FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 43113

FusionGeneSummary for ZNF236_QRSL1

check button Fusion gene summary
Fusion gene informationFusion gene name: ZNF236_QRSL1
Fusion gene ID: 43113
HgeneTgene
Gene symbol

ZNF236

QRSL1

Gene ID

7776

55278

Gene namezinc finger protein 236glutaminyl-tRNA synthase (glutamine-hydrolyzing)-like 1
SynonymsZNF236A|ZNF236BGatA
Cytomap

18q23

6q21

Type of geneprotein-codingprotein-coding
Descriptionzinc finger protein 236regulated by glucoseglutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrialglu-AdT subunit Aglutaminyl-tRNA synthase-like protein 1glutamyl-tRNA(Gln) amidotransferase subunit A homologglutamyl-tRNA(Gln) amidotransferase, subunit A
Modification date2018051920180519
UniProtAcc

Q9UL36

Q9H0R6

Ensembl transtripts involved in fusion geneENST00000320610, ENST00000253159, 
ENST00000583095, 
ENST00000369046, 
ENST00000467262, ENST00000369044, 
Fusion gene scores* DoF score4 X 4 X 3=488 X 5 X 5=200
# samples 513
** MAII scorelog2(5/48*10)=0.0588936890535686
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(13/200*10)=-0.62148837674627
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ZNF236 [Title/Abstract] AND QRSL1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneQRSL1

GO:0070681

glutaminyl-tRNAGln biosynthesis via transamidation

19805282


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-K1-A42X-02AZNF236chr18

74563895

+QRSL1chr6

107088224

+
TCGARVSARCTCGA-K1-A42X-01AZNF236chr18

74563895

+QRSL1chr6

107088224

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000320610ENST00000369046ZNF236chr18

74563895

+QRSL1chr6

107088224

+
5CDS-3UTRENST00000320610ENST00000467262ZNF236chr18

74563895

+QRSL1chr6

107088224

+
5CDS-3UTRENST00000320610ENST00000369044ZNF236chr18

74563895

+QRSL1chr6

107088224

+
In-frameENST00000253159ENST00000369046ZNF236chr18

74563895

+QRSL1chr6

107088224

+
5CDS-3UTRENST00000253159ENST00000467262ZNF236chr18

74563895

+QRSL1chr6

107088224

+
5CDS-3UTRENST00000253159ENST00000369044ZNF236chr18

74563895

+QRSL1chr6

107088224

+
3UTR-3CDSENST00000583095ENST00000369046ZNF236chr18

74563895

+QRSL1chr6

107088224

+
3UTR-3UTRENST00000583095ENST00000467262ZNF236chr18

74563895

+QRSL1chr6

107088224

+
3UTR-3UTRENST00000583095ENST00000369044ZNF236chr18

74563895

+QRSL1chr6

107088224

+

Top

FusionProtFeatures for ZNF236_QRSL1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZNF236

Q9UL36

QRSL1

Q9H0R6

May be involved in transcriptional regulation. Allows the formation of correctly charged Gln-tRNA(Gln)through the transamidation of misacylated Glu-tRNA(Gln) in themitochondria. The reaction takes place in the presence ofglutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_03150,ECO:0000269|PubMed:19805282}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+33137_591191846Zinc fingerC2H2-type 1
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+33166_881191846Zinc fingerC2H2-type 2
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+33193_1151191846Zinc fingerC2H2-type 3

