCCTCCACCTAGGATTAAGCTGGAGAGAA
GTAAGTAATTTAGGTTTCATGGTACTGTAGAGGCCAGGCTGAAATGTCATATCTGAAGGAAGAAAGCAGCAGCTGGACAATGTTTCTTTG
CAAAGCAACACTCGAACCAAAAGATGCCTCAATCCCATTTTGATATTCATTTTAGTGAAAGGATGCATCAGACCTGTTCCACATCATGCA
CATGGGAAAGGGTGGTTATCATTTTCCTTCTAACAAGTAGGTACAGATATTCGGTTACTACACGTGCACCTGTAGCAGTATTTCTAGAAA
CATCCCTTTTTGTTGAGAACCTCCCTTGAATGTCTGTCACACTCACACCTGACGGGATGGTTACTGGATTAGAGAGTAGATTTGGCACAT
CTTTTCTTAGTCTTTTGATTCAAATTCAAAACTTAACAGCACAAACCAGGTCAGAGTTACTTTCGGTTAGAATTTATTGCCATTTATTCC
TTTTTATAAATTTCTATAGATTATACTGTTATTTTTATGTTATTGGCCTAGAGCTACACGTATATGGGTTTGTCCTGAGTCCGTTTTCAA
ATGACCTTGTGATAGGGAAATGGTTTTGTCCATGTTCTTGGAAATACTTGTGTATGTACAGAAGGAAGGGAGGGATTATTTTTCTACAAA

