FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 43114

FusionGeneSummary for ZNF236_RFX3

check button Fusion gene summary
Fusion gene informationFusion gene name: ZNF236_RFX3
Fusion gene ID: 43114
HgeneTgene
Gene symbol

ZNF236

RFX3

Gene ID

7776

5991

Gene namezinc finger protein 236regulatory factor X3
SynonymsZNF236A|ZNF236B-
Cytomap

18q23

9p24.2

Type of geneprotein-codingprotein-coding
Descriptionzinc finger protein 236regulated by glucosetranscription factor RFX3DNA binding protein RFX3regulatory factor X, 3 (influences HLA class II expression)
Modification date2018051920180523
UniProtAcc

Q9UL36

P48380

Ensembl transtripts involved in fusion geneENST00000320610, ENST00000253159, 
ENST00000583095, 
ENST00000382004, 
ENST00000358730, ENST00000302303, 
ENST00000381984, 
Fusion gene scores* DoF score4 X 4 X 3=483 X 3 X 2=18
# samples 52
** MAII scorelog2(5/48*10)=0.0588936890535686
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(2/18*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ZNF236 [Title/Abstract] AND RFX3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTranscription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneRFX3

GO:0045892

negative regulation of transcription, DNA-templated

12411430

TgeneRFX3

GO:0045893

positive regulation of transcription, DNA-templated

20148032


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A2-A04U-01AZNF236chr18

74659608

+RFX3chr9

3228889

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000320610ENST00000382004ZNF236chr18

74659608

+RFX3chr9

3228889

-
5CDS-intronENST00000320610ENST00000358730ZNF236chr18

74659608

+RFX3chr9

3228889

-
5CDS-intronENST00000320610ENST00000302303ZNF236chr18

74659608

+RFX3chr9

3228889

-
5CDS-intronENST00000320610ENST00000381984ZNF236chr18

74659608

+RFX3chr9

3228889

-
In-frameENST00000253159ENST00000382004ZNF236chr18

74659608

+RFX3chr9

3228889

-
5CDS-intronENST00000253159ENST00000358730ZNF236chr18

74659608

+RFX3chr9

3228889

-
5CDS-intronENST00000253159ENST00000302303ZNF236chr18

74659608

+RFX3chr9

3228889

-
5CDS-intronENST00000253159ENST00000381984ZNF236chr18

74659608

+RFX3chr9

3228889

-
intron-3CDSENST00000583095ENST00000382004ZNF236chr18

74659608

+RFX3chr9

3228889

-
intron-intronENST00000583095ENST00000358730ZNF236chr18

74659608

+RFX3chr9

3228889

-
intron-intronENST00000583095ENST00000302303ZNF236chr18

74659608

+RFX3chr9

3228889

-
intron-intronENST00000583095ENST00000381984ZNF236chr18

74659608

+RFX3chr9

3228889

-

Top

FusionProtFeatures for ZNF236_RFX3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZNF236

Q9UL36

RFX3

P48380

May be involved in transcriptional regulation.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+27311023_104516361846Zinc fingerC2H2-type 20
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+27311051_107316361846Zinc fingerC2H2-type 21
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+27311167_118916361846Zinc fingerC2H2-type 22
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+27311195_121716361846Zinc fingerC2H2-type 23
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+2731121_14316361846Zinc fingerC2H2-type 4
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+27311223_124516361846Zinc fingerC2H2-type 24
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+27311251_127316361846Zinc fingerC2H2-type 25
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+2731153_17516361846Zinc fingerC2H2-type 5
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+2731197_21916361846Zinc fingerC2H2-type 6
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+2731225_24716361846Zinc fingerC2H2-type 7
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+2731253_27616361846Zinc fingerC2H2-type 8
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+2731285_30816361846Zinc fingerC2H2-type 9
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+273137_5916361846Zinc fingerC2H2-type 1
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+2731482_50416361846Zinc fingerC2H2-type 10
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+2731510_53216361846Zinc fingerC2H2-type 11
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+2731538_56016361846Zinc fingerC2H2-type 12
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+2731566_58816361846Zinc fingerC2H2-type 13
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+2731657_67916361846Zinc fingerC2H2-type 14
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+273166_8816361846Zinc fingerC2H2-type 2
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+2731685_70716361846Zinc fingerC2H2-type 15
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+2731713_73516361846Zinc fingerC2H2-type 16
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+2731741_76316361846Zinc fingerC2H2-type 17
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+273193_11516361846Zinc fingerC2H2-type 3
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+2731967_98916361846Zinc fingerC2H2-type 18
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+2731995_101716361846Zinc fingerC2H2-type 19
TgeneRFX3chr18:74659608chr9:3228889ENST00000302303-016183_258-104708DNA bindingRFX-type winged-helix
TgeneRFX3chr18:74659608chr9:3228889ENST00000358730-014183_258-3708DNA bindingRFX-type winged-helix

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+27311657_168016361846Zinc fingerC2H2-type 26
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+27311686_170816361846Zinc fingerC2H2-type 27
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+27311722_174416361846Zinc fingerC2H2-type 28
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+27311750_177216361846Zinc fingerC2H2-type 29
HgeneZNF236chr18:74659608chr9:3228889ENST00000253159+27311778_180116361846Zinc fingerC2H2-type 30
TgeneRFX3chr18:74659608chr9:3228889ENST00000382004-1518183_258656750DNA bindingRFX-type winged-helix


Top

FusionGeneSequence for ZNF236_RFX3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZNF236_ENST00000320610_chr18_74659608_+_RFX3_ENST00000382004_chr9_3228889_-_1732aa
MPRGRPPKPRESKARGDSDGVLTLNAENTNTATQVPNFHKCEICLLSFPKESQFQRHMRDHERNDKPHRCDQCPQTFNVEFNLTLHKCTH
SGEDPTCPVCNKKFSRVASLKAHIMLHEKEENLICSECGDEFTLQSQLAVHMEEHRQELAGTRQHACKACKKEFETSSELKEHMKTHYKI
RVSSTRSTNRNIDRSGFTTSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPHACAFCPAAFSQKGNL
QSHVQRVHSEVKNGPTTNCTECSCVFKSLGSLNTHISKMHMGGPQNSTSSTETAHVLTATLFQTLPLQQTEAQATSASSQPSSQAVSDVI
QQLLELSEPAPVESGQSPQPGQQLSITVGINQDILQQALENSGLSSIPAAAHPNDSCHAKTSAPHAQNPDVSSVSNEQTDPTDAEQEKEQ
ESPEKLDKKEKKMIKKKSPFLPGSIREENGVRWHVCPYCAKEFRKPSDLVRHIRIHTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAF
KCQYCMKSFSTSGSLKVHIRLHTGVRPFACPHCDKKFRTSGHRKTHIASHFKHTELRKMRHQRKPAKVRVGKTNIPVPDIPLQEPILITD
LGLIQPIPKNQFFQSTFNNNFVNEADRPYKCFYCHRATKKSCHLKQHIRSHTGEKPFKCSQCGRGFVSAGVLKAHIRTHTGLKSFKCLIC
NGAFTTGGSLRRHMGIHNDLRPTMCPTCQKTFKTSLNCKKHMKTHRTELAQQLQQHQQAASIDDSTVDQQSMQASTQMQVEIESDELPQT
AEVVAANPEAMLDLEPQHVVGTEEAGLGQQLADQPLEADEDGFVAPQDPLRGHVDQFEEQSPAQQSFEPAGLPQGFTVTDTYHQQPQFPP
VQQLQDSSTLESQALSTSFHQQSLLQAPSSDGMNVTTRLIQESSQEELDLQAQGSQFLEDNEDQSRRSYRCDTCNKGFKKSSHLKQHVRS
HTGEKPYKCKLCGRGFVSSGVLKSHEKTHTGVKAFSCSVCNASFTTNGSLTRHMATHMSMKPTKCPFCEEGFRTTVHCKKHMKRHQTVPS
AVSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQESATVSEKVLVQSAAEKDRISELRDKQAELQDEPKHANC
CTYCPKSFKKPSDLVRHVRIHTGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAKPFKCPHCEL
RFRTSGRRKTHMQFHTKPDPKKARKPMTRSSSEGLQPVNLLNSSSTDPNVFIMNNSVLTGQFDQNLLQPGLVGQAILPASVSAGGDLTVS
LTDGSLATLEGIQLQLAANLVGPNVQISGIDAASINNITLQIDPSILQQTLQQGNLLAQQLTGEPGLAPQNSSLQTSDSTVPASVVIQPI
SGLSLQPTVTSANLTIGPLSEQDSVLTTNSSGTQDLTQVMTSQGLVSPSGGPHEITLTINNSSLSQVLAQAAGPTATSSSGSPQEITLTI
SELNTTSGSLPSTTPMSPSAISTQNLVMSSSGVGGDASVTLTLADTQGMLSGGLDTVTLNITSQGQQFPALLTDPSLSGQGGAGSPQVIL
VSHTPQSASAACEEIAYQFGDLNAVSPGNLDKDEGSEVESEMDEELDDSSEPQAKREKTELSQAFPVGCMQPVLETGVQPSLLNPIHSEH

