FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 43184

FusionGeneSummary for ZNF292_MAP3K4

check button Fusion gene summary
Fusion gene informationFusion gene name: ZNF292_MAP3K4
Fusion gene ID: 43184
HgeneTgene
Gene symbol

ZNF292

MAP3K4

Gene ID

23036

4216

Gene namezinc finger protein 292mitogen-activated protein kinase kinase kinase 4
SynonymsNbla00365|ZFP292|ZN-16|Zn-15|bA393I2.3MAPKKK4|MEKK 4|MEKK4|MTK1|PRO0412
Cytomap

6q14.3

6q26

Type of geneprotein-codingprotein-coding
Descriptionzinc finger protein 29216 zinc-finger domain proteinputative protein product of Nbla00365mitogen-activated protein kinase kinase kinase 4MAP three kinase 1MAP/ERK kinase kinase 4MAPK/ERK kinase kinase 4MEK kinase 4SSK2/SSK22 MAP kinase kinase kinase, yeast, homolog ofdJ473J16.1 (mitogen-activated protein kinase kinase kinase 4)predicte
Modification date2018051920180524
UniProtAcc

O60281

Q9Y6R4

Ensembl transtripts involved in fusion geneENST00000369577, ENST00000339907, 
ENST00000392985, ENST00000369578, 
ENST00000366919, ENST00000392142, 
ENST00000348824, ENST00000366920, 
ENST00000446500, 
Fusion gene scores* DoF score11 X 2 X 7=1542 X 2 X 2=8
# samples 122
** MAII scorelog2(12/154*10)=-0.359895945086383
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: ZNF292 [Title/Abstract] AND MAP3K4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneMAP3K4

GO:0000186

activation of MAPKK activity

9305639|9827804

TgeneMAP3K4

GO:0043507

positive regulation of JUN kinase activity

9305639

TgeneMAP3K4

GO:1900745

positive regulation of p38MAPK cascade

9305639


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-A3M1-01AZNF292chr6

87865477

+MAP3K4chr6

161491640

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000369577ENST00000366919ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
In-frameENST00000369577ENST00000392142ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
In-frameENST00000369577ENST00000348824ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
In-frameENST00000369577ENST00000366920ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
5CDS-intronENST00000369577ENST00000446500ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
In-frameENST00000339907ENST00000366919ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
In-frameENST00000339907ENST00000392142ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
In-frameENST00000339907ENST00000348824ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
In-frameENST00000339907ENST00000366920ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
5CDS-intronENST00000339907ENST00000446500ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
In-frameENST00000392985ENST00000366919ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
In-frameENST00000392985ENST00000392142ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
In-frameENST00000392985ENST00000348824ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
In-frameENST00000392985ENST00000366920ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
5CDS-intronENST00000392985ENST00000446500ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
3UTR-3CDSENST00000369578ENST00000366919ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
3UTR-3CDSENST00000369578ENST00000392142ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
3UTR-3CDSENST00000369578ENST00000348824ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
3UTR-3CDSENST00000369578ENST00000366920ZNF292chr6

87865477

+MAP3K4chr6

161491640

+
3UTR-intronENST00000369578ENST00000446500ZNF292chr6

87865477

+MAP3K4chr6

161491640

+

Top

FusionProtFeatures for ZNF292_MAP3K4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZNF292

O60281

MAP3K4

Q9Y6R4

May be involved in transcriptional regulation. Component of a protein kinase signal transductioncascade. Activates the CSBP2, P38 and JNK MAPK pathways, but notthe ERK pathway. Specifically phosphorylates and activates MAP2K4and MAP2K6. {ECO:0000269|PubMed:12052864,ECO:0000269|PubMed:9305639}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMAP3K4chr6:87865477chr6:161491640ENST00000366919+2261190_12025691559Compositional biasNote=Poly-Ala
TgeneMAP3K4chr6:87865477chr6:161491640ENST00000392142+2271190_12025691609Compositional biasNote=Poly-Ala
TgeneMAP3K4chr6:87865477chr6:161491640ENST00000366919+2261343_16015691559DomainProtein kinase
TgeneMAP3K4chr6:87865477chr6:161491640ENST00000392142+2271343_16015691609DomainProtein kinase
TgeneMAP3K4chr6:87865477chr6:161491640ENST00000366919+2261349_13575691559Nucleotide bindingATP
TgeneMAP3K4chr6:87865477chr6:161491640ENST00000392142+2271349_13575691609Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZNF292chr6:87865477chr6:161491640ENST00000369577+181827_1854562724Coiled coilOntology_term=ECO:0000255
HgeneZNF292chr6:87865477chr6:161491640ENST00000369577+181098_1123562724Zinc fingerC2H2-type 7
HgeneZNF292chr6:87865477chr6:161491640ENST00000369577+181375_1397562724Zinc fingerC2H2-type 8%3B degenerate
HgeneZNF292chr6:87865477chr6:161491640ENST00000369577+181902_1927562724Zinc fingerC2H2-type 9
HgeneZNF292chr6:87865477chr6:161491640ENST00000369577+181947_1972562724Zinc fingerC2H2-type 10
HgeneZNF292chr6:87865477chr6:161491640ENST00000369577+182114_2139562724Zinc fingerC2H2-type 11
HgeneZNF292chr6:87865477chr6:161491640ENST00000369577+182172_2197562724Zinc fingerC2H2-type 12
HgeneZNF292chr6:87865477chr6:161491640ENST00000369577+182216_2241562724Zinc fingerC2H2-type 13
HgeneZNF292chr6:87865477chr6:161491640ENST00000369577+182256_2281562724Zinc fingerC2H2-type 14
HgeneZNF292chr6:87865477chr6:161491640ENST00000369577+182386_2410562724Zinc fingerC2H2-type 15
HgeneZNF292chr6:87865477chr6:161491640ENST00000369577+18569_591562724Zinc fingerC2H2-type 1
HgeneZNF292chr6:87865477chr6:161491640ENST00000369577+18681_705562724Zinc fingerC2H2-type 2
HgeneZNF292chr6:87865477chr6:161491640ENST00000369577+18722_744562724Zinc fingerC2H2-type 3
HgeneZNF292chr6:87865477chr6:161491640ENST00000369577+18750_774562724Zinc fingerC2H2-type 4
HgeneZNF292chr6:87865477chr6:161491640ENST00000369577+18779_803562724Zinc fingerC2H2-type 5
HgeneZNF292chr6:87865477chr6:161491640ENST00000369577+18807_831562724Zinc fingerC2H2-type 6
TgeneMAP3K4chr6:87865477chr6:161491640ENST00000366919+22625_385691559Compositional biasNote=Poly-Pro
TgeneMAP3K4chr6:87865477chr6:161491640ENST00000366919+2264_75691559Compositional biasNote=Poly-Ala
TgeneMAP3K4chr6:87865477chr6:161491640ENST00000392142+22725_385691609Compositional biasNote=Poly-Pro
TgeneMAP3K4chr6:87865477chr6:161491640ENST00000392142+2274_75691609Compositional biasNote=Poly-Ala


Top

FusionGeneSequence for ZNF292_MAP3K4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZNF292_ENST00000369577_chr6_87865477_+_MAP3K4_ENST00000366919_chr6_161491640_+_1046aa
MADEEAEQERLSCGEGGCVAELQRLGERLQELELQLRESRVPAVEAATDYCQQLCQFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVSWEE
LKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEED
LHKMLMVYFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTSADD
SSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRDLLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEK
SIILQLLNAAAGKDCSKDSDDVLIDAYLLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRKAFQ
QSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEVDESESVTLQQYYREAMIQGYNFGFEYHKEVVRL
MSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTGLYLA
IHRNSPRPMKVPRCHSDPPNPHLIIPTPEGFRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQ
SKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQVCDTPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKE
IRFQPNDHKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRD
IKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQ

>In-frame_ZNF292_ENST00000369577_chr6_87865477_+_MAP3K4_ENST00000392142_chr6_161491640_+_1096aa
MADEEAEQERLSCGEGGCVAELQRLGERLQELELQLRESRVPAVEAATDYCQQLCQFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVSWEE
LKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEED
LHKMLMVYFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTSADD
SSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRDLLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEK
SIILQLLNAAAGKDCSKDSDDVLIDAYLLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRKAFQ
QSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEVDESESVTLQQYYREAMIQGYNFGFEYHKEVVRL
MSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTGLYLA
IHRNSPRPMKVPRCHSDPPNPHLIIPTPEGFSTRSMPSDARSHGSPAAAAAAAAAAVAASRPSPSGGDSVLPKSISSAHDTRGSSVPEND
RLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQVCD
TPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLVRYFGVELHRE
EMYIFMEYCDEGTLEEVSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTL
GTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYKVGMGHKPPIPERLSPEGKDFLSHCLESDPKMRWTAS

>In-frame_ZNF292_ENST00000369577_chr6_87865477_+_MAP3K4_ENST00000348824_chr6_161491640_+_1042aa
MADEEAEQERLSCGEGGCVAELQRLGERLQELELQLRESRVPAVEAATDYCQQLCQFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVSWEE
LKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEED
LHKMLMVYFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTSADD
SSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRDLLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEK
SIILQLLNAAAGKDCSKDSDDVLIDAYLLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRKAFQ
QSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEVDESESVTLQQYYREAMIQGYNFGFEYHKEVVRL
MSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTAIHRN
SPRPMKVPRCHSDPPNPHLIIPTPEGFRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDT
ASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQVCDTPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQ
PNDHKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRDIKGA
NIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYK

>In-frame_ZNF292_ENST00000369577_chr6_87865477_+_MAP3K4_ENST00000366920_chr6_161491640_+_1092aa
MADEEAEQERLSCGEGGCVAELQRLGERLQELELQLRESRVPAVEAATDYCQQLCQFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVSWEE
LKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEED
LHKMLMVYFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTSADD
SSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRDLLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEK
SIILQLLNAAAGKDCSKDSDDVLIDAYLLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRKAFQ
QSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEVDESESVTLQQYYREAMIQGYNFGFEYHKEVVRL
MSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTAIHRN
SPRPMKVPRCHSDPPNPHLIIPTPEGFSTRSMPSDARSHGSPAAAAAAAAAAVAASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLAS
IAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQVCDTPKS
YDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYI
FMEYCDEGTLEEVSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAA
YMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYKVGMGHKPPIPERLSPEGKDFLSHCLESDPKMRWTASQLLD

>In-frame_ZNF292_ENST00000339907_chr6_87865477_+_MAP3K4_ENST00000366919_chr6_161491640_+_1046aa
MADEEAEQERLSCGEGGCVAELQRLGERLQELELQLRESRVPAVEAATDYCQQLCQFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVSWEE
LKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEED
LHKMLMVYFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTSADD
SSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRDLLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEK
SIILQLLNAAAGKDCSKDSDDVLIDAYLLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRKAFQ
QSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEVDESESVTLQQYYREAMIQGYNFGFEYHKEVVRL
MSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTGLYLA
IHRNSPRPMKVPRCHSDPPNPHLIIPTPEGFRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQ
SKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQVCDTPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKE
IRFQPNDHKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRD
IKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQ

>In-frame_ZNF292_ENST00000339907_chr6_87865477_+_MAP3K4_ENST00000392142_chr6_161491640_+_1096aa
MADEEAEQERLSCGEGGCVAELQRLGERLQELELQLRESRVPAVEAATDYCQQLCQFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVSWEE
LKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEED
LHKMLMVYFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTSADD
SSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRDLLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEK
SIILQLLNAAAGKDCSKDSDDVLIDAYLLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRKAFQ
QSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEVDESESVTLQQYYREAMIQGYNFGFEYHKEVVRL
MSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTGLYLA
IHRNSPRPMKVPRCHSDPPNPHLIIPTPEGFSTRSMPSDARSHGSPAAAAAAAAAAVAASRPSPSGGDSVLPKSISSAHDTRGSSVPEND
RLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQVCD
TPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLVRYFGVELHRE
EMYIFMEYCDEGTLEEVSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTL
GTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYKVGMGHKPPIPERLSPEGKDFLSHCLESDPKMRWTAS

>In-frame_ZNF292_ENST00000339907_chr6_87865477_+_MAP3K4_ENST00000348824_chr6_161491640_+_1042aa
MADEEAEQERLSCGEGGCVAELQRLGERLQELELQLRESRVPAVEAATDYCQQLCQFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVSWEE
LKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEED
LHKMLMVYFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTSADD
SSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRDLLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEK
SIILQLLNAAAGKDCSKDSDDVLIDAYLLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRKAFQ
QSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEVDESESVTLQQYYREAMIQGYNFGFEYHKEVVRL
MSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTAIHRN
SPRPMKVPRCHSDPPNPHLIIPTPEGFRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDT
ASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQVCDTPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQ
PNDHKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRDIKGA
NIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYK