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+3311023_10451191846Zinc fingerC2H2-type 20
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+3311051_10731191846Zinc fingerC2H2-type 21
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+3311167_11891191846Zinc fingerC2H2-type 22
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+3311195_12171191846Zinc fingerC2H2-type 23
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+331121_1431191846Zinc fingerC2H2-type 4
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+3311223_12451191846Zinc fingerC2H2-type 24
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+3311251_12731191846Zinc fingerC2H2-type 25
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+331153_1751191846Zinc fingerC2H2-type 5
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+3311657_16801191846Zinc fingerC2H2-type 26
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+3311686_17081191846Zinc fingerC2H2-type 27
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+3311722_17441191846Zinc fingerC2H2-type 28
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+3311750_17721191846Zinc fingerC2H2-type 29
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+3311778_18011191846Zinc fingerC2H2-type 30
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+331197_2191191846Zinc fingerC2H2-type 6
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+331225_2471191846Zinc fingerC2H2-type 7
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+331253_2761191846Zinc fingerC2H2-type 8
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+331285_3081191846Zinc fingerC2H2-type 9
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+331482_5041191846Zinc fingerC2H2-type 10
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+331510_5321191846Zinc fingerC2H2-type 11
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+331538_5601191846Zinc fingerC2H2-type 12
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+331566_5881191846Zinc fingerC2H2-type 13
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+331657_6791191846Zinc fingerC2H2-type 14
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+331685_7071191846Zinc fingerC2H2-type 15
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+331713_7351191846Zinc fingerC2H2-type 16
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+331741_7631191846Zinc fingerC2H2-type 17
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+331967_9891191846Zinc fingerC2H2-type 18
HgeneZNF236chr18:74563895chr6:107088224ENST00000253159+331995_10171191846Zinc fingerC2H2-type 19


Top

FusionGeneSequence for ZNF236_QRSL1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZNF236_ENST00000320610_chr18_74563895_+_QRSL1_ENST00000369046_chr6_107088224_+_642aa
MPRGRPPKPRESKARGDSDGVLTLNAENTNTATQVPNFHKCEICLLSFPKESQFQRHMRDHERNDKPHRCDQCPQTFNVEFNLTLHKCTH
SGEDPTCPVCNKKFSRVASLKAHIMLHEKEEVSAALKQGQITPTELCQKCLSLIKKTKFLNAYITVSEEVALKQAEESEKRTKNGQSLGD
LDGIPIAVKDNFSTSGIETTCASNMLKGTIPPTNATVVQKLLDQGALLMGKTNLDEFAMGSGSTDGVFGPVKNPWSTSKQTREKRKQNPH
SENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDTGGSTRNPAAHCGLVGFKPSTGLVSRHGLIPLVNSMDVPGILTRCVDDAAIVLGAL
AGPDPRDSTTVHEPINKPFMLPSLADVSKLCIGIPKETLVPELSSEVQSLWSKAADLFESEGAKVIEVSLPHTSTSIVCYHVLCTSEVAS
NMARFDGLQTGHRCDIDVSTEAMTAATRREGFNDVVRGRILSGNFFLLKENTENTFVKAQKVRRLIANDFVNAFNSGVDVLLTPTTLSEA
VPYLEFIKEDNRTRSAQDDIFTQAVNMAGLPAVSIPVALSNQGLPIGLQFIGRAFCDQQLLTVAKWFEKQVQFPVIQLQELMDDCSAVLE