>In-frame_ZNF236_ENST00000253159_chr18_74659608_+_RFX3_ENST00000382004_chr9_3228889_-_1730aa
MGLCGLLERCWLHHDPDGVLTLNAENTNTATQVPNFHKCEICLLSFPKESQFQRHMRDHERNDKPHRCDQCPQTFNVEFNLTLHKCTHSG
EDPTCPVCNKKFSRVASLKAHIMLHEKEENLICSECGDEFTLQSQLAVHMEEHRQELAGTRQHACKACKKEFETSSELKEHMKTHYKIRV
SSTRSTNRNIDRSGFTTSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPHACAFCPAAFSQKGNLQS
HVQRVHSEVKNGPTTNCTECSCVFKSLGSLNTHISKMHMGGPQNSTSSTETAHVLTATLFQTLPLQQTEAQATSASSQPSSQAVSDVIQQ
LLELSEPAPVESGQSPQPGQQLSITVGINQDILQQALENSGLSSIPAAAHPNDSCHAKTSAPHAQNPDVSSVSNEQTDPTDAEQEKEQES
PEKLDKKEKKMIKKKSPFLPGSIREENGVRWHVCPYCAKEFRKPSDLVRHIRIHTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKC
QYCMKSFSTSGSLKVHIRLHTGVRPFACPHCDKKFRTSGHRKTHIASHFKHTELRKMRHQRKPAKVRVGKTNIPVPDIPLQEPILITDLG
LIQPIPKNQFFQSTFNNNFVNEADRPYKCFYCHRATKKSCHLKQHIRSHTGEKPFKCSQCGRGFVSAGVLKAHIRTHTGLKSFKCLICNG
AFTTGGSLRRHMGIHNDLRPTMCPTCQKTFKTSLNCKKHMKTHRTELAQQLQQHQQAASIDDSTVDQQSMQASTQMQVEIESDELPQTAE
VVAANPEAMLDLEPQHVVGTEEAGLGQQLADQPLEADEDGFVAPQDPLRGHVDQFEEQSPAQQSFEPAGLPQGFTVTDTYHQQPQFPPVQ
QLQDSSTLESQALSTSFHQQSLLQAPSSDGMNVTTRLIQESSQEELDLQAQGSQFLEDNEDQSRRSYRCDTCNKGFKKSSHLKQHVRSHT
GEKPYKCKLCGRGFVSSGVLKSHEKTHTGVKAFSCSVCNASFTTNGSLTRHMATHMSMKPTKCPFCEEGFRTTVHCKKHMKRHQTVPSAV
SATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQESATVSEKVLVQSAAEKDRISELRDKQAELQDEPKHANCCT
YCPKSFKKPSDLVRHVRIHTGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAKPFKCPHCELRF
RTSGRRKTHMQFHTKPDPKKARKPMTRSSSEGLQPVNLLNSSSTDPNVFIMNNSVLTGQFDQNLLQPGLVGQAILPASVSAGGDLTVSLT
DGSLATLEGIQLQLAANLVGPNVQISGIDAASINNITLQIDPSILQQTLQQGNLLAQQLTGEPGLAPQNSSLQTSDSTVPASVVIQPISG
LSLQPTVTSANLTIGPLSEQDSVLTTNSSGTQDLTQVMTSQGLVSPSGGPHEITLTINNSSLSQVLAQAAGPTATSSSGSPQEITLTISE
LNTTSGSLPSTTPMSPSAISTQNLVMSSSGVGGDASVTLTLADTQGMLSGGLDTVTLNITSQGQQFPALLTDPSLSGQGGAGSPQVILVS
HTPQSASAACEEIAYQFGDLNAVSPGNLDKDEGSEVESEMDEELDDSSEPQAKREKTELSQAFPVGCMQPVLETGVQPSLLNPIHSEHIV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZNF236_ENST00000320610_chr18_74659608_+_RFX3_ENST00000382004_chr9_3228889_-_5196nt
ATGCCGCGGGGCCGCCCCCCGAAGCCCAGGGAGAGCAAGGCGCGCGGCGACTCCGATGGAGTTTTAACATTGAATGCGGAGAACACTAAT
TATGCCTATCAAGTTCCAAACTTCCATAAATGTGAAATCTGTCTACTATCTTTTCCAAAAGAATCCCAGTTTCAACGCCACATGAGGGAT
CACGAGCGAAATGACAAGCCACATCGATGTGACCAGTGCCCCCAAACATTTAATGTTGAATTCAACCTGACACTTCATAAATGCACCCAC
AGCGGGGAAGATCCTACCTGCCCTGTGTGTAACAAGAAATTCTCCAGAGTGGCTAGTCTCAAAGCGCATATTATGCTACATGAAAAGGAA
GAGAATCTCATCTGTTCTGAGTGTGGGGATGAGTTTACTCTGCAGAGTCAGCTGGCCGTGCACATGGAGGAGCACCGCCAGGAGCTGGCT
GGAACCCGGCAGCATGCCTGCAAGGCCTGCAAGAAAGAGTTCGAGACCTCCTCGGAGCTGAAGGAACACATGAAGACTCATTACAAAATT
AGGGTATCAAGTACAAGGTCTTATAACCGGAATATCGACAGAAGTGGATTCACGTATTCGTGTCCGCACTGTGGAAAGACGTTTCAAAAG
CCAAGCCAGTTAACGCGACACATTAGGATACACACAGGTGAAAGGCCGTTCAAATGTAGTGAATGTGGAAAGGCTTTTAACCAGAAGGGG
GCACTGCAGACCCACATGATCAAGCACACAGGTGAAAAACCCCATGCCTGTGCCTTCTGTCCTGCCGCCTTCTCTCAGAAAGGGAATCTT
CAGTCGCACGTGCAGCGAGTCCACTCAGAGGTCAAGAATGGTCCTACCTATAACTGTACAGAATGTAGTTGTGTATTTAAAAGTTTAGGC
AGCTTAAACACGCATATCAGCAAGATGCATATGGGTGGGCCACAGAATTCAACAAGTTCTACAGAGACTGCTCATGTTTTAACGGCCACA
CTTTTTCAGACGTTACCTCTTCAACAGACGGAAGCCCAAGCCACGTCGGCCTCAAGCCAGCCGAGCTCCCAGGCGGTGAGCGACGTCATC
CAGCAGCTCCTGGAGCTCTCAGAGCCGGCGCCGGTGGAGTCGGGGCAGTCCCCGCAGCCTGGGCAGCAGCTGAGCATCACAGTGGGCATC
AACCAGGACATTTTACAGCAAGCCTTAGAAAACAGTGGGCTGTCTTCAATTCCAGCTGCAGCACATCCTAATGACTCCTGCCATGCCAAG
ACCTCTGCACCACACGCTCAAAACCCAGATGTTTCCAGCGTTTCAAATGAGCAGACGGACCCCACAGACGCAGAGCAAGAAAAAGAACAG
GAAAGCCCGGAGAAACTGGATAAAAAAGAAAAAAAAATGATAAAGAAGAAGTCACCGTTTCTACCTGGCTCCATCCGCGAGGAGAACGGC
GTGCGCTGGCATGTGTGTCCCTACTGCGCCAAGGAGTTCCGCAAGCCCAGCGACCTGGTCCGCCACATCCGCATCCACACCCACGAGAAG
CCCTTCAAGTGCCCGCAGTGCTTCCGCGCCTTCGCCGTGAAGAGCACGCTGACAGCGCACATCAAGACGCACACCGGCATCAAGGCGTTC
AAGTGCCAGTACTGCATGAAGAGCTTCTCCACCTCTGGCAGCCTCAAGGTGCACATTCGCCTGCACACAGGAGTTAGACCTTTTGCTTGT
CCTCACTGTGACAAAAAATTTCGAACCTCAGGCCATAGGAAGACTCACATTGCTTCCCACTTTAAACATACGGAATTAAGGAAAATGAGG
CACCAGCGTAAACCTGCAAAGGTCCGTGTTGGCAAGACGAATATTCCAGTCCCTGATATTCCTTTGCAGGAACCAATCCTCATAACTGAC
TTAGGTCTCATCCAGCCCATTCCAAAAAACCAGTTTTTCCAAAGCTATTTCAATAATAATTTTGTCAATGAAGCAGATAGACCATACAAG
TGTTTTTACTGTCATCGTGCATATAAAAAATCTTGCCACCTTAAACAACACATCAGATCCCATACAGGTGAAAAACCTTTTAAATGTTCT
CAGTGTGGAAGAGGCTTTGTTTCTGCAGGCGTGCTCAAAGCACACATCAGAACACACACAGGACTGAAATCTTTCAAGTGTCTGATATGT
AATGGGGCTTTCACTACTGGTGGCAGCTTACGGCGACACATGGGTATCCACAACGACCTTCGTCCCTATATGTGTCCCTATTGCCAAAAA
ACATTTAAGACTTCACTAAATTGCAAAAAGCACATGAAAACCCACAGATATGAGCTTGCCCAGCAGCTCCAACAGCATCAGCAGGCAGCC
TCGATAGATGACAGCACTGTAGACCAGCAGAGCATGCAGGCCTCCACTCAAATGCAGGTGGAGATCGAGAGCGACGAGCTGCCGCAGACG
GCAGAGGTGGTCGCAGCGAACCCCGAGGCCATGCTGGACCTGGAGCCTCAGCATGTGGTGGGCACGGAGGAAGCAGGGCTGGGCCAGCAG
TTGGCAGATCAGCCCCTGGAAGCAGATGAAGATGGGTTTGTGGCTCCACAGGACCCTCTGCGAGGGCACGTAGACCAGTTTGAAGAGCAG
AGCCCTGCGCAACAGTCCTTCGAACCAGCAGGGCTACCCCAAGGTTTTACAGTGACTGATACGTACCATCAGCAGCCTCAGTTTCCACCT
GTCCAACAGCTACAGGATTCCAGCACACTTGAGTCTCAGGCCCTCTCCACAAGCTTCCACCAGCAGAGCTTGCTGCAGGCTCCCAGCTCT
GATGGGATGAATGTAACAACTCGCTTGATTCAGGAGTCATCCCAAGAGGAACTGGACCTGCAGGCACAAGGTTCCCAGTTTCTGGAGGAC
AACGAGGACCAGAGCAGGCGCTCTTACAGGTGTGACTATTGCAACAAAGGCTTTAAGAAGTCCAGCCACCTGAAGCAGCATGTGCGGTCG
CACACCGGGGAAAAGCCCTACAAGTGCAAGCTCTGTGGACGCGGCTTTGTTTCCTCTGGGGTCCTCAAGTCCCACGAGAAGACACACACA
GGAGTGAAGGCGTTCAGCTGCAGTGTGTGCAATGCTTCCTTCACCACCAATGGCAGCCTCACCCGGCACATGGCCACACATATGAGCATG
AAGCCTTATAAGTGTCCGTTTTGTGAGGAGGGTTTCCGAACTACAGTGCATTGTAAAAAGCACATGAAGAGACACCAAACAGTCCCCTCT
GCTGTGTCAGCCACTGGAGAGACAGAAGGAGGAGACATTTGTATGGAGGAAGAGGAAGAACATTCTGACAGAAATGCATCACGGAAGTCT
CGTCCTGAGGTCATCACTTTCACGGAGGAGGAGACAGCCCAGTTAGCCAAGATCCGGCCGCAGGAGAGCGCCACGGTGTCAGAGAAGGTC
CTGGTGCAGTCCGCGGCAGAAAAGGACCGCATCAGTGAGCTGAGGGACAAGCAGGCGGAGCTGCAGGACGAGCCCAAGCACGCCAACTGC
TGCACATACTGCCCCAAGAGCTTCAAGAAACCTAGCGACCTGGTGAGGCATGTTCGAATCCATACTGGAGAAAAGCCATACAAATGTGAT
GAATGTGGAAAGAGTTTTACTGTGAAATCCACTCTCGATTGTCATGTGAAGACTCACACAGGTCAGAAGCTCTTCAGCTGTCACGTCTGC
AGCAACGCCTTCTCCACGAAGGGAAGTCTGAAGGTCCACATGCGCCTGCACACGGGAGCCAAGCCCTTCAAATGCCCGCATTGCGAGCTG
CGTTTCCGTACCTCGGGTAGAAGAAAGACACACATGCAGTTTCATTATAAACCAGACCCAAAGAAGGCCAGAAAGCCTATGACTCGAAGC
TCATCGGAAGGACTGCAGCCTGTAAACCTCCTCAACTCCTCCTCTACTGACCCAAACGTGTTTATCATGAACAACTCTGTTCTAACAGGA
CAGTTTGATCAGAATCTGCTGCAACCAGGACTGGTGGGCCAAGCTATTCTCCCTGCCTCTGTGTCAGCTGGGGGTGACCTGACCGTGTCT
CTGACAGATGGGAGCCTGGCTACCCTAGAAGGCATCCAGTTACAGTTGGCTGCTAACTTGGTTGGACCAAATGTACAGATTTCTGGAATC
GATGCTGCCAGCATTAATAACATTACGTTGCAGATTGATCCAAGCATTCTGCAGCAGACGCTACAGCAGGGCAACCTATTGGCTCAGCAG
CTCACGGGGGAGCCTGGCCTGGCCCCACAGAACAGCTCTCTCCAGACATCGGACAGCACGGTCCCTGCCAGTGTTGTCATCCAGCCCATC
TCAGGCCTGTCCTTACAGCCCACAGTGACCTCTGCGAACCTGACCATAGGCCCGCTGTCTGAGCAGGATTCAGTGCTGACCACTAACAGC
AGTGGGACCCAAGACCTCACTCAAGTGATGACTTCGCAAGGTCTAGTGTCCCCCTCCGGCGGTCCCCACGAGATCACCCTGACCATTAAC
AACTCCAGCCTGAGCCAGGTCCTGGCACAGGCCGCTGGGCCCACTGCCACGTCTTCCTCGGGGTCTCCACAGGAAATTACCCTGACTATC
TCCGAACTTAACACTACAAGCGGAAGCCTTCCTTCAACAACACCGATGTCTCCATCGGCCATCTCGACTCAGAACCTGGTCATGTCCTCG
TCGGGCGTGGGAGGTGACGCTAGTGTCACGCTGACGCTGGCCGATACTCAGGGTATGCTATCTGGAGGCCTGGACACTGTCACACTCAAC
ATCACCTCTCAGGGTCAGCAGTTCCCAGCGCTCCTCACGGATCCCTCTCTCTCGGGCCAGGGTGGAGCAGGCTCGCCGCAAGTCATACTA
GTGAGCCACACGCCACAGTCAGCGTCTGCTGCTTGTGAAGAAATAGCCTACCAGTTTGGTGATTTAAATGCCGTGTCTCCTGGAAATCTG
GATAAAGATGAAGGCAGTGAAGTAGAAAGTGAAATGGATGAAGAACTGGATGACTCTTCAGAGCCTCAAGCCAAAAGAGAGAAAACAGAG
CTGAGCCAGGCATTTCCAGTGGGCTGCATGCAGCCTGTTCTCGAGACTGGCGTGCAACCAAGCCTCCTGAATCCAATTCACAGCGAGCAC