>In-frame_ZNF292_ENST00000339907_chr6_87865477_+_MAP3K4_ENST00000366920_chr6_161491640_+_1092aa
MADEEAEQERLSCGEGGCVAELQRLGERLQELELQLRESRVPAVEAATDYCQQLCQFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVSWEE
LKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEED
LHKMLMVYFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTSADD
SSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRDLLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEK
SIILQLLNAAAGKDCSKDSDDVLIDAYLLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRKAFQ
QSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEVDESESVTLQQYYREAMIQGYNFGFEYHKEVVRL
MSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTAIHRN
SPRPMKVPRCHSDPPNPHLIIPTPEGFSTRSMPSDARSHGSPAAAAAAAAAAVAASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLAS
IAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQVCDTPKS
YDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYI
FMEYCDEGTLEEVSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAA
YMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYKVGMGHKPPIPERLSPEGKDFLSHCLESDPKMRWTASQLLD

>In-frame_ZNF292_ENST00000392985_chr6_87865477_+_MAP3K4_ENST00000366919_chr6_161491640_+_1046aa
MADEEAEQERLSCGEGGCVAELQRLGERLQELELQLRESRVPAVEAATDYCQQLCQFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVSWEE
LKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEED
LHKMLMVYFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTSADD
SSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRDLLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEK
SIILQLLNAAAGKDCSKDSDDVLIDAYLLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRKAFQ
QSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEVDESESVTLQQYYREAMIQGYNFGFEYHKEVVRL
MSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTGLYLA
IHRNSPRPMKVPRCHSDPPNPHLIIPTPEGFRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQ
SKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQVCDTPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKE
IRFQPNDHKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRD
IKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQ

>In-frame_ZNF292_ENST00000392985_chr6_87865477_+_MAP3K4_ENST00000392142_chr6_161491640_+_1096aa
MADEEAEQERLSCGEGGCVAELQRLGERLQELELQLRESRVPAVEAATDYCQQLCQFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVSWEE
LKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEED
LHKMLMVYFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTSADD
SSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRDLLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEK
SIILQLLNAAAGKDCSKDSDDVLIDAYLLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRKAFQ
QSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEVDESESVTLQQYYREAMIQGYNFGFEYHKEVVRL
MSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTGLYLA
IHRNSPRPMKVPRCHSDPPNPHLIIPTPEGFSTRSMPSDARSHGSPAAAAAAAAAAVAASRPSPSGGDSVLPKSISSAHDTRGSSVPEND
RLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQVCD
TPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLVRYFGVELHRE
EMYIFMEYCDEGTLEEVSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTL
GTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYKVGMGHKPPIPERLSPEGKDFLSHCLESDPKMRWTAS

>In-frame_ZNF292_ENST00000392985_chr6_87865477_+_MAP3K4_ENST00000348824_chr6_161491640_+_1042aa
MADEEAEQERLSCGEGGCVAELQRLGERLQELELQLRESRVPAVEAATDYCQQLCQFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVSWEE
LKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEED
LHKMLMVYFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTSADD
SSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRDLLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEK
SIILQLLNAAAGKDCSKDSDDVLIDAYLLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRKAFQ
QSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEVDESESVTLQQYYREAMIQGYNFGFEYHKEVVRL
MSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTAIHRN
SPRPMKVPRCHSDPPNPHLIIPTPEGFRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDT
ASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQVCDTPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQ
PNDHKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRDIKGA
NIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYK

>In-frame_ZNF292_ENST00000392985_chr6_87865477_+_MAP3K4_ENST00000366920_chr6_161491640_+_1092aa
MADEEAEQERLSCGEGGCVAELQRLGERLQELELQLRESRVPAVEAATDYCQQLCQFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVSWEE
LKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEED
LHKMLMVYFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTSADD
SSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRDLLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEK
SIILQLLNAAAGKDCSKDSDDVLIDAYLLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRKAFQ
QSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEVDESESVTLQQYYREAMIQGYNFGFEYHKEVVRL
MSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTAIHRN
SPRPMKVPRCHSDPPNPHLIIPTPEGFSTRSMPSDARSHGSPAAAAAAAAAAVAASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLAS
IAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQVCDTPKS
YDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYI
FMEYCDEGTLEEVSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAA
YMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYKVGMGHKPPIPERLSPEGKDFLSHCLESDPKMRWTASQLLD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZNF292_ENST00000369577_chr6_87865477_+_MAP3K4_ENST00000366919_chr6_161491640_+_3138nt
ATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAG
GAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTT
CCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAG
CTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTA
AGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTG
CTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGAT
CTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAA
AATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGAC
ATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGAC
AGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCC
AAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGAT
GTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAG
AGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTG
ACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACT
GTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAG
CAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGAT
GCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCT
GAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTG
ATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGT
GGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGAT
GACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGGTTTGTACCTTGCC
ATTCATCGGAACAGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGA
TTCAGGGGTTCCAGCGTTCCTGAAAATGATCGATTGGCTTCCATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCC
ACGGAGGAGCGAGATGAACCAGCATATCCAAGAGGAGATTCAAGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAG
AGTAAAGATACTGCTTCTAAACTAGGACCCATAGAAGCTATCCAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGG
AGAAAGAATATCATTGGTCAAGTTTGTGATACGCCTAAGTCCTATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGG
CAAAGAGGAAACAAAATTGGAGAAGGCCAGTATGGGAAGGTGTACACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAG
ATTCGATTTCAACCTAATGACCATAAGACTATCAAGGAAACTGCAGACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTT
CGGTATTTTGGTGTGGAGCTCCATAGAGAAGAAATGTACATCTTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTG
GGACTTCAGGAACATGTGATTAGGCTGTATTCAAAGCAGATCACCATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGAC
ATTAAAGGTGCCAATATCTTCCTTACCTCATCTGGATTAATCAAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAG
ACCATGCCTGGTGAAGTGAACAGCACCCTGGGGACAGCAGCATACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGG
CGTGCGGCCGACATCTGGAGTCTGGGGTGTGTTGTCATAGAGATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAA
ATTATGTATAAAGTGGGGATGGGACATAAGCCACCAATCCCTGAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAG

>In-frame_ZNF292_ENST00000369577_chr6_87865477_+_MAP3K4_ENST00000392142_chr6_161491640_+_3288nt
ATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAG
GAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTT
CCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAG
CTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTA
AGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTG
CTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGAT
CTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAA
AATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGAC
ATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGAC
AGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCC
AAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGAT
GTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAG
AGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTG
ACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACT
GTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAG
CAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGAT
GCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCT
GAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTG
ATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGT
GGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGAT
GACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGGTTTGTACCTTGCC
ATTCATCGGAACAGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGA
TTCAGCACTCGGAGCATGCCTTCCGACGCGCGGAGCCATGGCAGCCCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGTTGCTGCCAGT
CGGCCCAGCCCCTCTGGTGGTGACTCTGTGCTGCCCAAATCCATCAGCAGTGCCCATGATACCAGGGGTTCCAGCGTTCCTGAAAATGAT
CGATTGGCTTCCATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCCACGGAGGAGCGAGATGAACCAGCATATCCA
AGAGGAGATTCAAGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAGAGTAAAGATACTGCTTCTAAACTAGGACCC
ATAGAAGCTATCCAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGGAGAAAGAATATCATTGGTCAAGTTTGTGAT
ACGCCTAAGTCCTATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGGCAAAGAGGAAACAAAATTGGAGAAGGCCAG
TATGGGAAGGTGTACACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAGATTCGATTTCAACCTAATGACCATAAGACT
ATCAAGGAAACTGCAGACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTTCGGTATTTTGGTGTGGAGCTCCATAGAGAA
GAAATGTACATCTTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTGGGACTTCAGGAACATGTGATTAGGCTGTAT
TCAAAGCAGATCACCATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGACATTAAAGGTGCCAATATCTTCCTTACCTCA
TCTGGATTAATCAAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAGACCATGCCTGGTGAAGTGAACAGCACCCTG
GGGACAGCAGCATACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGGCGTGCGGCCGACATCTGGAGTCTGGGGTGT
GTTGTCATAGAGATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAAATTATGTATAAAGTGGGGATGGGACATAAG
CCACCAATCCCTGAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAGAGTGACCCAAAGATGAGATGGACCGCCAGC

>In-frame_ZNF292_ENST00000369577_chr6_87865477_+_MAP3K4_ENST00000348824_chr6_161491640_+_3126nt
ATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAG
GAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTT
CCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAG
CTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTA
AGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTG
CTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGAT
CTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAA
AATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGAC
ATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGAC
AGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCC
AAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGAT
GTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAG
AGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTG
ACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACT
GTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAG
CAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGAT
GCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCT
GAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTG
ATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGT
GGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGAT
GACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGCCATTCATCGGAAC
AGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGATTCAGGGGTTCC
AGCGTTCCTGAAAATGATCGATTGGCTTCCATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCCACGGAGGAGCGA
GATGAACCAGCATATCCAAGAGGAGATTCAAGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAGAGTAAAGATACT
GCTTCTAAACTAGGACCCATAGAAGCTATCCAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGGAGAAAGAATATC
ATTGGTCAAGTTTGTGATACGCCTAAGTCCTATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGGCAAAGAGGAAAC
AAAATTGGAGAAGGCCAGTATGGGAAGGTGTACACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAGATTCGATTTCAA
CCTAATGACCATAAGACTATCAAGGAAACTGCAGACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTTCGGTATTTTGGT
GTGGAGCTCCATAGAGAAGAAATGTACATCTTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTGGGACTTCAGGAA
CATGTGATTAGGCTGTATTCAAAGCAGATCACCATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGACATTAAAGGTGCC
AATATCTTCCTTACCTCATCTGGATTAATCAAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAGACCATGCCTGGT
GAAGTGAACAGCACCCTGGGGACAGCAGCATACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGGCGTGCGGCCGAC
ATCTGGAGTCTGGGGTGTGTTGTCATAGAGATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAAATTATGTATAAA
GTGGGGATGGGACATAAGCCACCAATCCCTGAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAGAGTGACCCAAAG

>In-frame_ZNF292_ENST00000369577_chr6_87865477_+_MAP3K4_ENST00000366920_chr6_161491640_+_3276nt
ATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAG
GAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTT
CCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAG
CTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTA
AGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTG
CTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGAT
CTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAA
AATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGAC
ATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGAC
AGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCC
AAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGAT
GTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAG
AGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTG
ACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACT
GTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAG
CAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGAT
GCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCT
GAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTG
ATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGT
GGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGAT
GACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGCCATTCATCGGAAC
AGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGATTCAGCACTCGG
AGCATGCCTTCCGACGCGCGGAGCCATGGCAGCCCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGTTGCTGCCAGTCGGCCCAGCCCC
TCTGGTGGTGACTCTGTGCTGCCCAAATCCATCAGCAGTGCCCATGATACCAGGGGTTCCAGCGTTCCTGAAAATGATCGATTGGCTTCC
ATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCCACGGAGGAGCGAGATGAACCAGCATATCCAAGAGGAGATTCA
AGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAGAGTAAAGATACTGCTTCTAAACTAGGACCCATAGAAGCTATC
CAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGGAGAAAGAATATCATTGGTCAAGTTTGTGATACGCCTAAGTCC
TATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGGCAAAGAGGAAACAAAATTGGAGAAGGCCAGTATGGGAAGGTG
TACACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAGATTCGATTTCAACCTAATGACCATAAGACTATCAAGGAAACT
GCAGACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTTCGGTATTTTGGTGTGGAGCTCCATAGAGAAGAAATGTACATC
TTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTGGGACTTCAGGAACATGTGATTAGGCTGTATTCAAAGCAGATC
ACCATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGACATTAAAGGTGCCAATATCTTCCTTACCTCATCTGGATTAATC
AAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAGACCATGCCTGGTGAAGTGAACAGCACCCTGGGGACAGCAGCA
TACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGGCGTGCGGCCGACATCTGGAGTCTGGGGTGTGTTGTCATAGAG
ATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAAATTATGTATAAAGTGGGGATGGGACATAAGCCACCAATCCCT
GAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAGAGTGACCCAAAGATGAGATGGACCGCCAGCCAGCTCCTCGAC