>In-frame_ZNF236_ENST00000253159_chr18_74563895_+_QRSL1_ENST00000369046_chr6_107088224_+_640aa
MGLCGLLERCWLHHDPDGVLTLNAENTNTATQVPNFHKCEICLLSFPKESQFQRHMRDHERNDKPHRCDQCPQTFNVEFNLTLHKCTHSG
EDPTCPVCNKKFSRVASLKAHIMLHEKEEVSAALKQGQITPTELCQKCLSLIKKTKFLNAYITVSEEVALKQAEESEKRTKNGQSLGDLD
GIPIAVKDNFSTSGIETTCASNMLKGTIPPTNATVVQKLLDQGALLMGKTNLDEFAMGSGSTDGVFGPVKNPWSTSKQTREKRKQNPHSE
NEDSDWLITGGSSGGSAAAVSAFTCYAALGSDTGGSTRNPAAHCGLVGFKPSTGLVSRHGLIPLVNSMDVPGILTRCVDDAAIVLGALAG
PDPRDSTTVHEPINKPFMLPSLADVSKLCIGIPKETLVPELSSEVQSLWSKAADLFESEGAKVIEVSLPHTSTSIVCYHVLCTSEVASNM
ARFDGLQTGHRCDIDVSTEAMTAATRREGFNDVVRGRILSGNFFLLKENTENTFVKAQKVRRLIANDFVNAFNSGVDVLLTPTTLSEAVP
YLEFIKEDNRTRSAQDDIFTQAVNMAGLPAVSIPVALSNQGLPIGLQFIGRAFCDQQLLTVAKWFEKQVQFPVIQLQELMDDCSAVLENE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZNF236_ENST00000320610_chr18_74563895_+_QRSL1_ENST00000369046_chr6_107088224_+_1926nt
ATGCCGCGGGGCCGCCCCCCGAAGCCCAGGGAGAGCAAGGCGCGCGGCGACTCCGATGGAGTTTTAACATTGAATGCGGAGAACACTAAT
TATGCCTATCAAGTTCCAAACTTCCATAAATGTGAAATCTGTCTACTATCTTTTCCAAAAGAATCCCAGTTTCAACGCCACATGAGGGAT
CACGAGCGAAATGACAAGCCACATCGATGTGACCAGTGCCCCCAAACATTTAATGTTGAATTCAACCTGACACTTCATAAATGCACCCAC
AGCGGGGAAGATCCTACCTGCCCTGTGTGTAACAAGAAATTCTCCAGAGTGGCTAGTCTCAAAGCGCATATTATGCTACATGAAAAGGAA
GAGGTTTCTGCGGCACTGAAACAAGGCCAAATTACACCAACAGAGCTCTGTCAAAAATGTCTCTCTCTTATCAAGAAGACCAAGTTTCTA
AATGCCTACATTACTGTGTCAGAAGAGGTGGCCTTAAAACAAGCTGAAGAATCAGAAAAGAGATATAAGAATGGACAGTCACTTGGGGAT
TTAGATGGAATTCCTATTGCAGTAAAAGACAATTTCAGCACTTCTGGCATTGAGACAACATGTGCATCAAATATGCTGAAAGGTTATATA
CCACCTTATAATGCTACAGTAGTTCAGAAGTTGTTGGATCAGGGAGCTCTACTAATGGGAAAAACAAATTTAGATGAGTTTGCTATGGGA
TCTGGGAGCACAGATGGTGTATTTGGACCAGTTAAAAACCCCTGGAGTTATTCAAAACAATATAGAGAAAAGAGGAAGCAGAATCCCCAC
AGCGAGAATGAAGATTCAGACTGGCTGATAACTGGAGGAAGCTCAGGTGGGAGTGCAGCTGCTGTATCGGCGTTCACATGCTACGCGGCT
TTAGGATCAGATACAGGAGGATCGACCAGAAATCCTGCTGCCCACTGTGGGCTTGTTGGTTTCAAACCAAGCTATGGCTTAGTTTCCCGT
CATGGTCTCATTCCCCTGGTGAATTCGATGGATGTGCCAGGAATCTTAACCAGATGTGTGGATGATGCAGCAATTGTGTTGGGTGCACTG
GCCGGACCTGACCCCAGGGACTCTACCACAGTACATGAACCTATTAATAAACCATTCATGCTTCCCAGTTTGGCAGATGTGAGCAAACTA
TGTATAGGAATTCCAAAGGAATATCTTGTACCGGAATTATCAAGTGAAGTACAGTCTCTTTGGTCCAAAGCTGCTGACCTCTTTGAGTCT
GAGGGGGCCAAAGTAATTGAAGTATCCCTTCCTCACACCAGTTATTCAATTGTCTGCTACCATGTATTGTGCACATCAGAAGTGGCATCG
AATATGGCAAGATTTGATGGGCTACAATATGGTCACAGATGTGACATTGATGTGTCCACTGAAGCCATGTATGCTGCAACCAGACGAGAA
GGGTTTAATGATGTGGTGAGAGGAAGAATTCTCTCAGGAAACTTTTTCTTATTAAAAGAAAACTATGAAAATTATTTTGTCAAAGCACAG
AAAGTGAGACGCCTCATTGCTAATGACTTTGTAAATGCTTTTAACTCTGGAGTAGATGTCTTGCTAACTCCCACCACCTTGAGTGAGGCA
GTACCATACTTGGAGTTCATCAAAGAGGACAACAGAACCCGAAGTGCCCAGGATGATATTTTTACACAAGCTGTAAATATGGCAGGATTG
CCAGCAGTGAGTATCCCTGTTGCACTCTCAAACCAAGGGTTGCCAATAGGACTGCAGTTTATTGGACGTGCGTTTTGTGACCAGCAGCTT
CTTACAGTAGCCAAATGGTTTGAAAAACAAGTACAGTTTCCTGTTATTCAACTTCAAGAACTCATGGATGATTGTTCAGCAGTCCTTGAA

>In-frame_ZNF236_ENST00000253159_chr18_74563895_+_QRSL1_ENST00000369046_chr6_107088224_+_1920nt
ATGGGCCTTTGTGGGCTGCTGGAGAGATGTTGGCTGCACCATGACCCAGATGGAGTTTTAACATTGAATGCGGAGAACACTAATTATGCC
TATCAAGTTCCAAACTTCCATAAATGTGAAATCTGTCTACTATCTTTTCCAAAAGAATCCCAGTTTCAACGCCACATGAGGGATCACGAG
CGAAATGACAAGCCACATCGATGTGACCAGTGCCCCCAAACATTTAATGTTGAATTCAACCTGACACTTCATAAATGCACCCACAGCGGG
GAAGATCCTACCTGCCCTGTGTGTAACAAGAAATTCTCCAGAGTGGCTAGTCTCAAAGCGCATATTATGCTACATGAAAAGGAAGAGGTT
TCTGCGGCACTGAAACAAGGCCAAATTACACCAACAGAGCTCTGTCAAAAATGTCTCTCTCTTATCAAGAAGACCAAGTTTCTAAATGCC
TACATTACTGTGTCAGAAGAGGTGGCCTTAAAACAAGCTGAAGAATCAGAAAAGAGATATAAGAATGGACAGTCACTTGGGGATTTAGAT
GGAATTCCTATTGCAGTAAAAGACAATTTCAGCACTTCTGGCATTGAGACAACATGTGCATCAAATATGCTGAAAGGTTATATACCACCT
TATAATGCTACAGTAGTTCAGAAGTTGTTGGATCAGGGAGCTCTACTAATGGGAAAAACAAATTTAGATGAGTTTGCTATGGGATCTGGG
AGCACAGATGGTGTATTTGGACCAGTTAAAAACCCCTGGAGTTATTCAAAACAATATAGAGAAAAGAGGAAGCAGAATCCCCACAGCGAG
AATGAAGATTCAGACTGGCTGATAACTGGAGGAAGCTCAGGTGGGAGTGCAGCTGCTGTATCGGCGTTCACATGCTACGCGGCTTTAGGA
TCAGATACAGGAGGATCGACCAGAAATCCTGCTGCCCACTGTGGGCTTGTTGGTTTCAAACCAAGCTATGGCTTAGTTTCCCGTCATGGT
CTCATTCCCCTGGTGAATTCGATGGATGTGCCAGGAATCTTAACCAGATGTGTGGATGATGCAGCAATTGTGTTGGGTGCACTGGCCGGA
CCTGACCCCAGGGACTCTACCACAGTACATGAACCTATTAATAAACCATTCATGCTTCCCAGTTTGGCAGATGTGAGCAAACTATGTATA
GGAATTCCAAAGGAATATCTTGTACCGGAATTATCAAGTGAAGTACAGTCTCTTTGGTCCAAAGCTGCTGACCTCTTTGAGTCTGAGGGG
GCCAAAGTAATTGAAGTATCCCTTCCTCACACCAGTTATTCAATTGTCTGCTACCATGTATTGTGCACATCAGAAGTGGCATCGAATATG
GCAAGATTTGATGGGCTACAATATGGTCACAGATGTGACATTGATGTGTCCACTGAAGCCATGTATGCTGCAACCAGACGAGAAGGGTTT
AATGATGTGGTGAGAGGAAGAATTCTCTCAGGAAACTTTTTCTTATTAAAAGAAAACTATGAAAATTATTTTGTCAAAGCACAGAAAGTG
AGACGCCTCATTGCTAATGACTTTGTAAATGCTTTTAACTCTGGAGTAGATGTCTTGCTAACTCCCACCACCTTGAGTGAGGCAGTACCA