>In-frame_ZNF302_ENST00000505365_chr19_35169718_+_ANKRD27_ENST00000306065_chr19_33098738_-_2461nt
GAGGCCCTGCTGAGGACTCCGGCAAGTGTGGGTCGCGGCGACGGCGGGGCTAAGGCCCTGGGTCCGCGCGCGGTTTGACCACGGCCGGGG
CCTTGGGCATTTCCTGGCCTTCCTGTTGAGCCGTGTAAACGCGGGGTGATGACGGCGCCGACCTCTTGGCACTGTTGTGAGAGCGAAGTG
GGCGCGAGAGCAGACGCCAGCTACAGTTTTTTTTGGGTTATGTCGTCATGAAGCCGGCGCTTTCAGTTGTGCAACCTTGAACAAATGGGA
CACTGCCCATCTCTAAGATAAGAACCTGGAAAGGGGACTCTGTTGGCCATTGGAAATTGCAGAATAATGTCTCAGAGGCTGGCGAAGGTT
CCTGCCAGTGGGCTTGGTGTGAACGTGACCAGCCAGGACGGCTCCTCCCCGCTGCATGTCGCCGCCCTGCACGGCCGGGCGGACCTCATC
CCCCTCCTGCTGAAGCACGGGGCCAACGCAGGTGCCAGGAACGCAGACCAAGCCGTCCCGCTCCACCTGGCCTGCCAGCAGGGCCACTTT
CAGGTGGTGAAGTGTCTGTTAGATTCGAATGCAAAACCCAATAAGAAGGACCTCAGTGGAAACACGCCCCTCATTTACGCCTGCTCCGGT
GGCCATCACGAGCTTGTGGCACTGCTGCTACAGCACGGGGCCTCCATTAACGCTTCTAACAATAAGGGCAACACAGCGCTGCACGAGGCT
GTGATTGAAAAGCACGTCTTCGTGGTAGAGCTGCTTCTGCTCCACGGAGCGTCAGTTCAGGTGCTGAACAAGCGGCAGCGCACGGCTGTA
GACTGTGCTGAACAGAATTCAAAAATAATGGAATTGCTTCAGGTGGTACCAAGCTGTGTTGCTTCATTAGATGATGTGGCTGAAACTGAC
CGCAAGGAGTATGTCACTGTTAAGATCAGGAAAAAATGGAACTCAAAACTGTATGATCTACCAGATGAGCCTTTTACAAGACAGTTTTAC
TTTGTCCACTCAGCTGGTCAGTTTAAGGGAAAGACTTCAAGGGAGATTATGGCAAGAGATAGAAGTGTCCCTAATTTAACCGAAGGTTCT
TTGCATGAGCCAGGGAGGCAAAGTGTCACACTGAGACAGAATAACCTGCCAGCTCAGAGTGGATCTCATGCTGCTGAGAAAGGCAACAGC
GACTGGCCAGAGAGGCCTGGACTGACACAGACTGGCCCTGGACACAGACGGATGCTGCGGAGACACACGGTAGAGGATGCGGTCGTGTCC
CAGGGCCCGGAGGCTGCTGGCCCCCTCTCCACTCCCCAAGAGGTTAGTGCTTCCCGGTCCTAACAGGAATGAGGAGTTGTTGAACCCACT
GCTAGGAAGCAAGGATGCAACAAGATGATGCTGAGCGTGAACACATCTGAGAACTAAATGTGCTTCCATGAGACTGGCTTGAGAAGTCTT
CAGCACCAAGTTCCTGAAAGCTTTTCTGTGGCAGGAAAGAATGCAACAAAAAAGTTAACCACCACCATCTCTCTCCTCTTCAAAGCTAAT
GAATACAATTGAAACAGACAAAAATTCCAGTAGCATCCAGATCCTTAAGCCAGAGGTGCATGCTTCTTTTTAAGTATGAGGGTTTGTTGG
TCACAGTGGGAGAGGTTTCACCACCGCATTCTGACCTCCTCCTCCCAAAAGGTGCTAAACCTCTCTGACCTGTGTACATTCACAAACCAC
AGCTAGAATTCCTCCACCTAGGATTAAGCTGGAGAGAAGTAAGTAATTTAGGTTTCATGGTACTGTAGAGGCCAGGCTGAAATGTCATAT
CTGAAGGAAGAAAGCAGCAGCTGGACAATGTTTCTTTGCAAAGCAACACTCGAACCAAAAGATGCCTCAATCCCATTTTGATATTCATTT
TAGTGAAAGGATGCATCAGACCTGTTCCACATCATGCACATGGGAAAGGGTGGTTATCATTTTCCTTCTAACAAGTAGGTACAGATATTC
GGTTACTACACGTGCACCTGTAGCAGTATTTCTAGAAACATCCCTTTTTGTTGAGAACCTCCCTTGAATGTCTGTCACACTCACACCTGA
CGGGATGGTTACTGGATTAGAGAGTAGATTTGGCACATCTTTTCTTAGTCTTTTGATTCAAATTCAAAACTTAACAGCACAAACCAGGTC
AGAGTTACTTTCGGTTAGAATTTATTGCCATTTATTCCTTTTTATAAATTTCTATAGATTATACTGTTATTTTTATGTTATTGGCCTAGA
GCTACACGTATATGGGTTTGTCCTGAGTCCGTTTTCAAATGACCTTGTGATAGGGAAATGGTTTTGTCCATGTTCTTGGAAATACTTGTG
TATGTACAGAAGGAAGGGAGGGATTATTTTTCTACAAAGTAATTTATGATTTCTAATTTTCTAATGTGCCTTGGATATGTGCCAAATGAT


Top

FusionGenePPI for ZNF302_ANKRD27


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZNF302HGS, SMARCAD1, COPS5, CAND1, CBX5, CLIC1, CEP70, TP53, TMEM25, VWCE, RFPL4B, DMC1ANKRD27VAMP7, SMAD1, NFKBIA, DLK1, RAB40A, RAB40B, RAB40C, VPS26A, VPS26B, VPS29, HIF1AN, TPCN2, ZNF669, IKZF1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneANKRD27chr19:35169718chr19:33098738ENST00000306065-2129451_7307251051RAB32
TgeneANKRD27chr19:35169718chr19:33098738ENST00000306065-2129451_6007251051RAB38


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZNF302_ANKRD27


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ZNF302_ANKRD27


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource