FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 43131

FusionGeneSummary for ZNF254_ETFB

check button Fusion gene summary
Fusion gene informationFusion gene name: ZNF254_ETFB
Fusion gene ID: 43131
HgeneTgene
Gene symbol

ZNF254

ETFB

Gene ID

9534

2109

Gene namezinc finger protein 254electron transfer flavoprotein subunit beta
SynonymsBMZF-5|HD-ZNF1|ZNF539|ZNF91LFP585|MADD
Cytomap

19p12

19q13.41

Type of geneprotein-codingprotein-coding
Descriptionzinc finger protein 254CTD-2017D11.1bone marrow zinc finger 5hematopoietic cell-derived zinc finger protein 1zinc finger protein 539electron transfer flavoprotein subunit betabeta-ETFelectron transfer flavoprotein beta subunitelectron transfer flavoprotein, beta polypeptideelectron-transferring-flavoprotein, beta polypeptide
Modification date2018052220180523
UniProtAcc

O75437

P38117

Ensembl transtripts involved in fusion geneENST00000342944, ENST00000339642, 
ENST00000357002, 
ENST00000354232, 
ENST00000309244, 
Fusion gene scores* DoF score3 X 3 X 3=272 X 1 X 2=4
# samples 32
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(2/4*10)=2.32192809488736
Context

PubMed: ZNF254 [Title/Abstract] AND ETFB [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneETFB

GO:0033539

fatty acid beta-oxidation using acyl-CoA dehydrogenase

25416781


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDGBMTCGA-19-A6J5-01AZNF254chr19

24270139

+ETFBchr19

51857562

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000342944ENST00000354232ZNF254chr19

24270139

+ETFBchr19

51857562

-
intron-3CDSENST00000342944ENST00000309244ZNF254chr19

24270139

+ETFBchr19

51857562

-
In-frameENST00000339642ENST00000354232ZNF254chr19

24270139

+ETFBchr19

51857562

-
In-frameENST00000339642ENST00000309244ZNF254chr19

24270139

+ETFBchr19

51857562

-
In-frameENST00000357002ENST00000354232ZNF254chr19

24270139

+ETFBchr19

51857562

-
In-frameENST00000357002ENST00000309244ZNF254chr19

24270139

+ETFBchr19

51857562

-

Top

FusionProtFeatures for ZNF254_ETFB


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZNF254

O75437

ETFB

P38117

May be involved in transcriptional regulation. Heterodimeric electron transfer flavoprotein thataccepts electrons from several mitochondrial dehydrogenases,including acyl-CoA dehydrogenases, glutaryl-CoA and sarcosinedehydrogenase (PubMed:25416781, PubMed:15159392, PubMed:15975918).It transfers the electrons to the main mitochondrial respiratorychain via ETF-ubiquinone oxidoreductase (Probable). Required fornormal mitochondrial fatty acid oxidation and normal amino acidmetabolism (PubMed:12815589, PubMed:7912128). ETFB binds an AMPmolecule that probably has a purely structural role(PubMed:8962055, PubMed:15159392, PubMed:15975918).{ECO:0000269|PubMed:12815589, ECO:0000269|PubMed:15159392,ECO:0000269|PubMed:15975918, ECO:0000269|PubMed:25416781,ECO:0000269|PubMed:7912128, ECO:0000269|PubMed:8962055,ECO:0000303|PubMed:17941859, ECO:0000305}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ZNF254_ETFB


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZNF254_ENST00000339642_chr19_24270139_+_ETFB_ENST00000354232_chr19_51857562_-_10aa

>In-frame_ZNF254_ENST00000339642_chr19_24270139_+_ETFB_ENST00000309244_chr19_51857562_-_247aa
MPGPPRSLEMIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERL
GPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNE

>In-frame_ZNF254_ENST00000357002_chr19_24270139_+_ETFB_ENST00000354232_chr19_51857562_-_10aa

>In-frame_ZNF254_ENST00000357002_chr19_24270139_+_ETFB_ENST00000309244_chr19_51857562_-_247aa
MPGPPRSLEMIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERL
GPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZNF254_ENST00000339642_chr19_24270139_+_ETFB_ENST00000354232_chr19_51857562_-_30nt