>In-frame_ZNF236_ENST00000253159_chr18_74659608_+_RFX3_ENST00000382004_chr9_3228889_-_5190nt
ATGGGCCTTTGTGGGCTGCTGGAGAGATGTTGGCTGCACCATGACCCAGATGGAGTTTTAACATTGAATGCGGAGAACACTAATTATGCC
TATCAAGTTCCAAACTTCCATAAATGTGAAATCTGTCTACTATCTTTTCCAAAAGAATCCCAGTTTCAACGCCACATGAGGGATCACGAG
CGAAATGACAAGCCACATCGATGTGACCAGTGCCCCCAAACATTTAATGTTGAATTCAACCTGACACTTCATAAATGCACCCACAGCGGG
GAAGATCCTACCTGCCCTGTGTGTAACAAGAAATTCTCCAGAGTGGCTAGTCTCAAAGCGCATATTATGCTACATGAAAAGGAAGAGAAT
CTCATCTGTTCTGAGTGTGGGGATGAGTTTACTCTGCAGAGTCAGCTGGCCGTGCACATGGAGGAGCACCGCCAGGAGCTGGCTGGAACC
CGGCAGCATGCCTGCAAGGCCTGCAAGAAAGAGTTCGAGACCTCCTCGGAGCTGAAGGAACACATGAAGACTCATTACAAAATTAGGGTA
TCAAGTACAAGGTCTTATAACCGGAATATCGACAGAAGTGGATTCACGTATTCGTGTCCGCACTGTGGAAAGACGTTTCAAAAGCCAAGC
CAGTTAACGCGACACATTAGGATACACACAGGTGAAAGGCCGTTCAAATGTAGTGAATGTGGAAAGGCTTTTAACCAGAAGGGGGCACTG
CAGACCCACATGATCAAGCACACAGGTGAAAAACCCCATGCCTGTGCCTTCTGTCCTGCCGCCTTCTCTCAGAAAGGGAATCTTCAGTCG
CACGTGCAGCGAGTCCACTCAGAGGTCAAGAATGGTCCTACCTATAACTGTACAGAATGTAGTTGTGTATTTAAAAGTTTAGGCAGCTTA
AACACGCATATCAGCAAGATGCATATGGGTGGGCCACAGAATTCAACAAGTTCTACAGAGACTGCTCATGTTTTAACGGCCACACTTTTT
CAGACGTTACCTCTTCAACAGACGGAAGCCCAAGCCACGTCGGCCTCAAGCCAGCCGAGCTCCCAGGCGGTGAGCGACGTCATCCAGCAG
CTCCTGGAGCTCTCAGAGCCGGCGCCGGTGGAGTCGGGGCAGTCCCCGCAGCCTGGGCAGCAGCTGAGCATCACAGTGGGCATCAACCAG
GACATTTTACAGCAAGCCTTAGAAAACAGTGGGCTGTCTTCAATTCCAGCTGCAGCACATCCTAATGACTCCTGCCATGCCAAGACCTCT
GCACCACACGCTCAAAACCCAGATGTTTCCAGCGTTTCAAATGAGCAGACGGACCCCACAGACGCAGAGCAAGAAAAAGAACAGGAAAGC
CCGGAGAAACTGGATAAAAAAGAAAAAAAAATGATAAAGAAGAAGTCACCGTTTCTACCTGGCTCCATCCGCGAGGAGAACGGCGTGCGC
TGGCATGTGTGTCCCTACTGCGCCAAGGAGTTCCGCAAGCCCAGCGACCTGGTCCGCCACATCCGCATCCACACCCACGAGAAGCCCTTC
AAGTGCCCGCAGTGCTTCCGCGCCTTCGCCGTGAAGAGCACGCTGACAGCGCACATCAAGACGCACACCGGCATCAAGGCGTTCAAGTGC
CAGTACTGCATGAAGAGCTTCTCCACCTCTGGCAGCCTCAAGGTGCACATTCGCCTGCACACAGGAGTTAGACCTTTTGCTTGTCCTCAC
TGTGACAAAAAATTTCGAACCTCAGGCCATAGGAAGACTCACATTGCTTCCCACTTTAAACATACGGAATTAAGGAAAATGAGGCACCAG
CGTAAACCTGCAAAGGTCCGTGTTGGCAAGACGAATATTCCAGTCCCTGATATTCCTTTGCAGGAACCAATCCTCATAACTGACTTAGGT
CTCATCCAGCCCATTCCAAAAAACCAGTTTTTCCAAAGCTATTTCAATAATAATTTTGTCAATGAAGCAGATAGACCATACAAGTGTTTT
TACTGTCATCGTGCATATAAAAAATCTTGCCACCTTAAACAACACATCAGATCCCATACAGGTGAAAAACCTTTTAAATGTTCTCAGTGT
GGAAGAGGCTTTGTTTCTGCAGGCGTGCTCAAAGCACACATCAGAACACACACAGGACTGAAATCTTTCAAGTGTCTGATATGTAATGGG
GCTTTCACTACTGGTGGCAGCTTACGGCGACACATGGGTATCCACAACGACCTTCGTCCCTATATGTGTCCCTATTGCCAAAAAACATTT
AAGACTTCACTAAATTGCAAAAAGCACATGAAAACCCACAGATATGAGCTTGCCCAGCAGCTCCAACAGCATCAGCAGGCAGCCTCGATA
GATGACAGCACTGTAGACCAGCAGAGCATGCAGGCCTCCACTCAAATGCAGGTGGAGATCGAGAGCGACGAGCTGCCGCAGACGGCAGAG
GTGGTCGCAGCGAACCCCGAGGCCATGCTGGACCTGGAGCCTCAGCATGTGGTGGGCACGGAGGAAGCAGGGCTGGGCCAGCAGTTGGCA
GATCAGCCCCTGGAAGCAGATGAAGATGGGTTTGTGGCTCCACAGGACCCTCTGCGAGGGCACGTAGACCAGTTTGAAGAGCAGAGCCCT
GCGCAACAGTCCTTCGAACCAGCAGGGCTACCCCAAGGTTTTACAGTGACTGATACGTACCATCAGCAGCCTCAGTTTCCACCTGTCCAA
CAGCTACAGGATTCCAGCACACTTGAGTCTCAGGCCCTCTCCACAAGCTTCCACCAGCAGAGCTTGCTGCAGGCTCCCAGCTCTGATGGG
ATGAATGTAACAACTCGCTTGATTCAGGAGTCATCCCAAGAGGAACTGGACCTGCAGGCACAAGGTTCCCAGTTTCTGGAGGACAACGAG
GACCAGAGCAGGCGCTCTTACAGGTGTGACTATTGCAACAAAGGCTTTAAGAAGTCCAGCCACCTGAAGCAGCATGTGCGGTCGCACACC
GGGGAAAAGCCCTACAAGTGCAAGCTCTGTGGACGCGGCTTTGTTTCCTCTGGGGTCCTCAAGTCCCACGAGAAGACACACACAGGAGTG
AAGGCGTTCAGCTGCAGTGTGTGCAATGCTTCCTTCACCACCAATGGCAGCCTCACCCGGCACATGGCCACACATATGAGCATGAAGCCT
TATAAGTGTCCGTTTTGTGAGGAGGGTTTCCGAACTACAGTGCATTGTAAAAAGCACATGAAGAGACACCAAACAGTCCCCTCTGCTGTG
TCAGCCACTGGAGAGACAGAAGGAGGAGACATTTGTATGGAGGAAGAGGAAGAACATTCTGACAGAAATGCATCACGGAAGTCTCGTCCT
GAGGTCATCACTTTCACGGAGGAGGAGACAGCCCAGTTAGCCAAGATCCGGCCGCAGGAGAGCGCCACGGTGTCAGAGAAGGTCCTGGTG
CAGTCCGCGGCAGAAAAGGACCGCATCAGTGAGCTGAGGGACAAGCAGGCGGAGCTGCAGGACGAGCCCAAGCACGCCAACTGCTGCACA
TACTGCCCCAAGAGCTTCAAGAAACCTAGCGACCTGGTGAGGCATGTTCGAATCCATACTGGAGAAAAGCCATACAAATGTGATGAATGT
GGAAAGAGTTTTACTGTGAAATCCACTCTCGATTGTCATGTGAAGACTCACACAGGTCAGAAGCTCTTCAGCTGTCACGTCTGCAGCAAC
GCCTTCTCCACGAAGGGAAGTCTGAAGGTCCACATGCGCCTGCACACGGGAGCCAAGCCCTTCAAATGCCCGCATTGCGAGCTGCGTTTC
CGTACCTCGGGTAGAAGAAAGACACACATGCAGTTTCATTATAAACCAGACCCAAAGAAGGCCAGAAAGCCTATGACTCGAAGCTCATCG
GAAGGACTGCAGCCTGTAAACCTCCTCAACTCCTCCTCTACTGACCCAAACGTGTTTATCATGAACAACTCTGTTCTAACAGGACAGTTT
GATCAGAATCTGCTGCAACCAGGACTGGTGGGCCAAGCTATTCTCCCTGCCTCTGTGTCAGCTGGGGGTGACCTGACCGTGTCTCTGACA
GATGGGAGCCTGGCTACCCTAGAAGGCATCCAGTTACAGTTGGCTGCTAACTTGGTTGGACCAAATGTACAGATTTCTGGAATCGATGCT
GCCAGCATTAATAACATTACGTTGCAGATTGATCCAAGCATTCTGCAGCAGACGCTACAGCAGGGCAACCTATTGGCTCAGCAGCTCACG
GGGGAGCCTGGCCTGGCCCCACAGAACAGCTCTCTCCAGACATCGGACAGCACGGTCCCTGCCAGTGTTGTCATCCAGCCCATCTCAGGC
CTGTCCTTACAGCCCACAGTGACCTCTGCGAACCTGACCATAGGCCCGCTGTCTGAGCAGGATTCAGTGCTGACCACTAACAGCAGTGGG
ACCCAAGACCTCACTCAAGTGATGACTTCGCAAGGTCTAGTGTCCCCCTCCGGCGGTCCCCACGAGATCACCCTGACCATTAACAACTCC
AGCCTGAGCCAGGTCCTGGCACAGGCCGCTGGGCCCACTGCCACGTCTTCCTCGGGGTCTCCACAGGAAATTACCCTGACTATCTCCGAA
CTTAACACTACAAGCGGAAGCCTTCCTTCAACAACACCGATGTCTCCATCGGCCATCTCGACTCAGAACCTGGTCATGTCCTCGTCGGGC
GTGGGAGGTGACGCTAGTGTCACGCTGACGCTGGCCGATACTCAGGGTATGCTATCTGGAGGCCTGGACACTGTCACACTCAACATCACC
TCTCAGGGTCAGCAGTTCCCAGCGCTCCTCACGGATCCCTCTCTCTCGGGCCAGGGTGGAGCAGGCTCGCCGCAAGTCATACTAGTGAGC
CACACGCCACAGTCAGCGTCTGCTGCTTGTGAAGAAATAGCCTACCAGTTTGGTGATTTAAATGCCGTGTCTCCTGGAAATCTGGATAAA
GATGAAGGCAGTGAAGTAGAAAGTGAAATGGATGAAGAACTGGATGACTCTTCAGAGCCTCAAGCCAAAAGAGAGAAAACAGAGCTGAGC
CAGGCATTTCCAGTGGGCTGCATGCAGCCTGTTCTCGAGACTGGCGTGCAACCAAGCCTCCTGAATCCAATTCACAGCGAGCACATTGTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZNF236_ENST00000320610_chr18_74659608_+_RFX3_ENST00000382004_chr9_3228889_-_11942nt
GATGCCGCGGGGCCGCCCCCCGAAGCCCAGGGAGAGCAAGGCGCGCGGCGACTCCGATGGAGTTTTAACATTGAATGCGGAGAACACTAA
TTATGCCTATCAAGTTCCAAACTTCCATAAATGTGAAATCTGTCTACTATCTTTTCCAAAAGAATCCCAGTTTCAACGCCACATGAGGGA
TCACGAGCGAAATGACAAGCCACATCGATGTGACCAGTGCCCCCAAACATTTAATGTTGAATTCAACCTGACACTTCATAAATGCACCCA
CAGCGGGGAAGATCCTACCTGCCCTGTGTGTAACAAGAAATTCTCCAGAGTGGCTAGTCTCAAAGCGCATATTATGCTACATGAAAAGGA