>In-frame_ZNF292_ENST00000339907_chr6_87865477_+_MAP3K4_ENST00000366919_chr6_161491640_+_3138nt
ATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAG
GAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTT
CCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAG
CTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTA
AGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTG
CTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGAT
CTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAA
AATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGAC
ATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGAC
AGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCC
AAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGAT
GTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAG
AGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTG
ACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACT
GTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAG
CAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGAT
GCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCT
GAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTG
ATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGT
GGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGAT
GACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGGTTTGTACCTTGCC
ATTCATCGGAACAGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGA
TTCAGGGGTTCCAGCGTTCCTGAAAATGATCGATTGGCTTCCATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCC
ACGGAGGAGCGAGATGAACCAGCATATCCAAGAGGAGATTCAAGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAG
AGTAAAGATACTGCTTCTAAACTAGGACCCATAGAAGCTATCCAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGG
AGAAAGAATATCATTGGTCAAGTTTGTGATACGCCTAAGTCCTATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGG
CAAAGAGGAAACAAAATTGGAGAAGGCCAGTATGGGAAGGTGTACACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAG
ATTCGATTTCAACCTAATGACCATAAGACTATCAAGGAAACTGCAGACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTT
CGGTATTTTGGTGTGGAGCTCCATAGAGAAGAAATGTACATCTTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTG
GGACTTCAGGAACATGTGATTAGGCTGTATTCAAAGCAGATCACCATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGAC
ATTAAAGGTGCCAATATCTTCCTTACCTCATCTGGATTAATCAAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAG
ACCATGCCTGGTGAAGTGAACAGCACCCTGGGGACAGCAGCATACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGG
CGTGCGGCCGACATCTGGAGTCTGGGGTGTGTTGTCATAGAGATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAA
ATTATGTATAAAGTGGGGATGGGACATAAGCCACCAATCCCTGAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAG

>In-frame_ZNF292_ENST00000339907_chr6_87865477_+_MAP3K4_ENST00000392142_chr6_161491640_+_3288nt
ATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAG
GAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTT
CCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAG
CTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTA
AGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTG
CTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGAT
CTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAA
AATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGAC
ATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGAC
AGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCC
AAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGAT
GTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAG
AGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTG
ACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACT
GTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAG
CAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGAT
GCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCT
GAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTG
ATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGT
GGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGAT
GACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGGTTTGTACCTTGCC
ATTCATCGGAACAGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGA
TTCAGCACTCGGAGCATGCCTTCCGACGCGCGGAGCCATGGCAGCCCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGTTGCTGCCAGT
CGGCCCAGCCCCTCTGGTGGTGACTCTGTGCTGCCCAAATCCATCAGCAGTGCCCATGATACCAGGGGTTCCAGCGTTCCTGAAAATGAT
CGATTGGCTTCCATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCCACGGAGGAGCGAGATGAACCAGCATATCCA
AGAGGAGATTCAAGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAGAGTAAAGATACTGCTTCTAAACTAGGACCC
ATAGAAGCTATCCAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGGAGAAAGAATATCATTGGTCAAGTTTGTGAT
ACGCCTAAGTCCTATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGGCAAAGAGGAAACAAAATTGGAGAAGGCCAG
TATGGGAAGGTGTACACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAGATTCGATTTCAACCTAATGACCATAAGACT
ATCAAGGAAACTGCAGACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTTCGGTATTTTGGTGTGGAGCTCCATAGAGAA
GAAATGTACATCTTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTGGGACTTCAGGAACATGTGATTAGGCTGTAT
TCAAAGCAGATCACCATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGACATTAAAGGTGCCAATATCTTCCTTACCTCA
TCTGGATTAATCAAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAGACCATGCCTGGTGAAGTGAACAGCACCCTG
GGGACAGCAGCATACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGGCGTGCGGCCGACATCTGGAGTCTGGGGTGT
GTTGTCATAGAGATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAAATTATGTATAAAGTGGGGATGGGACATAAG
CCACCAATCCCTGAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAGAGTGACCCAAAGATGAGATGGACCGCCAGC

>In-frame_ZNF292_ENST00000339907_chr6_87865477_+_MAP3K4_ENST00000348824_chr6_161491640_+_3126nt
ATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAG
GAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTT
CCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAG
CTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTA
AGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTG
CTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGAT
CTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAA
AATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGAC
ATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGAC
AGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCC
AAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGAT
GTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAG
AGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTG
ACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACT
GTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAG
CAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGAT
GCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCT
GAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTG
ATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGT
GGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGAT
GACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGCCATTCATCGGAAC
AGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGATTCAGGGGTTCC
AGCGTTCCTGAAAATGATCGATTGGCTTCCATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCCACGGAGGAGCGA
GATGAACCAGCATATCCAAGAGGAGATTCAAGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAGAGTAAAGATACT
GCTTCTAAACTAGGACCCATAGAAGCTATCCAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGGAGAAAGAATATC
ATTGGTCAAGTTTGTGATACGCCTAAGTCCTATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGGCAAAGAGGAAAC
AAAATTGGAGAAGGCCAGTATGGGAAGGTGTACACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAGATTCGATTTCAA
CCTAATGACCATAAGACTATCAAGGAAACTGCAGACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTTCGGTATTTTGGT
GTGGAGCTCCATAGAGAAGAAATGTACATCTTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTGGGACTTCAGGAA
CATGTGATTAGGCTGTATTCAAAGCAGATCACCATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGACATTAAAGGTGCC
AATATCTTCCTTACCTCATCTGGATTAATCAAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAGACCATGCCTGGT
GAAGTGAACAGCACCCTGGGGACAGCAGCATACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGGCGTGCGGCCGAC
ATCTGGAGTCTGGGGTGTGTTGTCATAGAGATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAAATTATGTATAAA
GTGGGGATGGGACATAAGCCACCAATCCCTGAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAGAGTGACCCAAAG

>In-frame_ZNF292_ENST00000339907_chr6_87865477_+_MAP3K4_ENST00000366920_chr6_161491640_+_3276nt
ATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAG
GAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTT
CCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAG
CTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTA
AGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTG
CTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGAT
CTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAA
AATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGAC
ATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGAC
AGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCC
AAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGAT
GTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAG
AGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTG
ACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACT
GTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAG
CAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGAT
GCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCT
GAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTG
ATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGT
GGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGAT
GACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGCCATTCATCGGAAC
AGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGATTCAGCACTCGG
AGCATGCCTTCCGACGCGCGGAGCCATGGCAGCCCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGTTGCTGCCAGTCGGCCCAGCCCC
TCTGGTGGTGACTCTGTGCTGCCCAAATCCATCAGCAGTGCCCATGATACCAGGGGTTCCAGCGTTCCTGAAAATGATCGATTGGCTTCC
ATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCCACGGAGGAGCGAGATGAACCAGCATATCCAAGAGGAGATTCA
AGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAGAGTAAAGATACTGCTTCTAAACTAGGACCCATAGAAGCTATC
CAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGGAGAAAGAATATCATTGGTCAAGTTTGTGATACGCCTAAGTCC
TATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGGCAAAGAGGAAACAAAATTGGAGAAGGCCAGTATGGGAAGGTG
TACACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAGATTCGATTTCAACCTAATGACCATAAGACTATCAAGGAAACT
GCAGACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTTCGGTATTTTGGTGTGGAGCTCCATAGAGAAGAAATGTACATC
TTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTGGGACTTCAGGAACATGTGATTAGGCTGTATTCAAAGCAGATC
ACCATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGACATTAAAGGTGCCAATATCTTCCTTACCTCATCTGGATTAATC
AAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAGACCATGCCTGGTGAAGTGAACAGCACCCTGGGGACAGCAGCA
TACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGGCGTGCGGCCGACATCTGGAGTCTGGGGTGTGTTGTCATAGAG
ATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAAATTATGTATAAAGTGGGGATGGGACATAAGCCACCAATCCCT
GAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAGAGTGACCCAAAGATGAGATGGACCGCCAGCCAGCTCCTCGAC

>In-frame_ZNF292_ENST00000392985_chr6_87865477_+_MAP3K4_ENST00000366919_chr6_161491640_+_3138nt
ATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAG
GAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTT
CCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAG
CTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTA
AGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTG
CTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGAT
CTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAA
AATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGAC
ATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGAC
AGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCC
AAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGAT
GTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAG
AGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTG
ACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACT
GTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAG
CAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGAT
GCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCT
GAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTG
ATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGT
GGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGAT
GACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGGTTTGTACCTTGCC
ATTCATCGGAACAGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGA
TTCAGGGGTTCCAGCGTTCCTGAAAATGATCGATTGGCTTCCATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCC
ACGGAGGAGCGAGATGAACCAGCATATCCAAGAGGAGATTCAAGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAG
AGTAAAGATACTGCTTCTAAACTAGGACCCATAGAAGCTATCCAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGG
AGAAAGAATATCATTGGTCAAGTTTGTGATACGCCTAAGTCCTATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGG
CAAAGAGGAAACAAAATTGGAGAAGGCCAGTATGGGAAGGTGTACACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAG
ATTCGATTTCAACCTAATGACCATAAGACTATCAAGGAAACTGCAGACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTT
CGGTATTTTGGTGTGGAGCTCCATAGAGAAGAAATGTACATCTTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTG
GGACTTCAGGAACATGTGATTAGGCTGTATTCAAAGCAGATCACCATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGAC
ATTAAAGGTGCCAATATCTTCCTTACCTCATCTGGATTAATCAAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAG
ACCATGCCTGGTGAAGTGAACAGCACCCTGGGGACAGCAGCATACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGG
CGTGCGGCCGACATCTGGAGTCTGGGGTGTGTTGTCATAGAGATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAA
ATTATGTATAAAGTGGGGATGGGACATAAGCCACCAATCCCTGAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAG

>In-frame_ZNF292_ENST00000392985_chr6_87865477_+_MAP3K4_ENST00000392142_chr6_161491640_+_3288nt
ATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAG
GAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTT
CCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAG
CTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTA
AGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTG
CTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGAT
CTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAA
AATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGAC
ATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGAC
AGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCC
AAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGAT
GTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAG
AGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTG
ACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACT
GTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAG
CAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGAT
GCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCT
GAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTG
ATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGT
GGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGAT
GACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGGTTTGTACCTTGCC
ATTCATCGGAACAGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGA
TTCAGCACTCGGAGCATGCCTTCCGACGCGCGGAGCCATGGCAGCCCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGTTGCTGCCAGT
CGGCCCAGCCCCTCTGGTGGTGACTCTGTGCTGCCCAAATCCATCAGCAGTGCCCATGATACCAGGGGTTCCAGCGTTCCTGAAAATGAT
CGATTGGCTTCCATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCCACGGAGGAGCGAGATGAACCAGCATATCCA
AGAGGAGATTCAAGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAGAGTAAAGATACTGCTTCTAAACTAGGACCC
ATAGAAGCTATCCAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGGAGAAAGAATATCATTGGTCAAGTTTGTGAT
ACGCCTAAGTCCTATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGGCAAAGAGGAAACAAAATTGGAGAAGGCCAG
TATGGGAAGGTGTACACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAGATTCGATTTCAACCTAATGACCATAAGACT
ATCAAGGAAACTGCAGACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTTCGGTATTTTGGTGTGGAGCTCCATAGAGAA
GAAATGTACATCTTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTGGGACTTCAGGAACATGTGATTAGGCTGTAT
TCAAAGCAGATCACCATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGACATTAAAGGTGCCAATATCTTCCTTACCTCA
TCTGGATTAATCAAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAGACCATGCCTGGTGAAGTGAACAGCACCCTG
GGGACAGCAGCATACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGGCGTGCGGCCGACATCTGGAGTCTGGGGTGT
GTTGTCATAGAGATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAAATTATGTATAAAGTGGGGATGGGACATAAG
CCACCAATCCCTGAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAGAGTGACCCAAAGATGAGATGGACCGCCAGC

>In-frame_ZNF292_ENST00000392985_chr6_87865477_+_MAP3K4_ENST00000348824_chr6_161491640_+_3126nt
ATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAG
GAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTT
CCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAG
CTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTA
AGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTG
CTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGAT
CTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAA
AATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGAC
ATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGAC
AGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCC
AAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGAT
GTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAG
AGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTG
ACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACT
GTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAG
CAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGAT
GCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCT
GAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTG
ATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGT
GGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGAT
GACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGCCATTCATCGGAAC
AGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGATTCAGGGGTTCC
AGCGTTCCTGAAAATGATCGATTGGCTTCCATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCCACGGAGGAGCGA
GATGAACCAGCATATCCAAGAGGAGATTCAAGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAGAGTAAAGATACT
GCTTCTAAACTAGGACCCATAGAAGCTATCCAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGGAGAAAGAATATC
ATTGGTCAAGTTTGTGATACGCCTAAGTCCTATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGGCAAAGAGGAAAC
AAAATTGGAGAAGGCCAGTATGGGAAGGTGTACACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAGATTCGATTTCAA
CCTAATGACCATAAGACTATCAAGGAAACTGCAGACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTTCGGTATTTTGGT
GTGGAGCTCCATAGAGAAGAAATGTACATCTTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTGGGACTTCAGGAA
CATGTGATTAGGCTGTATTCAAAGCAGATCACCATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGACATTAAAGGTGCC
AATATCTTCCTTACCTCATCTGGATTAATCAAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAGACCATGCCTGGT
GAAGTGAACAGCACCCTGGGGACAGCAGCATACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGGCGTGCGGCCGAC
ATCTGGAGTCTGGGGTGTGTTGTCATAGAGATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAAATTATGTATAAA
GTGGGGATGGGACATAAGCCACCAATCCCTGAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAGAGTGACCCAAAG

>In-frame_ZNF292_ENST00000392985_chr6_87865477_+_MAP3K4_ENST00000366920_chr6_161491640_+_3276nt
ATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAG
GAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTT
CCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAG
CTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTA
AGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTG
CTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGAT
CTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAA
AATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGAC
ATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGAC
AGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCC
AAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGAT
GTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAG
AGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTG
ACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACT
GTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAG
CAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGAT
GCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCT
GAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTG
ATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGT
GGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGAT
GACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGCCATTCATCGGAAC
AGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGATTCAGCACTCGG
AGCATGCCTTCCGACGCGCGGAGCCATGGCAGCCCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGTTGCTGCCAGTCGGCCCAGCCCC
TCTGGTGGTGACTCTGTGCTGCCCAAATCCATCAGCAGTGCCCATGATACCAGGGGTTCCAGCGTTCCTGAAAATGATCGATTGGCTTCC
ATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCCACGGAGGAGCGAGATGAACCAGCATATCCAAGAGGAGATTCA
AGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAGAGTAAAGATACTGCTTCTAAACTAGGACCCATAGAAGCTATC
CAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGGAGAAAGAATATCATTGGTCAAGTTTGTGATACGCCTAAGTCC
TATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGGCAAAGAGGAAACAAAATTGGAGAAGGCCAGTATGGGAAGGTG
TACACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAGATTCGATTTCAACCTAATGACCATAAGACTATCAAGGAAACT
GCAGACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTTCGGTATTTTGGTGTGGAGCTCCATAGAGAAGAAATGTACATC
TTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTGGGACTTCAGGAACATGTGATTAGGCTGTATTCAAAGCAGATC
ACCATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGACATTAAAGGTGCCAATATCTTCCTTACCTCATCTGGATTAATC
AAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAGACCATGCCTGGTGAAGTGAACAGCACCCTGGGGACAGCAGCA
TACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGGCGTGCGGCCGACATCTGGAGTCTGGGGTGTGTTGTCATAGAG
ATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAAATTATGTATAAAGTGGGGATGGGACATAAGCCACCAATCCCT
GAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAGAGTGACCCAAAGATGAGATGGACCGCCAGCCAGCTCCTCGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZNF292_ENST00000369577_chr6_87865477_+_MAP3K4_ENST00000366919_chr6_161491640_+_3696nt
ATCACGTGACCCAGGTGCGTACGCGACGGAGCGGGGTGTGAAGATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGG
CGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAGGAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGC
GGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTTCCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACC
ACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAGCTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCT
CTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTAAGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAA
GCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTGCTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGA
CTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGATCTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGAT
CCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAAAATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTA
CATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGACATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGG
CTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGACAGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCG
AGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCCAAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGC
AGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGATGTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGA
AAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAGAGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTC
AAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTGACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCAC
CTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACTGTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGT
CATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAGCAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAG
TCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGATGCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGA
CCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCTGAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGG
GTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTGATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTT
TGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGTGGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCT
ACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGATGACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGT
CATAGGAAAACCACACAGTCCTGTTACAGGTTTGTACCTTGCCATTCATCGGAACAGCCCCCGTCCTATGAAGGTACCTCGATGCCATAG
TGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGATTCAGGGGTTCCAGCGTTCCTGAAAATGATCGATTGGCTTCCATAGC
TGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCCACGGAGGAGCGAGATGAACCAGCATATCCAAGAGGAGATTCAAGTGG
GTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAGAGTAAAGATACTGCTTCTAAACTAGGACCCATAGAAGCTATCCAGAA
GTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGGAGAAAGAATATCATTGGTCAAGTTTGTGATACGCCTAAGTCCTATGA
TAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGGCAAAGAGGAAACAAAATTGGAGAAGGCCAGTATGGGAAGGTGTACAC
CTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAGATTCGATTTCAACCTAATGACCATAAGACTATCAAGGAAACTGCAGA
CGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTTCGGTATTTTGGTGTGGAGCTCCATAGAGAAGAAATGTACATCTTCAT
GGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTGGGACTTCAGGAACATGTGATTAGGCTGTATTCAAAGCAGATCACCAT
TGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGACATTAAAGGTGCCAATATCTTCCTTACCTCATCTGGATTAATCAAACT
GGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAGACCATGCCTGGTGAAGTGAACAGCACCCTGGGGACAGCAGCATACAT
GGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGGCGTGCGGCCGACATCTGGAGTCTGGGGTGTGTTGTCATAGAGATGGT
GACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAAATTATGTATAAAGTGGGGATGGGACATAAGCCACCAATCCCTGAAAG
ATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAGAGTGACCCAAAGATGAGATGGACCGCCAGCCAGCTCCTCGACCATTC
GTTTGTCAAGGTTTGCACAGATGAAGAATGAAGCCTAGTAGAATATGGACTTGGAAAATTCTCTTAATCACTACTGTATGTAATATTTAC
ATAAAGACTGTGCTGAGAAGCAGTATAAGCCTTTTTAACCTTCCAAGACTGAAGACTGCACAGGTGACAAGCGTCACTTCTCCTGCTGCT
CCTGTTTGTCTGATGTGGCAAAAGGCCCTCTGGAGGGCTGGTGGCCACGAGGTTAAAGAAGCTGCATGTTAAGTGCCATTACTACTGTAC
ACGGACCATCGCCTCTGTCTCCTCCGTGTCTCGCGCGACTGAGAACCGTGACATCAGCGTAGTGTTTTGACCTTTCTAGGTTCAAAAGAA
GTTGTAGTGTTATCAGGCGTCCCATACCTTGTTTTTAATCTCCTGTTTGTTGAGTGCACTGACTGTGAAACCTTTACCTTTTTTGTTGTT
GTTGGCAAGCTGCAGGTTTGTAATGCAAAAGGCTGATTACTGAAATTTAAGAAAAAGGTTCTTTTTTCAATAAATGGTTTATTTTAGGAA

>In-frame_ZNF292_ENST00000369577_chr6_87865477_+_MAP3K4_ENST00000392142_chr6_161491640_+_3846nt
ATCACGTGACCCAGGTGCGTACGCGACGGAGCGGGGTGTGAAGATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGG
CGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAGGAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGC
GGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTTCCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACC
ACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAGCTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCT
CTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTAAGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAA
GCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTGCTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGA
CTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGATCTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGAT
CCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAAAATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTA
CATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGACATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGG
CTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGACAGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCG
AGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCCAAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGC
AGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGATGTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGA
AAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAGAGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTC
AAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTGACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCAC
CTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACTGTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGT
CATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAGCAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAG
TCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGATGCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGA
CCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCTGAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGG
GTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTGATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTT
TGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGTGGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCT
ACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGATGACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGT
CATAGGAAAACCACACAGTCCTGTTACAGGTTTGTACCTTGCCATTCATCGGAACAGCCCCCGTCCTATGAAGGTACCTCGATGCCATAG
TGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGATTCAGCACTCGGAGCATGCCTTCCGACGCGCGGAGCCATGGCAGCCC
TGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGTTGCTGCCAGTCGGCCCAGCCCCTCTGGTGGTGACTCTGTGCTGCCCAAATCCATCAG
CAGTGCCCATGATACCAGGGGTTCCAGCGTTCCTGAAAATGATCGATTGGCTTCCATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCG
TCACTCAAGCCCCACGGAGGAGCGAGATGAACCAGCATATCCAAGAGGAGATTCAAGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGAC
ACTAATCAGCCAGAGTAAAGATACTGCTTCTAAACTAGGACCCATAGAAGCTATCCAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTA
CCGAGAAATGAGGAGAAAGAATATCATTGGTCAAGTTTGTGATACGCCTAAGTCCTATGATAATGTTATGCACGTTGGCTTGAGGAAGGT
GACCTTCAAATGGCAAAGAGGAAACAAAATTGGAGAAGGCCAGTATGGGAAGGTGTACACCTGCATCAGCGTCGACACCGGGGAGCTGAT
GGCCATGAAAGAGATTCGATTTCAACCTAATGACCATAAGACTATCAAGGAAACTGCAGACGAATTGAAAATATTCGAAGGCATCAAACA
CCCCAATCTGGTTCGGTATTTTGGTGTGGAGCTCCATAGAGAAGAAATGTACATCTTCATGGAGTACTGCGATGAGGGGACTTTAGAAGA
GGTGTCAAGGCTGGGACTTCAGGAACATGTGATTAGGCTGTATTCAAAGCAGATCACCATTGCGATCAACGTCCTCCATGAGCATGGCAT
AGTCCACCGTGACATTAAAGGTGCCAATATCTTCCTTACCTCATCTGGATTAATCAAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAA
AAACAATGCCCAGACCATGCCTGGTGAAGTGAACAGCACCCTGGGGACAGCAGCATACATGGCACCTGAAGTCATCACTCGTGCCAAAGG
AGAGGGCCATGGGCGTGCGGCCGACATCTGGAGTCTGGGGTGTGTTGTCATAGAGATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGA
GCACAACTTTCAAATTATGTATAAAGTGGGGATGGGACATAAGCCACCAATCCCTGAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTC
TCACTGCCTTGAGAGTGACCCAAAGATGAGATGGACCGCCAGCCAGCTCCTCGACCATTCGTTTGTCAAGGTTTGCACAGATGAAGAATG
AAGCCTAGTAGAATATGGACTTGGAAAATTCTCTTAATCACTACTGTATGTAATATTTACATAAAGACTGTGCTGAGAAGCAGTATAAGC
CTTTTTAACCTTCCAAGACTGAAGACTGCACAGGTGACAAGCGTCACTTCTCCTGCTGCTCCTGTTTGTCTGATGTGGCAAAAGGCCCTC
TGGAGGGCTGGTGGCCACGAGGTTAAAGAAGCTGCATGTTAAGTGCCATTACTACTGTACACGGACCATCGCCTCTGTCTCCTCCGTGTC
TCGCGCGACTGAGAACCGTGACATCAGCGTAGTGTTTTGACCTTTCTAGGTTCAAAAGAAGTTGTAGTGTTATCAGGCGTCCCATACCTT
GTTTTTAATCTCCTGTTTGTTGAGTGCACTGACTGTGAAACCTTTACCTTTTTTGTTGTTGTTGGCAAGCTGCAGGTTTGTAATGCAAAA