>In-frame_ZNF254_ENST00000339642_chr19_24270139_+_ETFB_ENST00000309244_chr19_51857562_-_741nt
ATGCCAGGACCCCCTAGAAGCCTAGAAATGATCCGAGTGAAGCCTGACAGGACCGGTGTGGTCACGGATGGTGTGAAGCACTCCATGAAC
CCCTTCTGTGAGATCGCGGTGGAGGAGGCTGTGCGGCTCAAGGAGAAGAAGCTGGTGAAGGAGGTCATCGCCGTCAGCTGTGGGCCTGCA
CAGTGCCAGGAGACGATTCGTACCGCCCTGGCCATGGGTGCAGACCGAGGTATCCACGTGGAGGTGCCCCCAGCAGAAGCAGAACGCTTG
GGTCCCCTGCAGGTGGCTCGGGTCCTGGCCAAGCTGGCAGAGAAGGAGAAGGTGGACCTGGTGCTGCTGGGCAAACAGGCCATCGATGAT
GACTGTAACCAGACAGGGCAGATGACAGCTGGATTTCTTGACTGGCCACAGGGCACATTCGCCTCCCAGGTGACGCTGGAGGGGGACAAG
TTGAAAGTGGAGCGGGAGATCGATGGGGGCCTGGAGACCCTGCGCCTGAAGCTGCCAGCTGTGGTGACAGCTGACCTGAGGCTCAACGAG
CCCCGCTACGCCACGCTGCCCAACATCATGAAAGCCAAGAAGAAGAAGATCGAGGTGATCAAGCCTGGGGACCTGGGTGTGGACCTGACC
TCCAAGCTCTCTGTGATCAGTGTGGAGGACCCGCCCCAGCGCACGGCCGGCGTCAAGGTGGAGACCACTGAGGACCTGGTGGCCAAGCTG

>In-frame_ZNF254_ENST00000357002_chr19_24270139_+_ETFB_ENST00000354232_chr19_51857562_-_30nt