AGAGAATCTCATCTGTTCTGAGTGTGGGGATGAGTTTACTCTGCAGAGTCAGCTGGCCGTGCACATGGAGGAGCACCGCCAGGAGCTGGC
TGGAACCCGGCAGCATGCCTGCAAGGCCTGCAAGAAAGAGTTCGAGACCTCCTCGGAGCTGAAGGAACACATGAAGACTCATTACAAAAT
TAGGGTATCAAGTACAAGGTCTTATAACCGGAATATCGACAGAAGTGGATTCACGTATTCGTGTCCGCACTGTGGAAAGACGTTTCAAAA
GCCAAGCCAGTTAACGCGACACATTAGGATACACACAGGTGAAAGGCCGTTCAAATGTAGTGAATGTGGAAAGGCTTTTAACCAGAAGGG
GGCACTGCAGACCCACATGATCAAGCACACAGGTGAAAAACCCCATGCCTGTGCCTTCTGTCCTGCCGCCTTCTCTCAGAAAGGGAATCT
TCAGTCGCACGTGCAGCGAGTCCACTCAGAGGTCAAGAATGGTCCTACCTATAACTGTACAGAATGTAGTTGTGTATTTAAAAGTTTAGG
CAGCTTAAACACGCATATCAGCAAGATGCATATGGGTGGGCCACAGAATTCAACAAGTTCTACAGAGACTGCTCATGTTTTAACGGCCAC
ACTTTTTCAGACGTTACCTCTTCAACAGACGGAAGCCCAAGCCACGTCGGCCTCAAGCCAGCCGAGCTCCCAGGCGGTGAGCGACGTCAT
CCAGCAGCTCCTGGAGCTCTCAGAGCCGGCGCCGGTGGAGTCGGGGCAGTCCCCGCAGCCTGGGCAGCAGCTGAGCATCACAGTGGGCAT
CAACCAGGACATTTTACAGCAAGCCTTAGAAAACAGTGGGCTGTCTTCAATTCCAGCTGCAGCACATCCTAATGACTCCTGCCATGCCAA
GACCTCTGCACCACACGCTCAAAACCCAGATGTTTCCAGCGTTTCAAATGAGCAGACGGACCCCACAGACGCAGAGCAAGAAAAAGAACA
GGAAAGCCCGGAGAAACTGGATAAAAAAGAAAAAAAAATGATAAAGAAGAAGTCACCGTTTCTACCTGGCTCCATCCGCGAGGAGAACGG
CGTGCGCTGGCATGTGTGTCCCTACTGCGCCAAGGAGTTCCGCAAGCCCAGCGACCTGGTCCGCCACATCCGCATCCACACCCACGAGAA
GCCCTTCAAGTGCCCGCAGTGCTTCCGCGCCTTCGCCGTGAAGAGCACGCTGACAGCGCACATCAAGACGCACACCGGCATCAAGGCGTT
CAAGTGCCAGTACTGCATGAAGAGCTTCTCCACCTCTGGCAGCCTCAAGGTGCACATTCGCCTGCACACAGGAGTTAGACCTTTTGCTTG
TCCTCACTGTGACAAAAAATTTCGAACCTCAGGCCATAGGAAGACTCACATTGCTTCCCACTTTAAACATACGGAATTAAGGAAAATGAG
GCACCAGCGTAAACCTGCAAAGGTCCGTGTTGGCAAGACGAATATTCCAGTCCCTGATATTCCTTTGCAGGAACCAATCCTCATAACTGA
CTTAGGTCTCATCCAGCCCATTCCAAAAAACCAGTTTTTCCAAAGCTATTTCAATAATAATTTTGTCAATGAAGCAGATAGACCATACAA
GTGTTTTTACTGTCATCGTGCATATAAAAAATCTTGCCACCTTAAACAACACATCAGATCCCATACAGGTGAAAAACCTTTTAAATGTTC
TCAGTGTGGAAGAGGCTTTGTTTCTGCAGGCGTGCTCAAAGCACACATCAGAACACACACAGGACTGAAATCTTTCAAGTGTCTGATATG
TAATGGGGCTTTCACTACTGGTGGCAGCTTACGGCGACACATGGGTATCCACAACGACCTTCGTCCCTATATGTGTCCCTATTGCCAAAA
AACATTTAAGACTTCACTAAATTGCAAAAAGCACATGAAAACCCACAGATATGAGCTTGCCCAGCAGCTCCAACAGCATCAGCAGGCAGC
CTCGATAGATGACAGCACTGTAGACCAGCAGAGCATGCAGGCCTCCACTCAAATGCAGGTGGAGATCGAGAGCGACGAGCTGCCGCAGAC
GGCAGAGGTGGTCGCAGCGAACCCCGAGGCCATGCTGGACCTGGAGCCTCAGCATGTGGTGGGCACGGAGGAAGCAGGGCTGGGCCAGCA
GTTGGCAGATCAGCCCCTGGAAGCAGATGAAGATGGGTTTGTGGCTCCACAGGACCCTCTGCGAGGGCACGTAGACCAGTTTGAAGAGCA
GAGCCCTGCGCAACAGTCCTTCGAACCAGCAGGGCTACCCCAAGGTTTTACAGTGACTGATACGTACCATCAGCAGCCTCAGTTTCCACC
TGTCCAACAGCTACAGGATTCCAGCACACTTGAGTCTCAGGCCCTCTCCACAAGCTTCCACCAGCAGAGCTTGCTGCAGGCTCCCAGCTC
TGATGGGATGAATGTAACAACTCGCTTGATTCAGGAGTCATCCCAAGAGGAACTGGACCTGCAGGCACAAGGTTCCCAGTTTCTGGAGGA
CAACGAGGACCAGAGCAGGCGCTCTTACAGGTGTGACTATTGCAACAAAGGCTTTAAGAAGTCCAGCCACCTGAAGCAGCATGTGCGGTC
GCACACCGGGGAAAAGCCCTACAAGTGCAAGCTCTGTGGACGCGGCTTTGTTTCCTCTGGGGTCCTCAAGTCCCACGAGAAGACACACAC
AGGAGTGAAGGCGTTCAGCTGCAGTGTGTGCAATGCTTCCTTCACCACCAATGGCAGCCTCACCCGGCACATGGCCACACATATGAGCAT
GAAGCCTTATAAGTGTCCGTTTTGTGAGGAGGGTTTCCGAACTACAGTGCATTGTAAAAAGCACATGAAGAGACACCAAACAGTCCCCTC
TGCTGTGTCAGCCACTGGAGAGACAGAAGGAGGAGACATTTGTATGGAGGAAGAGGAAGAACATTCTGACAGAAATGCATCACGGAAGTC
TCGTCCTGAGGTCATCACTTTCACGGAGGAGGAGACAGCCCAGTTAGCCAAGATCCGGCCGCAGGAGAGCGCCACGGTGTCAGAGAAGGT
CCTGGTGCAGTCCGCGGCAGAAAAGGACCGCATCAGTGAGCTGAGGGACAAGCAGGCGGAGCTGCAGGACGAGCCCAAGCACGCCAACTG
CTGCACATACTGCCCCAAGAGCTTCAAGAAACCTAGCGACCTGGTGAGGCATGTTCGAATCCATACTGGAGAAAAGCCATACAAATGTGA
TGAATGTGGAAAGAGTTTTACTGTGAAATCCACTCTCGATTGTCATGTGAAGACTCACACAGGTCAGAAGCTCTTCAGCTGTCACGTCTG
CAGCAACGCCTTCTCCACGAAGGGAAGTCTGAAGGTCCACATGCGCCTGCACACGGGAGCCAAGCCCTTCAAATGCCCGCATTGCGAGCT
GCGTTTCCGTACCTCGGGTAGAAGAAAGACACACATGCAGTTTCATTATAAACCAGACCCAAAGAAGGCCAGAAAGCCTATGACTCGAAG
CTCATCGGAAGGACTGCAGCCTGTAAACCTCCTCAACTCCTCCTCTACTGACCCAAACGTGTTTATCATGAACAACTCTGTTCTAACAGG
ACAGTTTGATCAGAATCTGCTGCAACCAGGACTGGTGGGCCAAGCTATTCTCCCTGCCTCTGTGTCAGCTGGGGGTGACCTGACCGTGTC
TCTGACAGATGGGAGCCTGGCTACCCTAGAAGGCATCCAGTTACAGTTGGCTGCTAACTTGGTTGGACCAAATGTACAGATTTCTGGAAT
CGATGCTGCCAGCATTAATAACATTACGTTGCAGATTGATCCAAGCATTCTGCAGCAGACGCTACAGCAGGGCAACCTATTGGCTCAGCA
GCTCACGGGGGAGCCTGGCCTGGCCCCACAGAACAGCTCTCTCCAGACATCGGACAGCACGGTCCCTGCCAGTGTTGTCATCCAGCCCAT
CTCAGGCCTGTCCTTACAGCCCACAGTGACCTCTGCGAACCTGACCATAGGCCCGCTGTCTGAGCAGGATTCAGTGCTGACCACTAACAG
CAGTGGGACCCAAGACCTCACTCAAGTGATGACTTCGCAAGGTCTAGTGTCCCCCTCCGGCGGTCCCCACGAGATCACCCTGACCATTAA
CAACTCCAGCCTGAGCCAGGTCCTGGCACAGGCCGCTGGGCCCACTGCCACGTCTTCCTCGGGGTCTCCACAGGAAATTACCCTGACTAT
CTCCGAACTTAACACTACAAGCGGAAGCCTTCCTTCAACAACACCGATGTCTCCATCGGCCATCTCGACTCAGAACCTGGTCATGTCCTC
GTCGGGCGTGGGAGGTGACGCTAGTGTCACGCTGACGCTGGCCGATACTCAGGGTATGCTATCTGGAGGCCTGGACACTGTCACACTCAA
CATCACCTCTCAGGGTCAGCAGTTCCCAGCGCTCCTCACGGATCCCTCTCTCTCGGGCCAGGGTGGAGCAGGCTCGCCGCAAGTCATACT
AGTGAGCCACACGCCACAGTCAGCGTCTGCTGCTTGTGAAGAAATAGCCTACCAGTTTGGTGATTTAAATGCCGTGTCTCCTGGAAATCT
GGATAAAGATGAAGGCAGTGAAGTAGAAAGTGAAATGGATGAAGAACTGGATGACTCTTCAGAGCCTCAAGCCAAAAGAGAGAAAACAGA
GCTGAGCCAGGCATTTCCAGTGGGCTGCATGCAGCCTGTTCTCGAGACTGGCGTGCAACCAAGCCTCCTGAATCCAATTCACAGCGAGCA
CATTGTCACAAGTACTCAGACTATCAGACAGTGCAGCGCTACAGGAAATACCTACACTGCAGTCTAAAGAATATTAAAGCGTATTTTTCC
AGCTTACATTAACCCTGTTGATATTGGGCTTAAGTTGAAAATTTAATAAGCCTGAAGGTCGACTGTTGTCAAATTCTATCTGTGCTGAAC
ATTAACTTTTTGGAGTTGTGAAATGGAATGGGTGTATGTATTTTGCCAGATCTTTTTTTTTAACGTAAACAAATTATTTGCTTCTTAATA
ATGAATTTTTTCCCTTAGTTTCAGGTGTCAAGAAGGATTTTTACAACACTTAATGTCAATGTTTTGTTTTCTTATAATTAAAAAGTAATT
TACATTTTTTGTAGCTTAAAATATTTTATTGTTGATTGTTAGTCTTGGTGTATGATTTCATGTGTAAGTTTTTTAATTAGATGCACTTCT
GTGAAATATCAAAAGAAATGATTTTTTTGATTTACACTGGAGGCATGCCCATTTGGCAGCAGATGCATCAAATTTGCTTTTGAAAGGTGC
TTTTCATTGGACAGAACCATAAGACACTATTTTGATAACATTTTGAGTATGGAGAGAGAATACAGAGCATTTTTATTATAGTGCTAGAGG
GTTTGGAAGGTCATCTATTTTTCTCTGAGGAAAAAATGAGCTGTACATTTATCAGTTCAGAGTAAATGACAGAATTGCAAGAGATTATGC
TAATATGTACATAATTTGTGTACATAATTATTAAACCATGTTAACAATGCAAGCTTCCGTTAAACATTGAATTTTAACTATTATTTGCAT
ACCAATTCCTCTGTTTAAAGACTACTGATTCTGTATTTGGGACCACTGCACAGATGCATTCTGCTGTTAAGTGGGGGCTGTTATAGTTAG
ATACTGAAGCAGAAAAAAAAGACTTGACTTTTTTTTTTTAAGTGTACATGCTACTTATGCTGAGCTGGACATACAGGAAACCATTCCATT