>In-frame_ZNF292_ENST00000369577_chr6_87865477_+_MAP3K4_ENST00000348824_chr6_161491640_+_3681nt
ATCACGTGACCCAGGTGCGTACGCGACGGAGCGGGGTGTGAAGATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGG
CGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAGGAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGC
GGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTTCCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACC
ACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAGCTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCT
CTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTAAGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAA
GCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTGCTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGA
CTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGATCTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGAT
CCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAAAATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTA
CATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGACATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGG
CTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGACAGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCG
AGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCCAAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGC
AGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGATGTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGA
AAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAGAGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTC
AAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTGACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCAC
CTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACTGTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGT
CATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAGCAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAG
TCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGATGCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGA
CCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCTGAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGG
GTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTGATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTT
TGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGTGGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCT
ACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGATGACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGT
CATAGGAAAACCACACAGTCCTGTTACAGCCATTCATCGGAACAGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAA
CCCACACCTCATTATCCCCACTCCAGAGGGATTCAGGGGTTCCAGCGTTCCTGAAAATGATCGATTGGCTTCCATAGCTGCTGAATTGCA
GTTTAGGTCCCTGAGTCGTCACTCAAGCCCCACGGAGGAGCGAGATGAACCAGCATATCCAAGAGGAGATTCAAGTGGGTCCACAAGAAG
AAGTTGGGAACTTCGGACACTAATCAGCCAGAGTAAAGATACTGCTTCTAAACTAGGACCCATAGAAGCTATCCAGAAGTCAGTCCGATT
GTTTGAAGAAAAGAGGTACCGAGAAATGAGGAGAAAGAATATCATTGGTCAAGTTTGTGATACGCCTAAGTCCTATGATAATGTTATGCA
CGTTGGCTTGAGGAAGGTGACCTTCAAATGGCAAAGAGGAAACAAAATTGGAGAAGGCCAGTATGGGAAGGTGTACACCTGCATCAGCGT
CGACACCGGGGAGCTGATGGCCATGAAAGAGATTCGATTTCAACCTAATGACCATAAGACTATCAAGGAAACTGCAGACGAATTGAAAAT
ATTCGAAGGCATCAAACACCCCAATCTGGTTCGGTATTTTGGTGTGGAGCTCCATAGAGAAGAAATGTACATCTTCATGGAGTACTGCGA
TGAGGGGACTTTAGAAGAGGTGTCAAGGCTGGGACTTCAGGAACATGTGATTAGGCTGTATTCAAAGCAGATCACCATTGCGATCAACGT
CCTCCATGAGCATGGCATAGTCCACCGTGACATTAAAGGTGCCAATATCTTCCTTACCTCATCTGGATTAATCAAACTGGGAGATTTTGG
ATGTTCAGTAAAGCTCAAAAACAATGCCCAGACCATGCCTGGTGAAGTGAACAGCACCCTGGGGACAGCAGCATACATGGCACCTGAAGT
CATCACTCGTGCCAAAGGAGAGGGCCATGGGCGTGCGGCCGACATCTGGAGTCTGGGGTGTGTTGTCATAGAGATGGTGACTGGCAAGAG
GCCTTGGCATGAGTATGAGCACAACTTTCAAATTATGTATAAAGTGGGGATGGGACATAAGCCACCAATCCCTGAAAGATTAAGCCCTGA
AGGAAAGGACTTCCTTTCTCACTGCCTTGAGAGTGACCCAAAGATGAGATGGACCGCCAGCCAGCTCCTCGACCATTCGTTTGTCAAGGT
TTGCACAGATGAAGAATGAAGCCTAGTAGAATATGGACTTGGAAAATTCTCTTAATCACTACTGTATGTAATATTTACATAAAGACTGTG
CTGAGAAGCAGTATAAGCCTTTTTAACCTTCCAAGACTGAAGACTGCACAGGTGACAAGCGTCACTTCTCCTGCTGCTCCTGTTTGTCTG
ATGTGGCAAAAGGCCCTCTGGAGGGCTGGTGGCCACGAGGTTAAAGAAGCTGCATGTTAAGTGCCATTACTACTGTACACGGACCATCGC
CTCTGTCTCCTCCGTGTCTCGCGCGACTGAGAACCGTGACATCAGCGTAGTGTTTTGACCTTTCTAGGTTCAAAAGAAGTTGTAGTGTTA
TCAGGCGTCCCATACCTTGTTTTTAATCTCCTGTTTGTTGAGTGCACTGACTGTGAAACCTTTACCTTTTTTGTTGTTGTTGGCAAGCTG

>In-frame_ZNF292_ENST00000369577_chr6_87865477_+_MAP3K4_ENST00000366920_chr6_161491640_+_3831nt
ATCACGTGACCCAGGTGCGTACGCGACGGAGCGGGGTGTGAAGATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGG
CGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAGGAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGC
GGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTTCCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACC
ACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAGCTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCT
CTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTAAGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAA
GCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTGCTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGA
CTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGATCTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGAT
CCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAAAATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTA
CATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGACATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGG
CTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGACAGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCG
AGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCCAAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGC
AGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGATGTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGA
AAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAGAGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTC
AAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTGACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCAC
CTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACTGTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGT
CATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAGCAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAG
TCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGATGCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGA
CCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCTGAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGG
GTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTGATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTT
TGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGTGGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCT
ACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGATGACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGT
CATAGGAAAACCACACAGTCCTGTTACAGCCATTCATCGGAACAGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAA
CCCACACCTCATTATCCCCACTCCAGAGGGATTCAGCACTCGGAGCATGCCTTCCGACGCGCGGAGCCATGGCAGCCCTGCTGCTGCTGC
TGCTGCTGCTGCTGCTGCTGTTGCTGCCAGTCGGCCCAGCCCCTCTGGTGGTGACTCTGTGCTGCCCAAATCCATCAGCAGTGCCCATGA
TACCAGGGGTTCCAGCGTTCCTGAAAATGATCGATTGGCTTCCATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCC
CACGGAGGAGCGAGATGAACCAGCATATCCAAGAGGAGATTCAAGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCA
GAGTAAAGATACTGCTTCTAAACTAGGACCCATAGAAGCTATCCAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAG
GAGAAAGAATATCATTGGTCAAGTTTGTGATACGCCTAAGTCCTATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATG
GCAAAGAGGAAACAAAATTGGAGAAGGCCAGTATGGGAAGGTGTACACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGA
GATTCGATTTCAACCTAATGACCATAAGACTATCAAGGAAACTGCAGACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGT
TCGGTATTTTGGTGTGGAGCTCCATAGAGAAGAAATGTACATCTTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCT
GGGACTTCAGGAACATGTGATTAGGCTGTATTCAAAGCAGATCACCATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGA
CATTAAAGGTGCCAATATCTTCCTTACCTCATCTGGATTAATCAAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCA
GACCATGCCTGGTGAAGTGAACAGCACCCTGGGGACAGCAGCATACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGG
GCGTGCGGCCGACATCTGGAGTCTGGGGTGTGTTGTCATAGAGATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCA
AATTATGTATAAAGTGGGGATGGGACATAAGCCACCAATCCCTGAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGA
GAGTGACCCAAAGATGAGATGGACCGCCAGCCAGCTCCTCGACCATTCGTTTGTCAAGGTTTGCACAGATGAAGAATGAAGCCTAGTAGA
ATATGGACTTGGAAAATTCTCTTAATCACTACTGTATGTAATATTTACATAAAGACTGTGCTGAGAAGCAGTATAAGCCTTTTTAACCTT
CCAAGACTGAAGACTGCACAGGTGACAAGCGTCACTTCTCCTGCTGCTCCTGTTTGTCTGATGTGGCAAAAGGCCCTCTGGAGGGCTGGT
GGCCACGAGGTTAAAGAAGCTGCATGTTAAGTGCCATTACTACTGTACACGGACCATCGCCTCTGTCTCCTCCGTGTCTCGCGCGACTGA
GAACCGTGACATCAGCGTAGTGTTTTGACCTTTCTAGGTTCAAAAGAAGTTGTAGTGTTATCAGGCGTCCCATACCTTGTTTTTAATCTC
CTGTTTGTTGAGTGCACTGACTGTGAAACCTTTACCTTTTTTGTTGTTGTTGGCAAGCTGCAGGTTTGTAATGCAAAAGGCTGATTACTG

>In-frame_ZNF292_ENST00000339907_chr6_87865477_+_MAP3K4_ENST00000366919_chr6_161491640_+_3664nt
GGGGTGTGAAGATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCG
AGCGGCTCCAGGAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGT
TTTCTGAATTTCCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGT
CGTGGGAGGAGCTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGT
GTCTGAAGTTAAGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGA
AGGGCGGCCTGCTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTT
TTGAAGAGGATCTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGC
ATAGTTTAAAAAATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGC
TTTTCTGTGACATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTA
GTGCGGATGACAGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAG
AAAGGGCTTCCAAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAG
ACCTCCTGGATGTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTG
CTGAGGAGAAGAGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCT
ATCTGCTTCTGACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTC
AGGTGGAGACTGTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAA
AAGCTTTCCAGCAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGC
TGAAGAATGATGCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGG
TTGATGAATCTGAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAG
TTGTTCGTTTGATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTA
AATGTGAGAGTGGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTT
TACCAGAAGATGACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGGTT
TGTACCTTGCCATTCATCGGAACAGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCA
CTCCAGAGGGATTCAGGGGTTCCAGCGTTCCTGAAAATGATCGATTGGCTTCCATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTC
ACTCAAGCCCCACGGAGGAGCGAGATGAACCAGCATATCCAAGAGGAGATTCAAGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACAC
TAATCAGCCAGAGTAAAGATACTGCTTCTAAACTAGGACCCATAGAAGCTATCCAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACC
GAGAAATGAGGAGAAAGAATATCATTGGTCAAGTTTGTGATACGCCTAAGTCCTATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGA
CCTTCAAATGGCAAAGAGGAAACAAAATTGGAGAAGGCCAGTATGGGAAGGTGTACACCTGCATCAGCGTCGACACCGGGGAGCTGATGG
CCATGAAAGAGATTCGATTTCAACCTAATGACCATAAGACTATCAAGGAAACTGCAGACGAATTGAAAATATTCGAAGGCATCAAACACC
CCAATCTGGTTCGGTATTTTGGTGTGGAGCTCCATAGAGAAGAAATGTACATCTTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGG
TGTCAAGGCTGGGACTTCAGGAACATGTGATTAGGCTGTATTCAAAGCAGATCACCATTGCGATCAACGTCCTCCATGAGCATGGCATAG
TCCACCGTGACATTAAAGGTGCCAATATCTTCCTTACCTCATCTGGATTAATCAAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAA
ACAATGCCCAGACCATGCCTGGTGAAGTGAACAGCACCCTGGGGACAGCAGCATACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAG
AGGGCCATGGGCGTGCGGCCGACATCTGGAGTCTGGGGTGTGTTGTCATAGAGATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGC
ACAACTTTCAAATTATGTATAAAGTGGGGATGGGACATAAGCCACCAATCCCTGAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTC
ACTGCCTTGAGAGTGACCCAAAGATGAGATGGACCGCCAGCCAGCTCCTCGACCATTCGTTTGTCAAGGTTTGCACAGATGAAGAATGAA
GCCTAGTAGAATATGGACTTGGAAAATTCTCTTAATCACTACTGTATGTAATATTTACATAAAGACTGTGCTGAGAAGCAGTATAAGCCT
TTTTAACCTTCCAAGACTGAAGACTGCACAGGTGACAAGCGTCACTTCTCCTGCTGCTCCTGTTTGTCTGATGTGGCAAAAGGCCCTCTG
GAGGGCTGGTGGCCACGAGGTTAAAGAAGCTGCATGTTAAGTGCCATTACTACTGTACACGGACCATCGCCTCTGTCTCCTCCGTGTCTC
GCGCGACTGAGAACCGTGACATCAGCGTAGTGTTTTGACCTTTCTAGGTTCAAAAGAAGTTGTAGTGTTATCAGGCGTCCCATACCTTGT
TTTTAATCTCCTGTTTGTTGAGTGCACTGACTGTGAAACCTTTACCTTTTTTGTTGTTGTTGGCAAGCTGCAGGTTTGTAATGCAAAAGG

>In-frame_ZNF292_ENST00000339907_chr6_87865477_+_MAP3K4_ENST00000392142_chr6_161491640_+_3814nt
GGGGTGTGAAGATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCG
AGCGGCTCCAGGAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGT
TTTCTGAATTTCCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGT
CGTGGGAGGAGCTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGT
GTCTGAAGTTAAGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGA
AGGGCGGCCTGCTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTT
TTGAAGAGGATCTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGC
ATAGTTTAAAAAATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGC
TTTTCTGTGACATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTA
GTGCGGATGACAGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAG
AAAGGGCTTCCAAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAG
ACCTCCTGGATGTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTG
CTGAGGAGAAGAGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCT
ATCTGCTTCTGACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTC
AGGTGGAGACTGTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAA
AAGCTTTCCAGCAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGC
TGAAGAATGATGCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGG
TTGATGAATCTGAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAG
TTGTTCGTTTGATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTA
AATGTGAGAGTGGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTT
TACCAGAAGATGACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGGTT
TGTACCTTGCCATTCATCGGAACAGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCA
CTCCAGAGGGATTCAGCACTCGGAGCATGCCTTCCGACGCGCGGAGCCATGGCAGCCCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTG
TTGCTGCCAGTCGGCCCAGCCCCTCTGGTGGTGACTCTGTGCTGCCCAAATCCATCAGCAGTGCCCATGATACCAGGGGTTCCAGCGTTC
CTGAAAATGATCGATTGGCTTCCATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCCACGGAGGAGCGAGATGAAC
CAGCATATCCAAGAGGAGATTCAAGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAGAGTAAAGATACTGCTTCTA
AACTAGGACCCATAGAAGCTATCCAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGGAGAAAGAATATCATTGGTC
AAGTTTGTGATACGCCTAAGTCCTATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGGCAAAGAGGAAACAAAATTG
GAGAAGGCCAGTATGGGAAGGTGTACACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAGATTCGATTTCAACCTAATG
ACCATAAGACTATCAAGGAAACTGCAGACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTTCGGTATTTTGGTGTGGAGC
TCCATAGAGAAGAAATGTACATCTTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTGGGACTTCAGGAACATGTGA
TTAGGCTGTATTCAAAGCAGATCACCATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGACATTAAAGGTGCCAATATCT
TCCTTACCTCATCTGGATTAATCAAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAGACCATGCCTGGTGAAGTGA
ACAGCACCCTGGGGACAGCAGCATACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGGCGTGCGGCCGACATCTGGA
GTCTGGGGTGTGTTGTCATAGAGATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAAATTATGTATAAAGTGGGGA
TGGGACATAAGCCACCAATCCCTGAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAGAGTGACCCAAAGATGAGAT
GGACCGCCAGCCAGCTCCTCGACCATTCGTTTGTCAAGGTTTGCACAGATGAAGAATGAAGCCTAGTAGAATATGGACTTGGAAAATTCT
CTTAATCACTACTGTATGTAATATTTACATAAAGACTGTGCTGAGAAGCAGTATAAGCCTTTTTAACCTTCCAAGACTGAAGACTGCACA
GGTGACAAGCGTCACTTCTCCTGCTGCTCCTGTTTGTCTGATGTGGCAAAAGGCCCTCTGGAGGGCTGGTGGCCACGAGGTTAAAGAAGC
TGCATGTTAAGTGCCATTACTACTGTACACGGACCATCGCCTCTGTCTCCTCCGTGTCTCGCGCGACTGAGAACCGTGACATCAGCGTAG
TGTTTTGACCTTTCTAGGTTCAAAAGAAGTTGTAGTGTTATCAGGCGTCCCATACCTTGTTTTTAATCTCCTGTTTGTTGAGTGCACTGA
CTGTGAAACCTTTACCTTTTTTGTTGTTGTTGGCAAGCTGCAGGTTTGTAATGCAAAAGGCTGATTACTGAAATTTAAGAAAAAGGTTCT