>In-frame_ZNF254_ENST00000357002_chr19_24270139_+_ETFB_ENST00000309244_chr19_51857562_-_741nt
ATGCCAGGACCCCCTAGAAGCCTAGAAATGATCCGAGTGAAGCCTGACAGGACCGGTGTGGTCACGGATGGTGTGAAGCACTCCATGAAC
CCCTTCTGTGAGATCGCGGTGGAGGAGGCTGTGCGGCTCAAGGAGAAGAAGCTGGTGAAGGAGGTCATCGCCGTCAGCTGTGGGCCTGCA
CAGTGCCAGGAGACGATTCGTACCGCCCTGGCCATGGGTGCAGACCGAGGTATCCACGTGGAGGTGCCCCCAGCAGAAGCAGAACGCTTG
GGTCCCCTGCAGGTGGCTCGGGTCCTGGCCAAGCTGGCAGAGAAGGAGAAGGTGGACCTGGTGCTGCTGGGCAAACAGGCCATCGATGAT
GACTGTAACCAGACAGGGCAGATGACAGCTGGATTTCTTGACTGGCCACAGGGCACATTCGCCTCCCAGGTGACGCTGGAGGGGGACAAG
TTGAAAGTGGAGCGGGAGATCGATGGGGGCCTGGAGACCCTGCGCCTGAAGCTGCCAGCTGTGGTGACAGCTGACCTGAGGCTCAACGAG
CCCCGCTACGCCACGCTGCCCAACATCATGAAAGCCAAGAAGAAGAAGATCGAGGTGATCAAGCCTGGGGACCTGGGTGTGGACCTGACC
TCCAAGCTCTCTGTGATCAGTGTGGAGGACCCGCCCCAGCGCACGGCCGGCGTCAAGGTGGAGACCACTGAGGACCTGGTGGCCAAGCTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZNF254_ENST00000339642_chr19_24270139_+_ETFB_ENST00000354232_chr19_51857562_-_3546nt
GGGGCCTTTGTCTCTCGCTGTCGCCGGAGTCCCAGGTCTGTCTTCACTGCTCTGTGTCCTCTGCTCCTAGAGGCCCAGCCTCTGTGGCGC
TGTTACCAGCAGGTATTGGAGATCCACAGCTAAGATGCCAGGACCCCCTAGAAGCCTAGAAATGGCGAGAGCCCATCTAAAAAAAAAAAA
AAAAGAAATTAGAAACAGGGTCTTTGCAGATGTGATTAAATTAAGCATCTTGAGATGGGGGCATTATCCTGGATTATTTAGGTGGGCCCT
GAATGCCATCTCAAGAGTCCTTATAAGAGAGAGACAGAGGGAGACTAGACACGCAGAGAGAGGAGAAGGCCACGTGAAGACAGAGCTGAG
GATGCTGGCATTGAAGATAAAGCGATGCAGCCACAAGCCAGGGAGTGTCAGCAGAAGCTGGAGGAGGCAAGAAACGTGTTCCTCCCGGGG
CCTGCAGACCCCTTGGTCTCACCCTGGTGACACTGACTTTGGACTTCTGGCCTCCAGAGCTGTAAGATTCTAAGCCACCAAATATATGGT
GATTTGTTACGGCAGCCGAGAGAAACTAATAGGAGAGTGGTTAGTGGTTCACGCTACACCCTGGTCTACACCGGAAGCCTCTCTCCCTGG
CACATGATGGTGTCCCCAGGATCCAGCTCAGAGCCAGGCACACAGTGGGGCCCAGGAGAGACAAAAATGATGTGCAGAAGCAAATGGGTG
GGGTTTGCCACCCACCTCCCTTACCTCCCTTGTCTGTTTAGCAAAGAGGTCTTTCATGCTGGTGTTTTCCAAATTAGGTTGTGACCATGT
GTGATCATGACATCCAGGCAGAGGGCTGGCATTTTTCCGAAAAAGGGTAGAAAATGTCAGAGTATGGTGTGTGTGTAGGCAGGGTCAGTA
TTGGTCACTGACCCTTACACTGCAGTGGCATTTGTGAAATAGGTCAGGGTCACTGGTCACGTTGTCTAAGGTGTTATCCGAGCTCGTTTC
ACAACCAAGAGAATTAAAGAGCATAGACCACCCAAAAGGTGAGGTTGGAGCGAAAGTTTAATAAGCAAAAGAAGAAAGCTCTCCACAGAG
GAGAGGGAAGCCCAAGCGGGTTGCCATTTTTACAGTTGATTCCAAAAGCTTTTTTTTTAAAAAATTATTTATTTATTTATTTTTTATTAT
TATACTTTAAGTTTTAGGATACATGTGCACAACGTACAGGTTTGTTACATGTGTTTATATGTGCCATGTTGGTGTGCTGCACCCAGTAAC