TGGATGACTTTCTTTTATTCCAGGTCTTTTTCCTAATAGTAGTTCAATATGCTGCTATTATAAACGAGAATTTATAGAATGCAAGGAATG
TAGCAACCTACATAACGTTATTTCCTTCAAAACTATTTCCTGGTTTCTAAAGTATGTGGATTTAAATTGTAAACAGAACCTGAAGGCAGT
GTAACTGGCACACCTCACTGTTACTTATCCCCAATTCTGTAGGATTTGGATAGGTGGCTGGATGGACCATTGCCATTGAAGAATGTACAT
CAGGGATCATCGTACCTCGGCTATTACATGGTGCCTTAAAACAGAACTGAAGCTAAGGTTTAGTAAGGTTTATTTTGTTCATGTGACTAA
CTCTTCAATCCATTTGACAAAGTGTGCCTGTCATTTTCAGATTCCTGAAGTAAGGACAGGTGACATGTTCTTCAAAGGAAATTTAGGGAA
AACAAAGGAAAACAAAAAGACAAAAATCAGTTTCCCTCTTTGAGTGACCGTGGATCTATTTTTTATTCTTAGAGCTGAATATTACTTGAT
TACAAATCAGATTGCTTAAGGGTGTGGAATAGCAGGCTAGTTTTAATACCAACTTGTTAACATAAAATCATATATGTTTTAGACCATTCT
TATTTAGTTACAATTTTAGAAAGTTAACAAAGTAAGCAGGTACTTATCGAAGTGCATCTTTTCAGTCTAAATGTTTGTCTGTGTGTCTAG
GTGCTGGTGAGTCCACATGGACACATGAGTGCCCATGGGGCAGGAGTCTGCTATAAAGTCAGAAGGTGAGATCCTAGAGAGTTACACCCA
GCCCCATTTTAATTTGCATGAAAAGCCAAGGTTCTTTTAAGCACTCAAATTATTTAATGATTAAAACACAAGAAAGGCACATCTGTTCAT
TTAAATAGTTGTAAAAAACTAATCAGCAAAAATAAATAGATAATAAAGCCAAAAAAAAGGAAAGCACAAAATGATTGACAGATTATCAAA
TGAGGCCTATATTAAACCCAAGATGTTTATCTTTCCAGTGGTATTGGGGTAAGGGGGGTGGGGGGTTGGAAAGACGAGGTGAGCCAGTCT
GTAAAGTTAGAAATACCAAATGGCTTATCGGGTAATACACAGTGTATTTAAGCTGTTGTTGCTTAATTGCCTCAGACTACTCAAATAACA
TCAACAACATTTCTTAAGTAAAATTTAAATATTTTAGATGTAATTTTAAAAACTGATCCAAATTTTTTATTATACAACTCACTCATATAT
TTGAAAGTCTTCACTAGCATAGTAGCATCACCTTCATCTAAATGTCATTTAAATTACTGTCCCCCTTTTTCCTCCCAAAAAGACAATGGA
TTTGTACCAAAACACACACAAAAAAGGCAAACAAAACATGATAATCTGCAAAAGTTCATGTATCTACTTCATTGTGCATAGGAAGTGTTT
ACAGGTAAAATTAAAATCAAAAATTGAAAAAACACTCTTCATTTTGGCTCTCCTTTCTGAATTTTTTCAGTTTCCTGTCTCTACCCGCCA
TCCTTTGAGTGATACTATATCTGTATTGGACCAAATGTATTTACTGGTTTCATTTTGTTTATTGAATGACTTTAAATGTATTTATTATCA
TTGTTTAATTTAATGTTGGATATATTTGTATCATTACAGGAATCTGGTAATAATGGGCAAATTTAGATTGATGAGGCTTAGGGATCGGGG
ATGCTCCAGGATTCAACATTTCTTCCAATTGTTCATGGTTTGTTCTAAATTAGGACAGATTAAGAACTAATAAAACATTATTACATTTGA
ACTTGACTCAATAAAAATATTCTGATCTCCTTTATGAATATTAGGAATATTCTTTGTGATTAGTGTAAGTAGTTTGGATCAAAACATAAA
AAGAAGACCTATGGTTTATGCTACTTCTAGTTATTTGTAGTTCACAGTAAAACATGCACAGACATACACACAAACATTTTCATCAATTTC
GAATTTGAATTGTGAAAAATATATAAGAAAATAAAAACAATTTATACATTTGAGCAAATTGAGCAATCACATTTATTGCATTTATTTCCC
TTTTTCCCTTTTTTCACTCATTGAAAGTGTGGGTTTTCTAAATAATATTAGACACTAACACTCAACAGATTTATTCACAAATGACACAAG
TACACATTTTAAGACTTCTTTGTATTTCTTGCAATTATAACCAATCACTAGTCATGAAATATACCTACATAAACCAAGTCCTACACTTTC
AGTGAGGAAGAATGTAAGGAAGGTATGTTGACTGTTTTCAAGTTTCAGAAAAGATATTTTCATATGATAGGATTGAGTATCATGGGTATA
GTTTGATCTTGACATATAGTTTGAAAATCATACTCAAAAGATTTGCATTCATGAAACCAGTGAACAATAGGGTGGAATGGATGAACCATC
TCCTTGGAAGACAGGGCCCAATTTTCAATTTTTTCTTTGGCTATCAAGTTGCTAGTCACTTATTCAGGATTTTCATCCAAACTGTGTTTG
GACTGACTGTATAAGTCTTACTGCCTTTTCAGAAATCTGCTTTCCTTTGTGTGATTTTTCTTGTACTGTATAGCACGGTTTATGCACCTC
TCTTTAGATGGTGTACTTTAAAAACAAAAGTAAAATTTAGAAAATGGTTTTAACACTGCATACCTAAAATTAGTAGTGTGCAGCATTGAC
TGCCTTTGATTTGTAGTAGACAAGTAAAAATGAATACGTTCTTGTAGAATGCTGTAAAAGTTATTCAGGAATGAATACGGTTTTAGTGCC
GTAATCATGAATCTTTTTATATGAATGCACTGTCTAAAAGTGCTAAATGCATTTTCAAATTTTTAAAAATTCCTCAGATGATATATTTGA
AATGTCTAAAATAATGCTGTGCTTGAAACATTAGTGTAAAAGGAAAAAAAAAATAGTGTCACTGTGATGTTGGTCCTCCCTGTGTGGACA
CAAGTAGAAAGAAAAAACTTGGCAAGTCACCTTTGTGTACAATTTGAGGCAGTGGTTATATACAATAAATTGACCTTTATTATATCCCCC
AGACACACACATTCTTGGTGAGAAAAGAACAACCATCCAGAAATTGAGATGAGAACTTTTGTGATCTGTATGAATCACAGCAGATCATGG
GGGAGGAGGATTGGCATGCAGTGCTGTTGAAAATTGGGCTTGTTGTTAGATCAGAACAACCTCCATGTATATGGTTAGAACGAATCAATT
AATGGAATCCTAGTATTTCTGCAAGTTTGGTGATTTTTAAAAACTGGAATAGAAGCATTAATTCAGTGCTTAGTTCTAGTATTAGAAAAC
CCCTTTGATGTAATGCCTTGTATTAACCCTTTGAGCATTGTAAGATATACAATGGGGGACAAAAGCCTTTCAGATCATTTATTTAGACTT
AGACCGGTAAAGTATACTCTATATCCAAATGTCTAATTATGCTGTTTTTTTAAAGGGGGGGGTAGGAAGAGAAAGTGTTTCCACGCCGAA
CACTTGCATTTTATATACAACTCTTAATTTTTCTTCAAGAGGGCTTGATATATTTATTCCCAAATATTCACTGCCATCTAAGTAAGTGTA
CTGTTTACAGAAAAAAAAAATCAACTTTTCTAGTATCACACCATAGTCTCTAGAAAAGGAGGACAAATACATGGGCCTGGATAGACCTAT
GTCATAACTGATTTCTGCACATTGAAGGTACCTAGATTGCCTTTAAAAGGTATAAAGAAAGGGTTAAGTTTCTTTTTTTTTTGTCTTTTT
TTTCCCAAAATGAATCAAAAGATCTCATTTATTTAGCTTTAGAAAGTACAAGTGTAAGTAAAGCCTTAGGAAGAAAGGAGTTCGAGTGGA
TTAAGAGAATCTGAACTCTTTGGGGGCAGTTAGGCTATTTGGAGTTAGATCGCTCATAAAATATTGTTTGCGAATTTCACACAGGGCATA
ATTTTATCTATGCTCCAAAACTTTAATACGTTGTCAAAAAATTATATATAGATAGAATGGAGAGCAAAGCACTTGATTTTAAGCTCATCT
GTCAGGAGATGCTATGACTACTGCTTCTGATATCTCTAAATGTCAGTCTGCTTACACCATTGCTGATTTTGTTCAAGGGAATCTCTTCGT
GCACTTGATTCCCTCTGTTCCCTGCGTGATCGAACATGAAAGCAGTGTTGTCTGCAGATGTGCTTGCGCTGCCCTAGCTGGGTGCAAATA
AGAGTGTAACCTATTCTGATGTCTGGTGAAAGGACATCCATAGCATAGTGCAAGTATGCCGTAAACGTTGCTTTTTAGGCAGTTTAGGAA
GTCAGACCATGCAAATTACTCATGTGTTAACATGCAATACTCAAAGGGTTTTAATTTAACTCTCTTCTTTTGAATTCTTCATGATGATTT
ACTGTAAATGCTTCTCAGTTTGCATGCCTTGATCATTGCTGCTAGTGATTTTATGTGCCAGTAGACCTGAGTTTAGTTTACCAATTTTAC
TTAAATAGTAAAAGCCACTTACAAAGTGACTGCCTAGGATTTTTTTTTCCTTTCATTTGAAATAATTGATAATATGTTTTTTTAAAAAGA
AAAATGTGTTTTGTCTCTTCTTTTATTTGGTTCTGGTTTGATTCTTTTTCTCCCCTCTTTCCTTTGTTTTTTTTTTTTAAATAAATTATG
ATGTTGGGATTGGAAGCCCTGAGTAATGAAAATCTTTGGTAAGAATTGTTTATGTAGCTCAATAACGAGGACAACAAATATTCTTTAGAA
GAATTTTGATTCTGGGGAGGAAAGAAAATATAAAAACTCCCATTGACTGTTGATAACCAAGTAAATTTTTCCTTCAGTAAATTAGTATTT
TTGAAGAAACGATCGCCTTGTTTTAACTTGCTAAACAACAATTTTAAATGACCCAATAAAGAATCTATTGAACTTTATTCGTTTAAAAAG
CATCTTTTGTACCAAAGCAAATTTTTTTCTCTACTCATTTCCATCATCAATTTGGACCTATGGTGGTGACCAATGCATTGGTTACAGAAA
CTTTAAGTGAGTGCCTTGAGAAAACTTGGAAATTTGTGCCTGAGGTGGTAAACTTTTAATTAGGTTAATTGTAGTGCTTACCAATCAGTA
ACTTCACTATCACTCAGGGCTTTCGTACCTTCTAGGTAAAACTTCTTTCATTGTGTTTTTTTAAGATACTGTATTTTTTTTTAAGTGCCA
TCATTTAAATTTCACTTAGTAAGTGGCAGATTACATTATTCAGTCCCACAAGCACAGAAACATAGTAACACTAGGAGATATTTGAACATT
TATTTTACAATCGACTGAATATATTATGTAAATGAGGTAAGCAACTTTTGTAGAGATTGTATGTGTGAGATAATGTAATGTTCTTTTCCA
GTTTTTGGACTACAGTTGAATAAACTTTTTAATTATTTAAAAACATCTTTACCGAATAACATGTGATGGTTTTTTGTATAATGTATTTGA
TTTTGTAAATACGTATTTCCTGATGTGATTTTTGTGAGAAATGCTAAATCTTTTAGTATATCATGTCCTCTCAAAATTGGCAGGAGCTAA
ATAATAGTTTGTGGGCGATTTGTATTGTGTACTGTACAATAACTGGGGAACTTTTATAATTATAAAAATATATATTAACTTTTAGTGTGT
TGTTTAAACAAATGACTGGAACATACTAAAGATATTAGTAGGATTTTTCTGAATATTTCAGACTTGAACTCAGGCTAGCTTTCTTGTGTT