TACTTGGAGTTCATCAAAGAGGACAACAGAACCCGAAGTGCCCAGGATGATATTTTTACACAAGCTGTAAATATGGCAGGATTGCCAGCA
GTGAGTATCCCTGTTGCACTCTCAAACCAAGGGTTGCCAATAGGACTGCAGTTTATTGGACGTGCGTTTTGTGACCAGCAGCTTCTTACA
GTAGCCAAATGGTTTGAAAAACAAGTACAGTTTCCTGTTATTCAACTTCAAGAACTCATGGATGATTGTTCAGCAGTCCTTGAAAATGAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZNF236_ENST00000320610_chr18_74563895_+_QRSL1_ENST00000369046_chr6_107088224_+_4342nt
GATGCCGCGGGGCCGCCCCCCGAAGCCCAGGGAGAGCAAGGCGCGCGGCGACTCCGATGGAGTTTTAACATTGAATGCGGAGAACACTAA
TTATGCCTATCAAGTTCCAAACTTCCATAAATGTGAAATCTGTCTACTATCTTTTCCAAAAGAATCCCAGTTTCAACGCCACATGAGGGA
TCACGAGCGAAATGACAAGCCACATCGATGTGACCAGTGCCCCCAAACATTTAATGTTGAATTCAACCTGACACTTCATAAATGCACCCA
CAGCGGGGAAGATCCTACCTGCCCTGTGTGTAACAAGAAATTCTCCAGAGTGGCTAGTCTCAAAGCGCATATTATGCTACATGAAAAGGA
AGAGGTTTCTGCGGCACTGAAACAAGGCCAAATTACACCAACAGAGCTCTGTCAAAAATGTCTCTCTCTTATCAAGAAGACCAAGTTTCT
AAATGCCTACATTACTGTGTCAGAAGAGGTGGCCTTAAAACAAGCTGAAGAATCAGAAAAGAGATATAAGAATGGACAGTCACTTGGGGA
TTTAGATGGAATTCCTATTGCAGTAAAAGACAATTTCAGCACTTCTGGCATTGAGACAACATGTGCATCAAATATGCTGAAAGGTTATAT
ACCACCTTATAATGCTACAGTAGTTCAGAAGTTGTTGGATCAGGGAGCTCTACTAATGGGAAAAACAAATTTAGATGAGTTTGCTATGGG
ATCTGGGAGCACAGATGGTGTATTTGGACCAGTTAAAAACCCCTGGAGTTATTCAAAACAATATAGAGAAAAGAGGAAGCAGAATCCCCA
CAGCGAGAATGAAGATTCAGACTGGCTGATAACTGGAGGAAGCTCAGGTGGGAGTGCAGCTGCTGTATCGGCGTTCACATGCTACGCGGC
TTTAGGATCAGATACAGGAGGATCGACCAGAAATCCTGCTGCCCACTGTGGGCTTGTTGGTTTCAAACCAAGCTATGGCTTAGTTTCCCG
TCATGGTCTCATTCCCCTGGTGAATTCGATGGATGTGCCAGGAATCTTAACCAGATGTGTGGATGATGCAGCAATTGTGTTGGGTGCACT
GGCCGGACCTGACCCCAGGGACTCTACCACAGTACATGAACCTATTAATAAACCATTCATGCTTCCCAGTTTGGCAGATGTGAGCAAACT
ATGTATAGGAATTCCAAAGGAATATCTTGTACCGGAATTATCAAGTGAAGTACAGTCTCTTTGGTCCAAAGCTGCTGACCTCTTTGAGTC