TCGTCCTTTAGCATTAGGTATATCTCCTAATGCTATCCCTCCCCCCTCCCCCCACCCCACGACAGTCCCCGGTGTGTGATGTTCCCCTTC
CTGTGTCCATGTGTTCTCATTGTTCAATTCCCACCTATGAGTGAGAACATGCGTTGTTTGGTTTTCTGTCCTTGCGATAGTTTGCTGAGA
ATGATGGTTTCCAGCTTCATCCATGTCCCTACAAAGGACATGAACTCATCATTGTTTATGGCTGCATAGTATTCCATGGTGTATATGTGC
CACATTTTCTTAATCCAGTCTATCATTGTTGGACATTTGGGTTGGTTCCAAGTCTTTACTATTGTGAATAGTGCCGCAATAAACATATGT
GTGCATGTGTCTTTATAGCAGCATGATTTATAATCCTTTGGGTATATACCCAGTAATAGGATGGCTGGGTCAAATGGTATTTCTAGTTCT
AGATCCCTGAGGAATCACCACACCGACTTCCACAATGGTTGAACTAGTTTACAGTCCCACCAACAGTGTAAAAGTGTTCCTTTTTCTCCA
CATCCTCTCCAGCACCTGTTCTTTCCTGACTTTTTAATGATCGCCGTTCTAACTGGTGTGAGACGGTATCTCATTGTGATTTTGATTTGC
ATTTCTCTGATGGCCAGTGATGATGAGCATTTTTCATGTGTTTTTTGGCTGCATAAATGTCTTCTTTTGAGAAGTGTCTATTCATATCCT
TCGCCCACTTTTTGATGGGGTTGTTTGTTTTTTTCTTGTACATTTGTTTGAGTTCATTGTAGATTCTGGATATTAGCCATTTGTCAGATG
AGTAGGCTGCAAAAATTTTCTCCCATTCTGTAGGTTGCCTGTTCACTCTGATGGTTAAACTAAAGAGCTTCTGCACAGCAAAAGACACCA
AAAGCTTTTATAAGAAACTCCTTTCATCTCTGTAGCTGTTTGAGTATCTTATCTGTAAAGCTATCTGCATAACTCTCCGTTATCTATGTA
GTTGTGGGTACGTCTTTAGGCAAGCACAAAGCTCCGCTTCTCTTGTTTCTGTAACCGTGGGTTTGTTTTAGGTAAGCTCCGCCCCTCCCC
GTGCAAGTTCCCACAGAGACCACCATGTACGTGCCTGAAAAGGGGAGGGAACTTTTCCTGGGAGCCTGTCAGTCACGCAAAGAACAAAAG
GCTTCTGTGCTGGGCAGCTTGAGTTTTCCCCAGGCTGCTCTATTGTTGCCTGTAGCTGTGATTTTTCAGGCAGGCTGCTCCTCTGAGGAC
CACCCTTAACTGTCTACCTAACTGGTTTTTCCTTTTCTTCTCCTCATTTGTATTTATGTATCAGTGTATTATGTATTTATATACACTTGG
AGATACAGTAAAATGTACCTCTCACTGTGGGTTACCATAAATACTGTAAATTTGAGAAACACTCTTTCAGGCCTGAGAGGAGCAGTGACA
ACAGTAGGGATGATCAAGTCAGATGTCCCTGGTACCCAGGAATGGCTGGATGAGAGAAGGAGACAGGGTGACCTGCCCCTGCCTACAAAC
TCTAACCCAGTTCTGTCCCTGGAGCTGTGTGACCCCGGACAAGGCCCTGCCCCTTTCCAGGCTGTCGTTGTCCTCATCCAGCCTGGGAGA
GGGTTGGCGCTGAGGCCCCCACCTTCTTGCCTGTTTCCTCCTGACCCCACCCCTTCCCCTCCTGCTGGGCAGATCCGAGTGAAGCCTGAC
AGGACCGGTGTGGTCACGGATGGTGTGAAGCACTCCATGAACCCCTTCTGTGAGATCGCGGTGGAGGAGGCTGTGCGGCTCAAGGAGAAG
AAGCTGGTGAAGGAGGTCATCGCCGTCAGCTGTGGGCCTGCACAGTGCCAGGAGACGATTCGTACCGCCCTGGCCATGGGTGCAGACCGA
GGTATCCACGTGGAGGTGCCCCCAGCAGAAGCAGAACGCTTGGGTCCCCTGCAGGTGGCTCGGGTCCTGGCCAAGCTGGCAGAGAAGGAG
AAGGTGGACCTGGTGCTGCTGGGCAAACAGGCCATCGATGATGACTGTAACCAGACAGGGCAGATGACAGCTGGATTTCTTGACTGGCCA
CAGGGCACATTCGCCTCCCAGGTGACGCTGGAGGGGGACAAGTTGAAAGTGGAGCGGGAGATCGATGGGGGCCTGGAGACCCTGCGCCTG
AAGCTGCCAGCTGTGGTGACAGCTGACCTGAGGCTCAACGAGCCCCGCTACGCCACGCTGCCCAACATCATGAAATCCTAAGTAATGCAC