>In-frame_ZNF236_ENST00000253159_chr18_74659608_+_RFX3_ENST00000382004_chr9_3228889_-_12133nt
GCCTGGAAACTACAAAGGATTGTGTTAATTTTGTGTTTAGGAAGAAAGAGGTAATGGGTAGGAATCAATGTAAACTTATTCATAGGCCAC
ACCAAACCAGGAATTCTTGTCGTGATTGCACTTGGTAGAGTTAACACACGTGCACATTACGGAAACGTTGGTGACCAACAGGCGTTTCAG
CGAGCTTTCGCACACCTCATGGGCCTTTGTGGGCTGCTGGAGAGATGTTGGCTGCACCATGACCCAGATGGAGTTTTAACATTGAATGCG
GAGAACACTAATTATGCCTATCAAGTTCCAAACTTCCATAAATGTGAAATCTGTCTACTATCTTTTCCAAAAGAATCCCAGTTTCAACGC
CACATGAGGGATCACGAGCGAAATGACAAGCCACATCGATGTGACCAGTGCCCCCAAACATTTAATGTTGAATTCAACCTGACACTTCAT
AAATGCACCCACAGCGGGGAAGATCCTACCTGCCCTGTGTGTAACAAGAAATTCTCCAGAGTGGCTAGTCTCAAAGCGCATATTATGCTA
CATGAAAAGGAAGAGAATCTCATCTGTTCTGAGTGTGGGGATGAGTTTACTCTGCAGAGTCAGCTGGCCGTGCACATGGAGGAGCACCGC
CAGGAGCTGGCTGGAACCCGGCAGCATGCCTGCAAGGCCTGCAAGAAAGAGTTCGAGACCTCCTCGGAGCTGAAGGAACACATGAAGACT
CATTACAAAATTAGGGTATCAAGTACAAGGTCTTATAACCGGAATATCGACAGAAGTGGATTCACGTATTCGTGTCCGCACTGTGGAAAG
ACGTTTCAAAAGCCAAGCCAGTTAACGCGACACATTAGGATACACACAGGTGAAAGGCCGTTCAAATGTAGTGAATGTGGAAAGGCTTTT
AACCAGAAGGGGGCACTGCAGACCCACATGATCAAGCACACAGGTGAAAAACCCCATGCCTGTGCCTTCTGTCCTGCCGCCTTCTCTCAG
AAAGGGAATCTTCAGTCGCACGTGCAGCGAGTCCACTCAGAGGTCAAGAATGGTCCTACCTATAACTGTACAGAATGTAGTTGTGTATTT
AAAAGTTTAGGCAGCTTAAACACGCATATCAGCAAGATGCATATGGGTGGGCCACAGAATTCAACAAGTTCTACAGAGACTGCTCATGTT
TTAACGGCCACACTTTTTCAGACGTTACCTCTTCAACAGACGGAAGCCCAAGCCACGTCGGCCTCAAGCCAGCCGAGCTCCCAGGCGGTG
AGCGACGTCATCCAGCAGCTCCTGGAGCTCTCAGAGCCGGCGCCGGTGGAGTCGGGGCAGTCCCCGCAGCCTGGGCAGCAGCTGAGCATC
ACAGTGGGCATCAACCAGGACATTTTACAGCAAGCCTTAGAAAACAGTGGGCTGTCTTCAATTCCAGCTGCAGCACATCCTAATGACTCC
TGCCATGCCAAGACCTCTGCACCACACGCTCAAAACCCAGATGTTTCCAGCGTTTCAAATGAGCAGACGGACCCCACAGACGCAGAGCAA
GAAAAAGAACAGGAAAGCCCGGAGAAACTGGATAAAAAAGAAAAAAAAATGATAAAGAAGAAGTCACCGTTTCTACCTGGCTCCATCCGC
GAGGAGAACGGCGTGCGCTGGCATGTGTGTCCCTACTGCGCCAAGGAGTTCCGCAAGCCCAGCGACCTGGTCCGCCACATCCGCATCCAC
ACCCACGAGAAGCCCTTCAAGTGCCCGCAGTGCTTCCGCGCCTTCGCCGTGAAGAGCACGCTGACAGCGCACATCAAGACGCACACCGGC
ATCAAGGCGTTCAAGTGCCAGTACTGCATGAAGAGCTTCTCCACCTCTGGCAGCCTCAAGGTGCACATTCGCCTGCACACAGGAGTTAGA
CCTTTTGCTTGTCCTCACTGTGACAAAAAATTTCGAACCTCAGGCCATAGGAAGACTCACATTGCTTCCCACTTTAAACATACGGAATTA
AGGAAAATGAGGCACCAGCGTAAACCTGCAAAGGTCCGTGTTGGCAAGACGAATATTCCAGTCCCTGATATTCCTTTGCAGGAACCAATC
CTCATAACTGACTTAGGTCTCATCCAGCCCATTCCAAAAAACCAGTTTTTCCAAAGCTATTTCAATAATAATTTTGTCAATGAAGCAGAT
AGACCATACAAGTGTTTTTACTGTCATCGTGCATATAAAAAATCTTGCCACCTTAAACAACACATCAGATCCCATACAGGTGAAAAACCT
TTTAAATGTTCTCAGTGTGGAAGAGGCTTTGTTTCTGCAGGCGTGCTCAAAGCACACATCAGAACACACACAGGACTGAAATCTTTCAAG
TGTCTGATATGTAATGGGGCTTTCACTACTGGTGGCAGCTTACGGCGACACATGGGTATCCACAACGACCTTCGTCCCTATATGTGTCCC
TATTGCCAAAAAACATTTAAGACTTCACTAAATTGCAAAAAGCACATGAAAACCCACAGATATGAGCTTGCCCAGCAGCTCCAACAGCAT
CAGCAGGCAGCCTCGATAGATGACAGCACTGTAGACCAGCAGAGCATGCAGGCCTCCACTCAAATGCAGGTGGAGATCGAGAGCGACGAG
CTGCCGCAGACGGCAGAGGTGGTCGCAGCGAACCCCGAGGCCATGCTGGACCTGGAGCCTCAGCATGTGGTGGGCACGGAGGAAGCAGGG
CTGGGCCAGCAGTTGGCAGATCAGCCCCTGGAAGCAGATGAAGATGGGTTTGTGGCTCCACAGGACCCTCTGCGAGGGCACGTAGACCAG
TTTGAAGAGCAGAGCCCTGCGCAACAGTCCTTCGAACCAGCAGGGCTACCCCAAGGTTTTACAGTGACTGATACGTACCATCAGCAGCCT
CAGTTTCCACCTGTCCAACAGCTACAGGATTCCAGCACACTTGAGTCTCAGGCCCTCTCCACAAGCTTCCACCAGCAGAGCTTGCTGCAG
GCTCCCAGCTCTGATGGGATGAATGTAACAACTCGCTTGATTCAGGAGTCATCCCAAGAGGAACTGGACCTGCAGGCACAAGGTTCCCAG
TTTCTGGAGGACAACGAGGACCAGAGCAGGCGCTCTTACAGGTGTGACTATTGCAACAAAGGCTTTAAGAAGTCCAGCCACCTGAAGCAG
CATGTGCGGTCGCACACCGGGGAAAAGCCCTACAAGTGCAAGCTCTGTGGACGCGGCTTTGTTTCCTCTGGGGTCCTCAAGTCCCACGAG
AAGACACACACAGGAGTGAAGGCGTTCAGCTGCAGTGTGTGCAATGCTTCCTTCACCACCAATGGCAGCCTCACCCGGCACATGGCCACA
CATATGAGCATGAAGCCTTATAAGTGTCCGTTTTGTGAGGAGGGTTTCCGAACTACAGTGCATTGTAAAAAGCACATGAAGAGACACCAA
ACAGTCCCCTCTGCTGTGTCAGCCACTGGAGAGACAGAAGGAGGAGACATTTGTATGGAGGAAGAGGAAGAACATTCTGACAGAAATGCA
TCACGGAAGTCTCGTCCTGAGGTCATCACTTTCACGGAGGAGGAGACAGCCCAGTTAGCCAAGATCCGGCCGCAGGAGAGCGCCACGGTG
TCAGAGAAGGTCCTGGTGCAGTCCGCGGCAGAAAAGGACCGCATCAGTGAGCTGAGGGACAAGCAGGCGGAGCTGCAGGACGAGCCCAAG
CACGCCAACTGCTGCACATACTGCCCCAAGAGCTTCAAGAAACCTAGCGACCTGGTGAGGCATGTTCGAATCCATACTGGAGAAAAGCCA
TACAAATGTGATGAATGTGGAAAGAGTTTTACTGTGAAATCCACTCTCGATTGTCATGTGAAGACTCACACAGGTCAGAAGCTCTTCAGC
TGTCACGTCTGCAGCAACGCCTTCTCCACGAAGGGAAGTCTGAAGGTCCACATGCGCCTGCACACGGGAGCCAAGCCCTTCAAATGCCCG
CATTGCGAGCTGCGTTTCCGTACCTCGGGTAGAAGAAAGACACACATGCAGTTTCATTATAAACCAGACCCAAAGAAGGCCAGAAAGCCT
ATGACTCGAAGCTCATCGGAAGGACTGCAGCCTGTAAACCTCCTCAACTCCTCCTCTACTGACCCAAACGTGTTTATCATGAACAACTCT