>In-frame_ZNF292_ENST00000339907_chr6_87865477_+_MAP3K4_ENST00000348824_chr6_161491640_+_3649nt
GGGGTGTGAAGATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCG
AGCGGCTCCAGGAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGT
TTTCTGAATTTCCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGT
CGTGGGAGGAGCTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGT
GTCTGAAGTTAAGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGA
AGGGCGGCCTGCTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTT
TTGAAGAGGATCTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGC
ATAGTTTAAAAAATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGC
TTTTCTGTGACATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTA
GTGCGGATGACAGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAG
AAAGGGCTTCCAAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAG
ACCTCCTGGATGTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTG
CTGAGGAGAAGAGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCT
ATCTGCTTCTGACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTC
AGGTGGAGACTGTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAA
AAGCTTTCCAGCAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGC
TGAAGAATGATGCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGG
TTGATGAATCTGAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAG
TTGTTCGTTTGATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTA
AATGTGAGAGTGGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTT
TACCAGAAGATGACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGCCA
TTCATCGGAACAGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGAT
TCAGGGGTTCCAGCGTTCCTGAAAATGATCGATTGGCTTCCATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCCA
CGGAGGAGCGAGATGAACCAGCATATCCAAGAGGAGATTCAAGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAGA
GTAAAGATACTGCTTCTAAACTAGGACCCATAGAAGCTATCCAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGGA
GAAAGAATATCATTGGTCAAGTTTGTGATACGCCTAAGTCCTATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGGC
AAAGAGGAAACAAAATTGGAGAAGGCCAGTATGGGAAGGTGTACACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAGA
TTCGATTTCAACCTAATGACCATAAGACTATCAAGGAAACTGCAGACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTTC
GGTATTTTGGTGTGGAGCTCCATAGAGAAGAAATGTACATCTTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTGG
GACTTCAGGAACATGTGATTAGGCTGTATTCAAAGCAGATCACCATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGACA
TTAAAGGTGCCAATATCTTCCTTACCTCATCTGGATTAATCAAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAGA
CCATGCCTGGTGAAGTGAACAGCACCCTGGGGACAGCAGCATACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGGC
GTGCGGCCGACATCTGGAGTCTGGGGTGTGTTGTCATAGAGATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAAA
TTATGTATAAAGTGGGGATGGGACATAAGCCACCAATCCCTGAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAGA
GTGACCCAAAGATGAGATGGACCGCCAGCCAGCTCCTCGACCATTCGTTTGTCAAGGTTTGCACAGATGAAGAATGAAGCCTAGTAGAAT
ATGGACTTGGAAAATTCTCTTAATCACTACTGTATGTAATATTTACATAAAGACTGTGCTGAGAAGCAGTATAAGCCTTTTTAACCTTCC
AAGACTGAAGACTGCACAGGTGACAAGCGTCACTTCTCCTGCTGCTCCTGTTTGTCTGATGTGGCAAAAGGCCCTCTGGAGGGCTGGTGG
CCACGAGGTTAAAGAAGCTGCATGTTAAGTGCCATTACTACTGTACACGGACCATCGCCTCTGTCTCCTCCGTGTCTCGCGCGACTGAGA
ACCGTGACATCAGCGTAGTGTTTTGACCTTTCTAGGTTCAAAAGAAGTTGTAGTGTTATCAGGCGTCCCATACCTTGTTTTTAATCTCCT
GTTTGTTGAGTGCACTGACTGTGAAACCTTTACCTTTTTTGTTGTTGTTGGCAAGCTGCAGGTTTGTAATGCAAAAGGCTGATTACTGAA

>In-frame_ZNF292_ENST00000339907_chr6_87865477_+_MAP3K4_ENST00000366920_chr6_161491640_+_3799nt
GGGGTGTGAAGATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTGAGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCG
AGCGGCTCCAGGAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTACCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGT
TTTCTGAATTTCCAGATCCCATGTGGGGTTCAGATTATGTGCAGTTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGT
CGTGGGAGGAGCTGAAGGCCATGGATTTACCTTCATTCGAACCTGCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGT
GTCTGAAGTTAAGATTGGAGCAGAGACCTGCTGGAGAACCATCTCTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGA
AGGGCGGCCTGCTGATGAAGCAGTACTACCAGTTCATGCTGCAGGAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTT
TTGAAGAGGATCTACATAAAATGCTTATGGTGTATTTTGATTACATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGC
ATAGTTTAAAAAATCTGTTAGAAGAAGAATGGAATTTCACCAAAGAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGC
TTTTCTGTGACATTGCAGGAATGCTGCTGAAATCTACAGGAAGTTTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTA
GTGCGGATGACAGCAGTGCTTCCGACGAAATCAGGAGGTCTGTTATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAG
AAAGGGCTTCCAAAGCACTTGGATTTGCTAAAATGTTGAGAAAGGACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAG
ACCTCCTGGATGTTCTGAAATCAAAACAGTATGTCAAGGTGCAAATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTG
CTGAGGAGAAGAGTATTATTTTGCAGTTACTCAATGCAGCTGCAGGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCT
ATCTGCTTCTGACCAAGCACGGTGATCGAGCCCGTGATTCAGAGGACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTC
AGGTGGAGACTGTTGACACCCTGAGAAGCATGCAGGTGGATAATCTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAA
AAGCTTTCCAGCAGTCCATTGAGGGACTTATGACTCTGTGCCAGGAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGC
TGAAGAATGATGCATTGGAGCTATGCAACAGGATAAGCAATGCCATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGG
TTGATGAATCTGAATCTGTCACCTTGCAACAGTACTACCGAGAAGCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAG
TTGTTCGTTTGATGTCTGGGGAGTTTAGACAGAAGATAGGAGACAAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTA
AATGTGAGAGTGGTAGAGGTACAAGACCCAGGTGGGCGACTCAAGGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTT
TACCAGAAGATGACTTCTTGAGTTTACAAGCCTTGATGAATGAATGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGCCA
TTCATCGGAACAGCCCCCGTCCTATGAAGGTACCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGAT
TCAGCACTCGGAGCATGCCTTCCGACGCGCGGAGCCATGGCAGCCCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGTTGCTGCCAGTC
GGCCCAGCCCCTCTGGTGGTGACTCTGTGCTGCCCAAATCCATCAGCAGTGCCCATGATACCAGGGGTTCCAGCGTTCCTGAAAATGATC
GATTGGCTTCCATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCCACGGAGGAGCGAGATGAACCAGCATATCCAA
GAGGAGATTCAAGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAGAGTAAAGATACTGCTTCTAAACTAGGACCCA
TAGAAGCTATCCAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGGAGAAAGAATATCATTGGTCAAGTTTGTGATA
CGCCTAAGTCCTATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGGCAAAGAGGAAACAAAATTGGAGAAGGCCAGT
ATGGGAAGGTGTACACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAGATTCGATTTCAACCTAATGACCATAAGACTA
TCAAGGAAACTGCAGACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTTCGGTATTTTGGTGTGGAGCTCCATAGAGAAG
AAATGTACATCTTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTGGGACTTCAGGAACATGTGATTAGGCTGTATT
CAAAGCAGATCACCATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGACATTAAAGGTGCCAATATCTTCCTTACCTCAT
CTGGATTAATCAAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAGACCATGCCTGGTGAAGTGAACAGCACCCTGG
GGACAGCAGCATACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGGCGTGCGGCCGACATCTGGAGTCTGGGGTGTG
TTGTCATAGAGATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAAATTATGTATAAAGTGGGGATGGGACATAAGC
CACCAATCCCTGAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAGAGTGACCCAAAGATGAGATGGACCGCCAGCC
AGCTCCTCGACCATTCGTTTGTCAAGGTTTGCACAGATGAAGAATGAAGCCTAGTAGAATATGGACTTGGAAAATTCTCTTAATCACTAC
TGTATGTAATATTTACATAAAGACTGTGCTGAGAAGCAGTATAAGCCTTTTTAACCTTCCAAGACTGAAGACTGCACAGGTGACAAGCGT
CACTTCTCCTGCTGCTCCTGTTTGTCTGATGTGGCAAAAGGCCCTCTGGAGGGCTGGTGGCCACGAGGTTAAAGAAGCTGCATGTTAAGT
GCCATTACTACTGTACACGGACCATCGCCTCTGTCTCCTCCGTGTCTCGCGCGACTGAGAACCGTGACATCAGCGTAGTGTTTTGACCTT
TCTAGGTTCAAAAGAAGTTGTAGTGTTATCAGGCGTCCCATACCTTGTTTTTAATCTCCTGTTTGTTGAGTGCACTGACTGTGAAACCTT
TACCTTTTTTGTTGTTGTTGGCAAGCTGCAGGTTTGTAATGCAAAAGGCTGATTACTGAAATTTAAGAAAAAGGTTCTTTTTTCAATAAA