>In-frame_ZNF254_ENST00000339642_chr19_24270139_+_ETFB_ENST00000309244_chr19_51857562_-_905nt
GGGGCCTTTGTCTCTCGCTGTCGCCGGAGTCCCAGGTCTGTCTTCACTGCTCTGTGTCCTCTGCTCCTAGAGGCCCAGCCTCTGTGGCGC
TGTTACCAGCAGGTATTGGAGATCCACAGCTAAGATGCCAGGACCCCCTAGAAGCCTAGAAATGATCCGAGTGAAGCCTGACAGGACCGG
TGTGGTCACGGATGGTGTGAAGCACTCCATGAACCCCTTCTGTGAGATCGCGGTGGAGGAGGCTGTGCGGCTCAAGGAGAAGAAGCTGGT
GAAGGAGGTCATCGCCGTCAGCTGTGGGCCTGCACAGTGCCAGGAGACGATTCGTACCGCCCTGGCCATGGGTGCAGACCGAGGTATCCA
CGTGGAGGTGCCCCCAGCAGAAGCAGAACGCTTGGGTCCCCTGCAGGTGGCTCGGGTCCTGGCCAAGCTGGCAGAGAAGGAGAAGGTGGA
CCTGGTGCTGCTGGGCAAACAGGCCATCGATGATGACTGTAACCAGACAGGGCAGATGACAGCTGGATTTCTTGACTGGCCACAGGGCAC
ATTCGCCTCCCAGGTGACGCTGGAGGGGGACAAGTTGAAAGTGGAGCGGGAGATCGATGGGGGCCTGGAGACCCTGCGCCTGAAGCTGCC
AGCTGTGGTGACAGCTGACCTGAGGCTCAACGAGCCCCGCTACGCCACGCTGCCCAACATCATGAAAGCCAAGAAGAAGAAGATCGAGGT
GATCAAGCCTGGGGACCTGGGTGTGGACCTGACCTCCAAGCTCTCTGTGATCAGTGTGGAGGACCCGCCCCAGCGCACGGCCGGCGTCAA
GGTGGAGACCACTGAGGACCTGGTGGCCAAGCTGAAGGAGATTGGGCGGATTTGAGCCCCTCCCAGAGATGGCAATAAAACTGACTCTCA