GTTCTAACAGGACAGTTTGATCAGAATCTGCTGCAACCAGGACTGGTGGGCCAAGCTATTCTCCCTGCCTCTGTGTCAGCTGGGGGTGAC
CTGACCGTGTCTCTGACAGATGGGAGCCTGGCTACCCTAGAAGGCATCCAGTTACAGTTGGCTGCTAACTTGGTTGGACCAAATGTACAG
ATTTCTGGAATCGATGCTGCCAGCATTAATAACATTACGTTGCAGATTGATCCAAGCATTCTGCAGCAGACGCTACAGCAGGGCAACCTA
TTGGCTCAGCAGCTCACGGGGGAGCCTGGCCTGGCCCCACAGAACAGCTCTCTCCAGACATCGGACAGCACGGTCCCTGCCAGTGTTGTC
ATCCAGCCCATCTCAGGCCTGTCCTTACAGCCCACAGTGACCTCTGCGAACCTGACCATAGGCCCGCTGTCTGAGCAGGATTCAGTGCTG
ACCACTAACAGCAGTGGGACCCAAGACCTCACTCAAGTGATGACTTCGCAAGGTCTAGTGTCCCCCTCCGGCGGTCCCCACGAGATCACC
CTGACCATTAACAACTCCAGCCTGAGCCAGGTCCTGGCACAGGCCGCTGGGCCCACTGCCACGTCTTCCTCGGGGTCTCCACAGGAAATT
ACCCTGACTATCTCCGAACTTAACACTACAAGCGGAAGCCTTCCTTCAACAACACCGATGTCTCCATCGGCCATCTCGACTCAGAACCTG
GTCATGTCCTCGTCGGGCGTGGGAGGTGACGCTAGTGTCACGCTGACGCTGGCCGATACTCAGGGTATGCTATCTGGAGGCCTGGACACT
GTCACACTCAACATCACCTCTCAGGGTCAGCAGTTCCCAGCGCTCCTCACGGATCCCTCTCTCTCGGGCCAGGGTGGAGCAGGCTCGCCG
CAAGTCATACTAGTGAGCCACACGCCACAGTCAGCGTCTGCTGCTTGTGAAGAAATAGCCTACCAGTTTGGTGATTTAAATGCCGTGTCT
CCTGGAAATCTGGATAAAGATGAAGGCAGTGAAGTAGAAAGTGAAATGGATGAAGAACTGGATGACTCTTCAGAGCCTCAAGCCAAAAGA
GAGAAAACAGAGCTGAGCCAGGCATTTCCAGTGGGCTGCATGCAGCCTGTTCTCGAGACTGGCGTGCAACCAAGCCTCCTGAATCCAATT
CACAGCGAGCACATTGTCACAAGTACTCAGACTATCAGACAGTGCAGCGCTACAGGAAATACCTACACTGCAGTCTAAAGAATATTAAAG
CGTATTTTTCCAGCTTACATTAACCCTGTTGATATTGGGCTTAAGTTGAAAATTTAATAAGCCTGAAGGTCGACTGTTGTCAAATTCTAT
CTGTGCTGAACATTAACTTTTTGGAGTTGTGAAATGGAATGGGTGTATGTATTTTGCCAGATCTTTTTTTTTAACGTAAACAAATTATTT
GCTTCTTAATAATGAATTTTTTCCCTTAGTTTCAGGTGTCAAGAAGGATTTTTACAACACTTAATGTCAATGTTTTGTTTTCTTATAATT
AAAAAGTAATTTACATTTTTTGTAGCTTAAAATATTTTATTGTTGATTGTTAGTCTTGGTGTATGATTTCATGTGTAAGTTTTTTAATTA
GATGCACTTCTGTGAAATATCAAAAGAAATGATTTTTTTGATTTACACTGGAGGCATGCCCATTTGGCAGCAGATGCATCAAATTTGCTT
TTGAAAGGTGCTTTTCATTGGACAGAACCATAAGACACTATTTTGATAACATTTTGAGTATGGAGAGAGAATACAGAGCATTTTTATTAT
AGTGCTAGAGGGTTTGGAAGGTCATCTATTTTTCTCTGAGGAAAAAATGAGCTGTACATTTATCAGTTCAGAGTAAATGACAGAATTGCA
AGAGATTATGCTAATATGTACATAATTTGTGTACATAATTATTAAACCATGTTAACAATGCAAGCTTCCGTTAAACATTGAATTTTAACT
ATTATTTGCATACCAATTCCTCTGTTTAAAGACTACTGATTCTGTATTTGGGACCACTGCACAGATGCATTCTGCTGTTAAGTGGGGGCT
GTTATAGTTAGATACTGAAGCAGAAAAAAAAGACTTGACTTTTTTTTTTTAAGTGTACATGCTACTTATGCTGAGCTGGACATACAGGAA
ACCATTCCATTTGGATGACTTTCTTTTATTCCAGGTCTTTTTCCTAATAGTAGTTCAATATGCTGCTATTATAAACGAGAATTTATAGAA
TGCAAGGAATGTAGCAACCTACATAACGTTATTTCCTTCAAAACTATTTCCTGGTTTCTAAAGTATGTGGATTTAAATTGTAAACAGAAC
CTGAAGGCAGTGTAACTGGCACACCTCACTGTTACTTATCCCCAATTCTGTAGGATTTGGATAGGTGGCTGGATGGACCATTGCCATTGA
AGAATGTACATCAGGGATCATCGTACCTCGGCTATTACATGGTGCCTTAAAACAGAACTGAAGCTAAGGTTTAGTAAGGTTTATTTTGTT
CATGTGACTAACTCTTCAATCCATTTGACAAAGTGTGCCTGTCATTTTCAGATTCCTGAAGTAAGGACAGGTGACATGTTCTTCAAAGGA
AATTTAGGGAAAACAAAGGAAAACAAAAAGACAAAAATCAGTTTCCCTCTTTGAGTGACCGTGGATCTATTTTTTATTCTTAGAGCTGAA
TATTACTTGATTACAAATCAGATTGCTTAAGGGTGTGGAATAGCAGGCTAGTTTTAATACCAACTTGTTAACATAAAATCATATATGTTT
TAGACCATTCTTATTTAGTTACAATTTTAGAAAGTTAACAAAGTAAGCAGGTACTTATCGAAGTGCATCTTTTCAGTCTAAATGTTTGTC
TGTGTGTCTAGGTGCTGGTGAGTCCACATGGACACATGAGTGCCCATGGGGCAGGAGTCTGCTATAAAGTCAGAAGGTGAGATCCTAGAG
AGTTACACCCAGCCCCATTTTAATTTGCATGAAAAGCCAAGGTTCTTTTAAGCACTCAAATTATTTAATGATTAAAACACAAGAAAGGCA
CATCTGTTCATTTAAATAGTTGTAAAAAACTAATCAGCAAAAATAAATAGATAATAAAGCCAAAAAAAAGGAAAGCACAAAATGATTGAC
AGATTATCAAATGAGGCCTATATTAAACCCAAGATGTTTATCTTTCCAGTGGTATTGGGGTAAGGGGGGTGGGGGGTTGGAAAGACGAGG
TGAGCCAGTCTGTAAAGTTAGAAATACCAAATGGCTTATCGGGTAATACACAGTGTATTTAAGCTGTTGTTGCTTAATTGCCTCAGACTA
CTCAAATAACATCAACAACATTTCTTAAGTAAAATTTAAATATTTTAGATGTAATTTTAAAAACTGATCCAAATTTTTTATTATACAACT
CACTCATATATTTGAAAGTCTTCACTAGCATAGTAGCATCACCTTCATCTAAATGTCATTTAAATTACTGTCCCCCTTTTTCCTCCCAAA
AAGACAATGGATTTGTACCAAAACACACACAAAAAAGGCAAACAAAACATGATAATCTGCAAAAGTTCATGTATCTACTTCATTGTGCAT
AGGAAGTGTTTACAGGTAAAATTAAAATCAAAAATTGAAAAAACACTCTTCATTTTGGCTCTCCTTTCTGAATTTTTTCAGTTTCCTGTC
TCTACCCGCCATCCTTTGAGTGATACTATATCTGTATTGGACCAAATGTATTTACTGGTTTCATTTTGTTTATTGAATGACTTTAAATGT
ATTTATTATCATTGTTTAATTTAATGTTGGATATATTTGTATCATTACAGGAATCTGGTAATAATGGGCAAATTTAGATTGATGAGGCTT
AGGGATCGGGGATGCTCCAGGATTCAACATTTCTTCCAATTGTTCATGGTTTGTTCTAAATTAGGACAGATTAAGAACTAATAAAACATT
ATTACATTTGAACTTGACTCAATAAAAATATTCTGATCTCCTTTATGAATATTAGGAATATTCTTTGTGATTAGTGTAAGTAGTTTGGAT
CAAAACATAAAAAGAAGACCTATGGTTTATGCTACTTCTAGTTATTTGTAGTTCACAGTAAAACATGCACAGACATACACACAAACATTT
TCATCAATTTCGAATTTGAATTGTGAAAAATATATAAGAAAATAAAAACAATTTATACATTTGAGCAAATTGAGCAATCACATTTATTGC