TGAGGGGGCCAAAGTAATTGAAGTATCCCTTCCTCACACCAGTTATTCAATTGTCTGCTACCATGTATTGTGCACATCAGAAGTGGCATC
GAATATGGCAAGATTTGATGGGCTACAATATGGTCACAGATGTGACATTGATGTGTCCACTGAAGCCATGTATGCTGCAACCAGACGAGA
AGGGTTTAATGATGTGGTGAGAGGAAGAATTCTCTCAGGAAACTTTTTCTTATTAAAAGAAAACTATGAAAATTATTTTGTCAAAGCACA
GAAAGTGAGACGCCTCATTGCTAATGACTTTGTAAATGCTTTTAACTCTGGAGTAGATGTCTTGCTAACTCCCACCACCTTGAGTGAGGC
AGTACCATACTTGGAGTTCATCAAAGAGGACAACAGAACCCGAAGTGCCCAGGATGATATTTTTACACAAGCTGTAAATATGGCAGGATT
GCCAGCAGTGAGTATCCCTGTTGCACTCTCAAACCAAGGGTTGCCAATAGGACTGCAGTTTATTGGACGTGCGTTTTGTGACCAGCAGCT
TCTTACAGTAGCCAAATGGTTTGAAAAACAAGTACAGTTTCCTGTTATTCAACTTCAAGAACTCATGGATGATTGTTCAGCAGTCCTTGA
AAATGAAAAGTTAGCCTCTGTCTCTCTAAAACAGTAAACATATCTTACAAATTAAAATGACTTTTAGGCTGGGTGCAGTGGCTCACACCT
GTAATCCCAGCACTTTGGGAGGCCAAGGCGAGCGGATCATGAGGTCAGAAGATCTAGAACAGCCTGGTCAACATGGTGAAACCCCGTCTC
TACTAAAAATACAAAAATTAGCCAGGCTTAGTGGCGGGCATCTGTAGTCCCAGCTACTCAGGAGGCTGAGGCAGGAGAATCACTTGAACC
CTGGAGGTGGAGGTTGCAGTGAGCCGAGATCATGCCACTGCACTGCACTCCAGCCTGGGTGACAAAGCAAGACTGTGTCTCAAAATAAAT
AAATAAAATAAAATAAAATGACGTACAGAGATTCTATATTCTAGAGAGTCAAATGGTCTTGCTCAATTCTTGTAATTAGGTTCTTGTTAA
TACAGTCATTCCATGGAATTACTTTTTAAAATTCCTGTGACAATTAATAATAAATAACGTGTCAGCATTTAGTAAGCATCCACTAAGTGT
ACAATACTTCTACAATAACACAAGATACCTGTTCCTCAAAGACAATGCATTCTGCCATAATGTTCATTAAAGAGTTTACAGTAAAAATAA
GATTAGGGATAAACTTCTCAAAAATTGTACATCTGTGTAACTAAAGCACTAACAAAAACATGAATAGTCCTTCTAGAGGTAACTTGGATA
GCCTAGGCAGGCAACTTATCATGTGGTGAAGGCCGCCTCAGGGGTTGTTAAAAATGCACAGAAACAATTGAGTGCGATTATTGGCTTCTG
AGCGCTGAGCAGAGCAGGTGGAAGAGGAACTTTGAGCACAGGAGGAAATGCAACCAGTCAGGGCCCAGAATCATGCAAATCTCAGGGGTA
TGCCTCTCTGGGGAGGAGCTCCACTTGCAGGGACTCCTTTTATTTCCCTAAGAAAGAGCTGAAATGACTGAGAACTTTCCTTTCCTCCTT
AGAGTTACAATTTTACTTCTGCTATTCCGGAGCCCATGCCTAGAAGCCAGAACAACTCCATGTTACACTGAGTTCATGCTCCTATTTACT