>In-frame_ZNF254_ENST00000357002_chr19_24270139_+_ETFB_ENST00000354232_chr19_51857562_-_3694nt
GTCTCTCGCTGTCGCCGGAGTCCCAGGTCTGTCTTCACTGCTCTGTGTCCTCTGCTCCTAGAGGCCCAGCCTCTGTGGCGCTGTTACCAG
CAGGTATTGGAGATCCACAGCTAAGATGCCAGGACCCCCTAGAAGCCTAGAAATGGCGAGAGCCCATCTAAAAAAAAAAAAAAAAGAAAT
TAGAAACAGGGTCTTTGCAGATGTGATTAAATTAAGCATCTTGAGATGGGGGCATTATCCTGGATTATTTAGGTGGGCCCTGAATGCCAT
CTCAAGAGTCCTTATAAGAGAGAGACAGAGGGAGACTAGACACGCAGAGAGAGGAGAAGGCCACGTGAAGACAGAGCTGAGGATGCTGGC
ATTGAAGATAAAGCGATGCAGCCACAAGCCAGGGAGTGTCAGCAGAAGCTGGAGGAGGCAAGAAACGTGTTCCTCCCGGGGCCTGCAGAC
CCCTTGGTCTCACCCTGGTGACACTGACTTTGGACTTCTGGCCTCCAGAGCTGTAAGATTCTAAGCCACCAAATATATGGTGATTTGTTA
CGGCAGCCGAGAGAAACTAATAGGAGAGTGGTTAGTGGTTCACGCTACACCCTGGTCTACACCGGAAGCCTCTCTCCCTGGCACATGATG
GTGTCCCCAGGATCCAGCTCAGAGCCAGGCACACAGTGGGGCCCAGGAGAGACAAAAATGATGTGCAGAAGCAAATGGGTGGGGTTTGCC
ACCCACCTCCCTTACCTCCCTTGTCTGTTTAGCAAAGAGGTCTTTCATGCTGGTGTTTTCCAAATTAGGTTGTGACCATGTGTGATCATG
ACATCCAGGCAGAGGGCTGGCATTTTTCCGAAAAAGGGTAGAAAATGTCAGAGTATGGTGTGTGTGTAGGCAGGGTCAGTATTGGTCACT
GACCCTTACACTGCAGTGGCATTTGTGAAATAGGTCAGGGTCACTGGTCACGTTGTCTAAGGTGTTATCCGAGCTCGTTTCACAACCAAG
AGAATTAAAGAGCATAGACCACCCAAAAGGTGAGGTTGGAGCGAAAGTTTAATAAGCAAAAGAAGAAAGCTCTCCACAGAGGAGAGGGAA
GCCCAAGCGGGTTGCCATTTTTACAGTTGATTCCAAAAGCTTTTTTTTTAAAAAATTATTTATTTATTTATTTTTTATTATTATACTTTA
AGTTTTAGGATACATGTGCACAACGTACAGGTTTGTTACATGTGTTTATATGTGCCATGTTGGTGTGCTGCACCCAGTAACTCGTCCTTT
AGCATTAGGTATATCTCCTAATGCTATCCCTCCCCCCTCCCCCCACCCCACGACAGTCCCCGGTGTGTGATGTTCCCCTTCCTGTGTCCA
TGTGTTCTCATTGTTCAATTCCCACCTATGAGTGAGAACATGCGTTGTTTGGTTTTCTGTCCTTGCGATAGTTTGCTGAGAATGATGGTT
TCCAGCTTCATCCATGTCCCTACAAAGGACATGAACTCATCATTGTTTATGGCTGCATAGTATTCCATGGTGTATATGTGCCACATTTTC
TTAATCCAGTCTATCATTGTTGGACATTTGGGTTGGTTCCAAGTCTTTACTATTGTGAATAGTGCCGCAATAAACATATGTGTGCATGTG
TCTTTATAGCAGCATGATTTATAATCCTTTGGGTATATACCCAGTAATAGGATGGCTGGGTCAAATGGTATTTCTAGTTCTAGATCCCTG
AGGAATCACCACACCGACTTCCACAATGGTTGAACTAGTTTACAGTCCCACCAACAGTGTAAAAGTGTTCCTTTTTCTCCACATCCTCTC
CAGCACCTGTTCTTTCCTGACTTTTTAATGATCGCCGTTCTAACTGGTGTGAGACGGTATCTCATTGTGATTTTGATTTGCATTTCTCTG
ATGGCCAGTGATGATGAGCATTTTTCATGTGTTTTTTGGCTGCATAAATGTCTTCTTTTGAGAAGTGTCTATTCATATCCTTCGCCCACT
TTTTGATGGGGTTGTTTGTTTTTTTCTTGTACATTTGTTTGAGTTCATTGTAGATTCTGGATATTAGCCATTTGTCAGATGAGTAGGCTG
CAAAAATTTTCTCCCATTCTGTAGGTTGCCTGTTCACTCTGATGGTTAAACTAAAGAGCTTCTGCACAGCAAAAGACACCAAAAGCTTTT
ATAAGAAACTCCTTTCATCTCTGTAGCTGTTTGAGTATCTTATCTGTAAAGCTATCTGCATAACTCTCCGTTATCTATGTAGTTGTGGGT
ACGTCTTTAGGCAAGCACAAAGCTCCGCTTCTCTTGTTTCTGTAACCGTGGGTTTGTTTTAGGTAAGCTCCGCCCCTCCCCGTGCAAGTT
CCCACAGAGACCACCATGTACGTGCCTGAAAAGGGGAGGGAACTTTTCCTGGGAGCCTGTCAGTCACGCAAAGAACAAAAGGCTTCTGTG
CTGGGCAGCTTGAGTTTTCCCCAGGCTGCTCTATTGTTGCCTGTAGCTGTGATTTTTCAGGCAGGCTGCTCCTCTGAGGACCACCCTTAA
CTGTCTACCTAACTGGTTTTTCCTTTTCTTCTCCTCATTTGTATTTATGTATCAGTGTATTATGTATTTATATACACTTGGAGATACAGT
AAAATGTACCTCTCACTGTGGGTTACCATAAATACTGTAAATTTGAGAAACACTCTTTCAGGCCTGAGAGGAGCAGTGACAACAGTAGGG
ATGATCAAGTCAGATGTCCCTGGTACCCAGGAATGGCTGGATGAGAGAAGGAGACAGGGTGACCTGCCCCTGCCTACAAACTCTAACCCA
GTTCTGTCCCTGGAGCTGTGTGACCCCGGACAAGGCCCTGCCCCTTTCCAGGCTGTCGTTGTCCTCATCCAGCCTGGGAGAGGGTTGGCG
CTGAGGCCCCCACCTTCTTGCCTGTTTCCTCCTGACCCCACCCCTTCCCCTCCTGCTGGGCAGATCCGAGTGAAGCCTGACAGGACCGGT
GTGGTCACGGATGGTGTGAAGCACTCCATGAACCCCTTCTGTGAGATCGCGGTGGAGGAGGCTGTGCGGCTCAAGGAGAAGAAGCTGGTG
AAGGAGGTCATCGCCGTCAGCTGTGGGCCTGCACAGTGCCAGGAGACGATTCGTACCGCCCTGGCCATGGGTGCAGACCGAGGTATCCAC
GTGGAGGTGCCCCCAGCAGAAGCAGAACGCTTGGGTCCCCTGCAGGTGGCTCGGGTCCTGGCCAAGCTGGCAGAGAAGGAGAAGGTGGAC
CTGGTGCTGCTGGGCAAACAGGCCATCGATGATGACTGTAACCAGACAGGGCAGATGACAGCTGGATTTCTTGACTGGCCACAGGGCACA
TTCGCCTCCCAGGTGACGCTGGAGGGGGACAAGTTGAAAGTGGAGCGGGAGATCGATGGGGGCCTGGAGACCCTGCGCCTGAAGCTGCCA
GCTGTGGTGACAGCTGACCTGAGGCTCAACGAGCCCCGCTACGCCACGCTGCCCAACATCATGAAAGCCAAGAAGAAGAAGATCGAGGTG
ATCAAGCCTGGGGACCTGGGTGTGGACCTGACCTCCAAGCTCTCTGTGATCAGTGTGGAGGACCCGCCCCAGCGCACGGCCGGCGTCAAG
GTGGAGACCACTGAGGACCTGGTGGCCAAGCTGAAGGAGATTGGGCGGATTTGAGCCCCTCCCAGAGATGGCAATAAAACTGACTCTCAA