>In-frame_ZNF292_ENST00000392985_chr6_87865477_+_MAP3K4_ENST00000366919_chr6_161491640_+_3890nt
ATGGAACAGGTCTTCGAATCTCCCCAGGAACATCTCAGAGGATATGTCCGTAGAAGACTTCGTGGACTGGGGAAAGCCACGCCGGGATCG
GGACGCCGGAGAGGGTCGCCCCTCCCTAGGCTTTTTCCCGTCGCGGCGCCCACGTGACCGAGAGCAGGCCTTCACCAGCCCGCCCCTTTC
GGCCGCTGCTGCCCACTTCCCGCTCGGGGTGCGTACGCGACGGAGCGGGGTGTGAAGATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTG
AGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAGGAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTA
CCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTTCCAGATCCCATGTGGGGTTCAGATTATGTGCAG
TTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAGCTGAAGGCCATGGATTTACCTTCATTCGAACCT
GCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTAAGATTGGAGCAGAGACCTGCTGGAGAACCATCT
CTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTGCTGATGAAGCAGTACTACCAGTTCATGCTGCAG
GAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGATCTACATAAAATGCTTATGGTGTATTTTGATTAC
ATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAAAATCTGTTAGAAGAAGAATGGAATTTCACCAAA
GAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGACATTGCAGGAATGCTGCTGAAATCTACAGGAAGT
TTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGACAGCAGTGCTTCCGACGAAATCAGGAGGTCTGTT
ATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCCAAAGCACTTGGATTTGCTAAAATGTTGAGAAAG
GACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGATGTTCTGAAATCAAAACAGTATGTCAAGGTGCAA
ATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAGAGTATTATTTTGCAGTTACTCAATGCAGCTGCA
GGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTGACCAAGCACGGTGATCGAGCCCGTGATTCAGAG
GACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACTGTTGACACCCTGAGAAGCATGCAGGTGGATAAT
CTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAGCAGTCCATTGAGGGACTTATGACTCTGTGCCAG
GAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGATGCATTGGAGCTATGCAACAGGATAAGCAATGCC
ATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCTGAATCTGTCACCTTGCAACAGTACTACCGAGAA
GCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTGATGTCTGGGGAGTTTAGACAGAAGATAGGAGAC
AAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGTGGTAGAGGTACAAGACCCAGGTGGGCGACTCAA
GGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGATGACTTCTTGAGTTTACAAGCCTTGATGAATGAA
TGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGGTTTGTACCTTGCCATTCATCGGAACAGCCCCCGTCCTATGAAGGTA
CCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGATTCAGGGGTTCCAGCGTTCCTGAAAATGATCGA
TTGGCTTCCATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCCACGGAGGAGCGAGATGAACCAGCATATCCAAGA
GGAGATTCAAGTGGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAGAGTAAAGATACTGCTTCTAAACTAGGACCCATA
GAAGCTATCCAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGGAGAAAGAATATCATTGGTCAAGTTTGTGATACG
CCTAAGTCCTATGATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGGCAAAGAGGAAACAAAATTGGAGAAGGCCAGTAT
GGGAAGGTGTACACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAGATTCGATTTCAACCTAATGACCATAAGACTATC
AAGGAAACTGCAGACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTTCGGTATTTTGGTGTGGAGCTCCATAGAGAAGAA
ATGTACATCTTCATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTGGGACTTCAGGAACATGTGATTAGGCTGTATTCA
AAGCAGATCACCATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGACATTAAAGGTGCCAATATCTTCCTTACCTCATCT
GGATTAATCAAACTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAGACCATGCCTGGTGAAGTGAACAGCACCCTGGGG
ACAGCAGCATACATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGGCGTGCGGCCGACATCTGGAGTCTGGGGTGTGTT
GTCATAGAGATGGTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAAATTATGTATAAAGTGGGGATGGGACATAAGCCA
CCAATCCCTGAAAGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAGAGTGACCCAAAGATGAGATGGACCGCCAGCCAG
CTCCTCGACCATTCGTTTGTCAAGGTTTGCACAGATGAAGAATGAAGCCTAGTAGAATATGGACTTGGAAAATTCTCTTAATCACTACTG
TATGTAATATTTACATAAAGACTGTGCTGAGAAGCAGTATAAGCCTTTTTAACCTTCCAAGACTGAAGACTGCACAGGTGACAAGCGTCA
CTTCTCCTGCTGCTCCTGTTTGTCTGATGTGGCAAAAGGCCCTCTGGAGGGCTGGTGGCCACGAGGTTAAAGAAGCTGCATGTTAAGTGC
CATTACTACTGTACACGGACCATCGCCTCTGTCTCCTCCGTGTCTCGCGCGACTGAGAACCGTGACATCAGCGTAGTGTTTTGACCTTTC
TAGGTTCAAAAGAAGTTGTAGTGTTATCAGGCGTCCCATACCTTGTTTTTAATCTCCTGTTTGTTGAGTGCACTGACTGTGAAACCTTTA
CCTTTTTTGTTGTTGTTGGCAAGCTGCAGGTTTGTAATGCAAAAGGCTGATTACTGAAATTTAAGAAAAAGGTTCTTTTTTCAATAAATG

>In-frame_ZNF292_ENST00000392985_chr6_87865477_+_MAP3K4_ENST00000392142_chr6_161491640_+_4040nt
ATGGAACAGGTCTTCGAATCTCCCCAGGAACATCTCAGAGGATATGTCCGTAGAAGACTTCGTGGACTGGGGAAAGCCACGCCGGGATCG
GGACGCCGGAGAGGGTCGCCCCTCCCTAGGCTTTTTCCCGTCGCGGCGCCCACGTGACCGAGAGCAGGCCTTCACCAGCCCGCCCCTTTC
GGCCGCTGCTGCCCACTTCCCGCTCGGGGTGCGTACGCGACGGAGCGGGGTGTGAAGATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTG
AGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAGGAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTA
CCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTTCCAGATCCCATGTGGGGTTCAGATTATGTGCAG
TTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAGCTGAAGGCCATGGATTTACCTTCATTCGAACCT
GCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTAAGATTGGAGCAGAGACCTGCTGGAGAACCATCT
CTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTGCTGATGAAGCAGTACTACCAGTTCATGCTGCAG
GAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGATCTACATAAAATGCTTATGGTGTATTTTGATTAC
ATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAAAATCTGTTAGAAGAAGAATGGAATTTCACCAAA
GAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGACATTGCAGGAATGCTGCTGAAATCTACAGGAAGT
TTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGACAGCAGTGCTTCCGACGAAATCAGGAGGTCTGTT
ATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCCAAAGCACTTGGATTTGCTAAAATGTTGAGAAAG
GACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGATGTTCTGAAATCAAAACAGTATGTCAAGGTGCAA
ATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAGAGTATTATTTTGCAGTTACTCAATGCAGCTGCA
GGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTGACCAAGCACGGTGATCGAGCCCGTGATTCAGAG
GACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACTGTTGACACCCTGAGAAGCATGCAGGTGGATAAT
CTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAGCAGTCCATTGAGGGACTTATGACTCTGTGCCAG
GAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGATGCATTGGAGCTATGCAACAGGATAAGCAATGCC
ATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCTGAATCTGTCACCTTGCAACAGTACTACCGAGAA
GCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTGATGTCTGGGGAGTTTAGACAGAAGATAGGAGAC
AAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGTGGTAGAGGTACAAGACCCAGGTGGGCGACTCAA
GGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGATGACTTCTTGAGTTTACAAGCCTTGATGAATGAA
TGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGGTTTGTACCTTGCCATTCATCGGAACAGCCCCCGTCCTATGAAGGTA
CCTCGATGCCATAGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGATTCAGCACTCGGAGCATGCCTTCCGACGCGCGG
AGCCATGGCAGCCCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGTTGCTGCCAGTCGGCCCAGCCCCTCTGGTGGTGACTCTGTGCTG
CCCAAATCCATCAGCAGTGCCCATGATACCAGGGGTTCCAGCGTTCCTGAAAATGATCGATTGGCTTCCATAGCTGCTGAATTGCAGTTT
AGGTCCCTGAGTCGTCACTCAAGCCCCACGGAGGAGCGAGATGAACCAGCATATCCAAGAGGAGATTCAAGTGGGTCCACAAGAAGAAGT
TGGGAACTTCGGACACTAATCAGCCAGAGTAAAGATACTGCTTCTAAACTAGGACCCATAGAAGCTATCCAGAAGTCAGTCCGATTGTTT
GAAGAAAAGAGGTACCGAGAAATGAGGAGAAAGAATATCATTGGTCAAGTTTGTGATACGCCTAAGTCCTATGATAATGTTATGCACGTT
GGCTTGAGGAAGGTGACCTTCAAATGGCAAAGAGGAAACAAAATTGGAGAAGGCCAGTATGGGAAGGTGTACACCTGCATCAGCGTCGAC
ACCGGGGAGCTGATGGCCATGAAAGAGATTCGATTTCAACCTAATGACCATAAGACTATCAAGGAAACTGCAGACGAATTGAAAATATTC
GAAGGCATCAAACACCCCAATCTGGTTCGGTATTTTGGTGTGGAGCTCCATAGAGAAGAAATGTACATCTTCATGGAGTACTGCGATGAG
GGGACTTTAGAAGAGGTGTCAAGGCTGGGACTTCAGGAACATGTGATTAGGCTGTATTCAAAGCAGATCACCATTGCGATCAACGTCCTC
CATGAGCATGGCATAGTCCACCGTGACATTAAAGGTGCCAATATCTTCCTTACCTCATCTGGATTAATCAAACTGGGAGATTTTGGATGT
TCAGTAAAGCTCAAAAACAATGCCCAGACCATGCCTGGTGAAGTGAACAGCACCCTGGGGACAGCAGCATACATGGCACCTGAAGTCATC
ACTCGTGCCAAAGGAGAGGGCCATGGGCGTGCGGCCGACATCTGGAGTCTGGGGTGTGTTGTCATAGAGATGGTGACTGGCAAGAGGCCT
TGGCATGAGTATGAGCACAACTTTCAAATTATGTATAAAGTGGGGATGGGACATAAGCCACCAATCCCTGAAAGATTAAGCCCTGAAGGA
AAGGACTTCCTTTCTCACTGCCTTGAGAGTGACCCAAAGATGAGATGGACCGCCAGCCAGCTCCTCGACCATTCGTTTGTCAAGGTTTGC
ACAGATGAAGAATGAAGCCTAGTAGAATATGGACTTGGAAAATTCTCTTAATCACTACTGTATGTAATATTTACATAAAGACTGTGCTGA
GAAGCAGTATAAGCCTTTTTAACCTTCCAAGACTGAAGACTGCACAGGTGACAAGCGTCACTTCTCCTGCTGCTCCTGTTTGTCTGATGT
GGCAAAAGGCCCTCTGGAGGGCTGGTGGCCACGAGGTTAAAGAAGCTGCATGTTAAGTGCCATTACTACTGTACACGGACCATCGCCTCT
GTCTCCTCCGTGTCTCGCGCGACTGAGAACCGTGACATCAGCGTAGTGTTTTGACCTTTCTAGGTTCAAAAGAAGTTGTAGTGTTATCAG
GCGTCCCATACCTTGTTTTTAATCTCCTGTTTGTTGAGTGCACTGACTGTGAAACCTTTACCTTTTTTGTTGTTGTTGGCAAGCTGCAGG

>In-frame_ZNF292_ENST00000392985_chr6_87865477_+_MAP3K4_ENST00000348824_chr6_161491640_+_3875nt
ATGGAACAGGTCTTCGAATCTCCCCAGGAACATCTCAGAGGATATGTCCGTAGAAGACTTCGTGGACTGGGGAAAGCCACGCCGGGATCG
GGACGCCGGAGAGGGTCGCCCCTCCCTAGGCTTTTTCCCGTCGCGGCGCCCACGTGACCGAGAGCAGGCCTTCACCAGCCCGCCCCTTTC
GGCCGCTGCTGCCCACTTCCCGCTCGGGGTGCGTACGCGACGGAGCGGGGTGTGAAGATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTG
AGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAGGAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTA
CCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTTCCAGATCCCATGTGGGGTTCAGATTATGTGCAG
TTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAGCTGAAGGCCATGGATTTACCTTCATTCGAACCT
GCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTAAGATTGGAGCAGAGACCTGCTGGAGAACCATCT
CTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTGCTGATGAAGCAGTACTACCAGTTCATGCTGCAG
GAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGATCTACATAAAATGCTTATGGTGTATTTTGATTAC
ATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAAAATCTGTTAGAAGAAGAATGGAATTTCACCAAA
GAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGACATTGCAGGAATGCTGCTGAAATCTACAGGAAGT
TTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGACAGCAGTGCTTCCGACGAAATCAGGAGGTCTGTT
ATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCCAAAGCACTTGGATTTGCTAAAATGTTGAGAAAG
GACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGATGTTCTGAAATCAAAACAGTATGTCAAGGTGCAA
ATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAGAGTATTATTTTGCAGTTACTCAATGCAGCTGCA
GGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTGACCAAGCACGGTGATCGAGCCCGTGATTCAGAG
GACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACTGTTGACACCCTGAGAAGCATGCAGGTGGATAAT
CTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAGCAGTCCATTGAGGGACTTATGACTCTGTGCCAG
GAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGATGCATTGGAGCTATGCAACAGGATAAGCAATGCC
ATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCTGAATCTGTCACCTTGCAACAGTACTACCGAGAA
GCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTGATGTCTGGGGAGTTTAGACAGAAGATAGGAGAC
AAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGTGGTAGAGGTACAAGACCCAGGTGGGCGACTCAA
GGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGATGACTTCTTGAGTTTACAAGCCTTGATGAATGAA
TGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGCCATTCATCGGAACAGCCCCCGTCCTATGAAGGTACCTCGATGCCAT
AGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGATTCAGGGGTTCCAGCGTTCCTGAAAATGATCGATTGGCTTCCATA
GCTGCTGAATTGCAGTTTAGGTCCCTGAGTCGTCACTCAAGCCCCACGGAGGAGCGAGATGAACCAGCATATCCAAGAGGAGATTCAAGT
GGGTCCACAAGAAGAAGTTGGGAACTTCGGACACTAATCAGCCAGAGTAAAGATACTGCTTCTAAACTAGGACCCATAGAAGCTATCCAG
AAGTCAGTCCGATTGTTTGAAGAAAAGAGGTACCGAGAAATGAGGAGAAAGAATATCATTGGTCAAGTTTGTGATACGCCTAAGTCCTAT
GATAATGTTATGCACGTTGGCTTGAGGAAGGTGACCTTCAAATGGCAAAGAGGAAACAAAATTGGAGAAGGCCAGTATGGGAAGGTGTAC
ACCTGCATCAGCGTCGACACCGGGGAGCTGATGGCCATGAAAGAGATTCGATTTCAACCTAATGACCATAAGACTATCAAGGAAACTGCA
GACGAATTGAAAATATTCGAAGGCATCAAACACCCCAATCTGGTTCGGTATTTTGGTGTGGAGCTCCATAGAGAAGAAATGTACATCTTC
ATGGAGTACTGCGATGAGGGGACTTTAGAAGAGGTGTCAAGGCTGGGACTTCAGGAACATGTGATTAGGCTGTATTCAAAGCAGATCACC
ATTGCGATCAACGTCCTCCATGAGCATGGCATAGTCCACCGTGACATTAAAGGTGCCAATATCTTCCTTACCTCATCTGGATTAATCAAA
CTGGGAGATTTTGGATGTTCAGTAAAGCTCAAAAACAATGCCCAGACCATGCCTGGTGAAGTGAACAGCACCCTGGGGACAGCAGCATAC
ATGGCACCTGAAGTCATCACTCGTGCCAAAGGAGAGGGCCATGGGCGTGCGGCCGACATCTGGAGTCTGGGGTGTGTTGTCATAGAGATG
GTGACTGGCAAGAGGCCTTGGCATGAGTATGAGCACAACTTTCAAATTATGTATAAAGTGGGGATGGGACATAAGCCACCAATCCCTGAA
AGATTAAGCCCTGAAGGAAAGGACTTCCTTTCTCACTGCCTTGAGAGTGACCCAAAGATGAGATGGACCGCCAGCCAGCTCCTCGACCAT
TCGTTTGTCAAGGTTTGCACAGATGAAGAATGAAGCCTAGTAGAATATGGACTTGGAAAATTCTCTTAATCACTACTGTATGTAATATTT
ACATAAAGACTGTGCTGAGAAGCAGTATAAGCCTTTTTAACCTTCCAAGACTGAAGACTGCACAGGTGACAAGCGTCACTTCTCCTGCTG
CTCCTGTTTGTCTGATGTGGCAAAAGGCCCTCTGGAGGGCTGGTGGCCACGAGGTTAAAGAAGCTGCATGTTAAGTGCCATTACTACTGT
ACACGGACCATCGCCTCTGTCTCCTCCGTGTCTCGCGCGACTGAGAACCGTGACATCAGCGTAGTGTTTTGACCTTTCTAGGTTCAAAAG
AAGTTGTAGTGTTATCAGGCGTCCCATACCTTGTTTTTAATCTCCTGTTTGTTGAGTGCACTGACTGTGAAACCTTTACCTTTTTTGTTG
TTGTTGGCAAGCTGCAGGTTTGTAATGCAAAAGGCTGATTACTGAAATTTAAGAAAAAGGTTCTTTTTTCAATAAATGGTTTATTTTAGG