ATTTATTTCCCTTTTTCCCTTTTTTCACTCATTGAAAGTGTGGGTTTTCTAAATAATATTAGACACTAACACTCAACAGATTTATTCACA
AATGACACAAGTACACATTTTAAGACTTCTTTGTATTTCTTGCAATTATAACCAATCACTAGTCATGAAATATACCTACATAAACCAAGT
CCTACACTTTCAGTGAGGAAGAATGTAAGGAAGGTATGTTGACTGTTTTCAAGTTTCAGAAAAGATATTTTCATATGATAGGATTGAGTA
TCATGGGTATAGTTTGATCTTGACATATAGTTTGAAAATCATACTCAAAAGATTTGCATTCATGAAACCAGTGAACAATAGGGTGGAATG
GATGAACCATCTCCTTGGAAGACAGGGCCCAATTTTCAATTTTTTCTTTGGCTATCAAGTTGCTAGTCACTTATTCAGGATTTTCATCCA
AACTGTGTTTGGACTGACTGTATAAGTCTTACTGCCTTTTCAGAAATCTGCTTTCCTTTGTGTGATTTTTCTTGTACTGTATAGCACGGT
TTATGCACCTCTCTTTAGATGGTGTACTTTAAAAACAAAAGTAAAATTTAGAAAATGGTTTTAACACTGCATACCTAAAATTAGTAGTGT
GCAGCATTGACTGCCTTTGATTTGTAGTAGACAAGTAAAAATGAATACGTTCTTGTAGAATGCTGTAAAAGTTATTCAGGAATGAATACG
GTTTTAGTGCCGTAATCATGAATCTTTTTATATGAATGCACTGTCTAAAAGTGCTAAATGCATTTTCAAATTTTTAAAAATTCCTCAGAT
GATATATTTGAAATGTCTAAAATAATGCTGTGCTTGAAACATTAGTGTAAAAGGAAAAAAAAAATAGTGTCACTGTGATGTTGGTCCTCC
CTGTGTGGACACAAGTAGAAAGAAAAAACTTGGCAAGTCACCTTTGTGTACAATTTGAGGCAGTGGTTATATACAATAAATTGACCTTTA
TTATATCCCCCAGACACACACATTCTTGGTGAGAAAAGAACAACCATCCAGAAATTGAGATGAGAACTTTTGTGATCTGTATGAATCACA
GCAGATCATGGGGGAGGAGGATTGGCATGCAGTGCTGTTGAAAATTGGGCTTGTTGTTAGATCAGAACAACCTCCATGTATATGGTTAGA
ACGAATCAATTAATGGAATCCTAGTATTTCTGCAAGTTTGGTGATTTTTAAAAACTGGAATAGAAGCATTAATTCAGTGCTTAGTTCTAG
TATTAGAAAACCCCTTTGATGTAATGCCTTGTATTAACCCTTTGAGCATTGTAAGATATACAATGGGGGACAAAAGCCTTTCAGATCATT
TATTTAGACTTAGACCGGTAAAGTATACTCTATATCCAAATGTCTAATTATGCTGTTTTTTTAAAGGGGGGGGTAGGAAGAGAAAGTGTT
TCCACGCCGAACACTTGCATTTTATATACAACTCTTAATTTTTCTTCAAGAGGGCTTGATATATTTATTCCCAAATATTCACTGCCATCT
AAGTAAGTGTACTGTTTACAGAAAAAAAAAATCAACTTTTCTAGTATCACACCATAGTCTCTAGAAAAGGAGGACAAATACATGGGCCTG
GATAGACCTATGTCATAACTGATTTCTGCACATTGAAGGTACCTAGATTGCCTTTAAAAGGTATAAAGAAAGGGTTAAGTTTCTTTTTTT
TTTGTCTTTTTTTTCCCAAAATGAATCAAAAGATCTCATTTATTTAGCTTTAGAAAGTACAAGTGTAAGTAAAGCCTTAGGAAGAAAGGA
GTTCGAGTGGATTAAGAGAATCTGAACTCTTTGGGGGCAGTTAGGCTATTTGGAGTTAGATCGCTCATAAAATATTGTTTGCGAATTTCA
CACAGGGCATAATTTTATCTATGCTCCAAAACTTTAATACGTTGTCAAAAAATTATATATAGATAGAATGGAGAGCAAAGCACTTGATTT
TAAGCTCATCTGTCAGGAGATGCTATGACTACTGCTTCTGATATCTCTAAATGTCAGTCTGCTTACACCATTGCTGATTTTGTTCAAGGG
AATCTCTTCGTGCACTTGATTCCCTCTGTTCCCTGCGTGATCGAACATGAAAGCAGTGTTGTCTGCAGATGTGCTTGCGCTGCCCTAGCT
GGGTGCAAATAAGAGTGTAACCTATTCTGATGTCTGGTGAAAGGACATCCATAGCATAGTGCAAGTATGCCGTAAACGTTGCTTTTTAGG
CAGTTTAGGAAGTCAGACCATGCAAATTACTCATGTGTTAACATGCAATACTCAAAGGGTTTTAATTTAACTCTCTTCTTTTGAATTCTT
CATGATGATTTACTGTAAATGCTTCTCAGTTTGCATGCCTTGATCATTGCTGCTAGTGATTTTATGTGCCAGTAGACCTGAGTTTAGTTT
ACCAATTTTACTTAAATAGTAAAAGCCACTTACAAAGTGACTGCCTAGGATTTTTTTTTCCTTTCATTTGAAATAATTGATAATATGTTT
TTTTAAAAAGAAAAATGTGTTTTGTCTCTTCTTTTATTTGGTTCTGGTTTGATTCTTTTTCTCCCCTCTTTCCTTTGTTTTTTTTTTTTA
AATAAATTATGATGTTGGGATTGGAAGCCCTGAGTAATGAAAATCTTTGGTAAGAATTGTTTATGTAGCTCAATAACGAGGACAACAAAT
ATTCTTTAGAAGAATTTTGATTCTGGGGAGGAAAGAAAATATAAAAACTCCCATTGACTGTTGATAACCAAGTAAATTTTTCCTTCAGTA
AATTAGTATTTTTGAAGAAACGATCGCCTTGTTTTAACTTGCTAAACAACAATTTTAAATGACCCAATAAAGAATCTATTGAACTTTATT
CGTTTAAAAAGCATCTTTTGTACCAAAGCAAATTTTTTTCTCTACTCATTTCCATCATCAATTTGGACCTATGGTGGTGACCAATGCATT
GGTTACAGAAACTTTAAGTGAGTGCCTTGAGAAAACTTGGAAATTTGTGCCTGAGGTGGTAAACTTTTAATTAGGTTAATTGTAGTGCTT
ACCAATCAGTAACTTCACTATCACTCAGGGCTTTCGTACCTTCTAGGTAAAACTTCTTTCATTGTGTTTTTTTAAGATACTGTATTTTTT
TTTAAGTGCCATCATTTAAATTTCACTTAGTAAGTGGCAGATTACATTATTCAGTCCCACAAGCACAGAAACATAGTAACACTAGGAGAT
ATTTGAACATTTATTTTACAATCGACTGAATATATTATGTAAATGAGGTAAGCAACTTTTGTAGAGATTGTATGTGTGAGATAATGTAAT
GTTCTTTTCCAGTTTTTGGACTACAGTTGAATAAACTTTTTAATTATTTAAAAACATCTTTACCGAATAACATGTGATGGTTTTTTGTAT
AATGTATTTGATTTTGTAAATACGTATTTCCTGATGTGATTTTTGTGAGAAATGCTAAATCTTTTAGTATATCATGTCCTCTCAAAATTG
GCAGGAGCTAAATAATAGTTTGTGGGCGATTTGTATTGTGTACTGTACAATAACTGGGGAACTTTTATAATTATAAAAATATATATTAAC
TTTTAGTGTGTTGTTTAAACAAATGACTGGAACATACTAAAGATATTAGTAGGATTTTTCTGAATATTTCAGACTTGAACTCAGGCTAGC


Top

FusionGenePPI for ZNF236_RFX3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZNF236RFX3TRAF2, RFX6, RFX4, BIN1, CREB1, EWSR1, IRF6, PKNOX1, SOX2, FHL2, FHL3, TRIP6, SEC63, PABPC5, FOXJ1, FOXJ2, FOXN3, FAM188A, IGSF8, RFX1, HDAC1, XYLT2, RTCB, MTA2, PTOV1, DDX1, TBC1D32, VPS45, TAF6L, MBD2, CDK20, ACAD9, HDAC2, TMED4, CFAP20, PLK1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZNF236_RFX3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ZNF236_RFX3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneRFX3C0037274Dermatologic disorders1CTD_human
TgeneRFX3C0311375Arsenic Poisoning1CTD_human