>In-frame_ZNF254_ENST00000357002_chr19_24270139_+_ETFB_ENST00000309244_chr19_51857562_-_896nt
GTCTCTCGCTGTCGCCGGAGTCCCAGGTCTGTCTTCACTGCTCTGTGTCCTCTGCTCCTAGAGGCCCAGCCTCTGTGGCGCTGTTACCAG
CAGGTATTGGAGATCCACAGCTAAGATGCCAGGACCCCCTAGAAGCCTAGAAATGATCCGAGTGAAGCCTGACAGGACCGGTGTGGTCAC
GGATGGTGTGAAGCACTCCATGAACCCCTTCTGTGAGATCGCGGTGGAGGAGGCTGTGCGGCTCAAGGAGAAGAAGCTGGTGAAGGAGGT
CATCGCCGTCAGCTGTGGGCCTGCACAGTGCCAGGAGACGATTCGTACCGCCCTGGCCATGGGTGCAGACCGAGGTATCCACGTGGAGGT
GCCCCCAGCAGAAGCAGAACGCTTGGGTCCCCTGCAGGTGGCTCGGGTCCTGGCCAAGCTGGCAGAGAAGGAGAAGGTGGACCTGGTGCT
GCTGGGCAAACAGGCCATCGATGATGACTGTAACCAGACAGGGCAGATGACAGCTGGATTTCTTGACTGGCCACAGGGCACATTCGCCTC
CCAGGTGACGCTGGAGGGGGACAAGTTGAAAGTGGAGCGGGAGATCGATGGGGGCCTGGAGACCCTGCGCCTGAAGCTGCCAGCTGTGGT
GACAGCTGACCTGAGGCTCAACGAGCCCCGCTACGCCACGCTGCCCAACATCATGAAAGCCAAGAAGAAGAAGATCGAGGTGATCAAGCC
TGGGGACCTGGGTGTGGACCTGACCTCCAAGCTCTCTGTGATCAGTGTGGAGGACCCGCCCCAGCGCACGGCCGGCGTCAAGGTGGAGAC


Top

FusionGenePPI for ZNF254_ETFB


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZNF254TRIM44, TRIM28, ZNF479, CYP24A1, TRIM24ETFBAPP, ETFA, DLD, IRF2BPL, ADRB2, STAU1, CUL7, CAPG, GRHPR, HADH, RABGGTA, GPX4, PITPNB, NTRK1, DYNLT1, XPO1, LRPPRC, ATP6AP2, ATL3, GOLT1B, LYRM5, IVD, EYA2, GMCL1, AKAP11, PRKACB, NDUFAB1, CASC5, DSN1, PLCH1, PRKAR1B, DLST, SOD1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZNF254_ETFB


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ZNF254_ETFB


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneETFBC0268596Multiple Acyl Coenzyme A Dehydrogenase Deficiency2CTD_human;UNIPROT