>In-frame_ZNF292_ENST00000392985_chr6_87865477_+_MAP3K4_ENST00000366920_chr6_161491640_+_4025nt
ATGGAACAGGTCTTCGAATCTCCCCAGGAACATCTCAGAGGATATGTCCGTAGAAGACTTCGTGGACTGGGGAAAGCCACGCCGGGATCG
GGACGCCGGAGAGGGTCGCCCCTCCCTAGGCTTTTTCCCGTCGCGGCGCCCACGTGACCGAGAGCAGGCCTTCACCAGCCCGCCCCTTTC
GGCCGCTGCTGCCCACTTCCCGCTCGGGGTGCGTACGCGACGGAGCGGGGTGTGAAGATGGCGGACGAAGAGGCCGAGCAGGAGAGGTTG
AGTTGCGGCGAAGGCGGCTGCGTCGCGGAGCTGCAGCGCCTGGGCGAGCGGCTCCAGGAGCTGGAGCTACAGCTGCGGGAGAGCCGGGTA
CCGGCCGTGGAAGCGGCCACCGACTACTGTCAGCAGCTGTGCCAGTTTTCTGAATTTCCAGATCCCATGTGGGGTTCAGATTATGTGCAG
TTGTCAAGGACACCACCTTCATCTGAGGAGAAATGCAGTGCTGTGTCGTGGGAGGAGCTGAAGGCCATGGATTTACCTTCATTCGAACCT
GCCTTCCTAGTTCTCTGCCGAGTCCTTCTGAATGTCATACATGAGTGTCTGAAGTTAAGATTGGAGCAGAGACCTGCTGGAGAACCATCT
CTCTTGAGTATTAAGCAGCTGGTGAGAGAGTGTAAGGAGGTCCTGAAGGGCGGCCTGCTGATGAAGCAGTACTACCAGTTCATGCTGCAG
GAGGTTCTGGAGGACTTGGAGAAGCCCGACTGCAACATTGACGCTTTTGAAGAGGATCTACATAAAATGCTTATGGTGTATTTTGATTAC
ATGAGAAGCTGGATCCAAATGCTACAGCAATTACCTCAAGCATCGCATAGTTTAAAAAATCTGTTAGAAGAAGAATGGAATTTCACCAAA
GAAATAACTCATTACATACGGGGAGGAGAAGCACAGGCCGGGAAGCTTTTCTGTGACATTGCAGGAATGCTGCTGAAATCTACAGGAAGT
TTTTTAGAATTTGGCTTACAGGAGAGCTGTGCTGAATTTTGGACTAGTGCGGATGACAGCAGTGCTTCCGACGAAATCAGGAGGTCTGTT
ATAGAGATCAGTCGAGCCCTGAAGGAGCTCTTCCATGAAGCCAGAGAAAGGGCTTCCAAAGCACTTGGATTTGCTAAAATGTTGAGAAAG
GACCTGGAAATAGCAGCAGAATTCAGGCTTTCAGCCCCAGTTAGAGACCTCCTGGATGTTCTGAAATCAAAACAGTATGTCAAGGTGCAA
ATTCCTGGGTTAGAAAACTTGCAAATGTTTGTTCCAGACACTCTTGCTGAGGAGAAGAGTATTATTTTGCAGTTACTCAATGCAGCTGCA
GGAAAGGACTGTTCAAAAGATTCAGATGACGTACTCATCGATGCCTATCTGCTTCTGACCAAGCACGGTGATCGAGCCCGTGATTCAGAG
GACAGCTGGGGCACCTGGGAGGCACAGCCTGTCAAAGTCGTGCCTCAGGTGGAGACTGTTGACACCCTGAGAAGCATGCAGGTGGATAAT
CTTTTACTAGTTGTCATGCAGTCTGCGCATCTCACAATTCAGAGAAAAGCTTTCCAGCAGTCCATTGAGGGACTTATGACTCTGTGCCAG
GAGCAGACATCCAGTCAGCCGGTCATCGCCAAAGCTTTGCAGCAGCTGAAGAATGATGCATTGGAGCTATGCAACAGGATAAGCAATGCC
ATTGACCGCGTGGACCACATGTTCACATCAGAATTTGATGCTGAGGTTGATGAATCTGAATCTGTCACCTTGCAACAGTACTACCGAGAA
GCAATGATTCAGGGGTACAATTTTGGATTTGAGTATCATAAAGAAGTTGTTCGTTTGATGTCTGGGGAGTTTAGACAGAAGATAGGAGAC
AAATATATAAGCTTTGCCCGGAAGTGGATGAATTATGTCCTGACTAAATGTGAGAGTGGTAGAGGTACAAGACCCAGGTGGGCGACTCAA
GGATTTGATTTTCTACAAGCAATTGAACCTGCCTTTATTTCAGCTTTACCAGAAGATGACTTCTTGAGTTTACAAGCCTTGATGAATGAA
TGCATTGGCCATGTCATAGGAAAACCACACAGTCCTGTTACAGCCATTCATCGGAACAGCCCCCGTCCTATGAAGGTACCTCGATGCCAT
AGTGACCCTCCTAACCCACACCTCATTATCCCCACTCCAGAGGGATTCAGCACTCGGAGCATGCCTTCCGACGCGCGGAGCCATGGCAGC
CCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGTTGCTGCCAGTCGGCCCAGCCCCTCTGGTGGTGACTCTGTGCTGCCCAAATCCATC
AGCAGTGCCCATGATACCAGGGGTTCCAGCGTTCCTGAAAATGATCGATTGGCTTCCATAGCTGCTGAATTGCAGTTTAGGTCCCTGAGT
CGTCACTCAAGCCCCACGGAGGAGCGAGATGAACCAGCATATCCAAGAGGAGATTCAAGTGGGTCCACAAGAAGAAGTTGGGAACTTCGG
ACACTAATCAGCCAGAGTAAAGATACTGCTTCTAAACTAGGACCCATAGAAGCTATCCAGAAGTCAGTCCGATTGTTTGAAGAAAAGAGG
TACCGAGAAATGAGGAGAAAGAATATCATTGGTCAAGTTTGTGATACGCCTAAGTCCTATGATAATGTTATGCACGTTGGCTTGAGGAAG
GTGACCTTCAAATGGCAAAGAGGAAACAAAATTGGAGAAGGCCAGTATGGGAAGGTGTACACCTGCATCAGCGTCGACACCGGGGAGCTG
ATGGCCATGAAAGAGATTCGATTTCAACCTAATGACCATAAGACTATCAAGGAAACTGCAGACGAATTGAAAATATTCGAAGGCATCAAA
CACCCCAATCTGGTTCGGTATTTTGGTGTGGAGCTCCATAGAGAAGAAATGTACATCTTCATGGAGTACTGCGATGAGGGGACTTTAGAA
GAGGTGTCAAGGCTGGGACTTCAGGAACATGTGATTAGGCTGTATTCAAAGCAGATCACCATTGCGATCAACGTCCTCCATGAGCATGGC
ATAGTCCACCGTGACATTAAAGGTGCCAATATCTTCCTTACCTCATCTGGATTAATCAAACTGGGAGATTTTGGATGTTCAGTAAAGCTC
AAAAACAATGCCCAGACCATGCCTGGTGAAGTGAACAGCACCCTGGGGACAGCAGCATACATGGCACCTGAAGTCATCACTCGTGCCAAA
GGAGAGGGCCATGGGCGTGCGGCCGACATCTGGAGTCTGGGGTGTGTTGTCATAGAGATGGTGACTGGCAAGAGGCCTTGGCATGAGTAT
GAGCACAACTTTCAAATTATGTATAAAGTGGGGATGGGACATAAGCCACCAATCCCTGAAAGATTAAGCCCTGAAGGAAAGGACTTCCTT
TCTCACTGCCTTGAGAGTGACCCAAAGATGAGATGGACCGCCAGCCAGCTCCTCGACCATTCGTTTGTCAAGGTTTGCACAGATGAAGAA
TGAAGCCTAGTAGAATATGGACTTGGAAAATTCTCTTAATCACTACTGTATGTAATATTTACATAAAGACTGTGCTGAGAAGCAGTATAA
GCCTTTTTAACCTTCCAAGACTGAAGACTGCACAGGTGACAAGCGTCACTTCTCCTGCTGCTCCTGTTTGTCTGATGTGGCAAAAGGCCC
TCTGGAGGGCTGGTGGCCACGAGGTTAAAGAAGCTGCATGTTAAGTGCCATTACTACTGTACACGGACCATCGCCTCTGTCTCCTCCGTG
TCTCGCGCGACTGAGAACCGTGACATCAGCGTAGTGTTTTGACCTTTCTAGGTTCAAAAGAAGTTGTAGTGTTATCAGGCGTCCCATACC
TTGTTTTTAATCTCCTGTTTGTTGAGTGCACTGACTGTGAAACCTTTACCTTTTTTGTTGTTGTTGGCAAGCTGCAGGTTTGTAATGCAA


Top

FusionGenePPI for ZNF292_MAP3K4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZNF292ALB, SLAMF1, P4HB, YEATS4, NEDD1MAP3K4CDC42, RAC1, MAP2K1, MAP2K4, MAP2K3, MAP2K6, GADD45G, GADD45B, GADD45A, ALK, SH3KBP1, TPR, YWHAZ, CNTRL, ZFP36, TRAF4, MAP2K7, RIPK2, MAPK8, CHUK, GSK3B, MAP3K4, AXIN1, HNRNPD, POLR2F, RAP1B, SORT1, SRPR, KIF23, BAG3, SYNCRIP, AP4E1, GOLT1B, SGTB, KIF21A, VWA9, CNTROB, NEDD1, KIF7, BAG6, USF1, MAPK13, SPATA1, ACTBL2, SIGLECL1, BTK, TOP1, TOP2A, TOP3A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZNF292_MAP3K4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ZNF292_MAP3K4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneZNF292C0009404Colorectal Neoplasms1CTD_human
TgeneMAP3K4C0014170Endometrial Neoplasms1CTD_human