GATCACAAATGAGCTCATTAATGTCATCGAAACATTTATTGTAACCTAACAGACCATCACAGATTGGAAACTTGGTAGATAGCAGAGCAT
GGTATTAGTGAAAAAGGTTCAAAATACACAAGTAACATACACTCTGAAAAACATGCAGATAATTTGCTGATGAAGCAGAAGAGGGGATGC
GCATGGCAAGAACTTGCCTTACCCCAGATTCTCTATATCTCATGGTTTCCTTTTCCTCTTGACTGTCTTTACGAGTGTTTTTTATTTGGG
ACCCTCGAGCCCAGAGATATTAATGGATATCTGTATTCAATATTTGACAAAATCTAATGGAAACCATCCATTTACTCATGATAAGGCTTC
ATCACTGGATTTCTGTGTCTTCACTAGAACACCATTGTCATCTCATATTGATCAGGTATTTTAATCTAGCACTTACATATTGTTGATAAA
TGAAAGCTGAATTGTTACTTAATAAATTCACTTTGTTTAGTAAAAAAAAATTGTTTTCTAAATATGACGTTCATGAAGAGAAAATAATGA
GTCAGAATCATCTGCAGAACCACTGGAATGTTTCATCGTCACCTGTTAGTTTTCATAAACAGTTTTCTGTCCTCTCTGAGATCCTCCCGC
TCCCAAATACTCAACCTGATTAACTTCACATAAAAGTCTTATGTGCCAGGCTTAGTAATATTCCTATAGATTTTGACTCTGAATCCCTGA
AAGAGGAAGAAATCCATGAGAGAAAATTGCATTACTTTATAGCAAGAGGAAACCGTTTTAAGTTTTTTAATTGCTCAGACACCACAACAT
CCTAGATGGAGGAAACCATTTTAGTTGAAGGAGCAAATATGATGTCAAAAGCAAGTAAATAAACAAACCGTTGCCCCAATCTGTTTTTAT
GTAATGAATTTAAAAAAAAAGAGAGAGAGAGAGAGATGGGCTCTCCCTGTGTTGCCCAGGCTAGTCTCAAACTCCTGGGCTCAAGTGATC
TGCCTCCCTCAGCCTCCCAAAGTGCTGAGATTAAAGACGTGAGCCACCACACCTGGCCGAAATAATAATATTCAATATTATATATTCAAT
GATATTATTCAGTATTCAATATTATTTCAAATAATATTAAATCTCTTGTTCCTGTATCTCTACATGAGCTGCACTAATAATTTGAATCTG
GAAATTAAAAAGTGAAACATTTACCGTTCTCATATACTGATACCCAACTACCATGAAATGATACCTAATTTGTTTTTCTTTTCTCTTCAT
TTTTACTCTTAATCTAGTAGGTCTCATTTTGCCAAGTCACTGTCTGGGAATTTAAGTGGCAAATACTTTCTTTGTCTCAGCTAATTAAAC

>In-frame_ZNF236_ENST00000253159_chr18_74563895_+_QRSL1_ENST00000369046_chr6_107088224_+_4533nt
GCCTGGAAACTACAAAGGATTGTGTTAATTTTGTGTTTAGGAAGAAAGAGGTAATGGGTAGGAATCAATGTAAACTTATTCATAGGCCAC
ACCAAACCAGGAATTCTTGTCGTGATTGCACTTGGTAGAGTTAACACACGTGCACATTACGGAAACGTTGGTGACCAACAGGCGTTTCAG
CGAGCTTTCGCACACCTCATGGGCCTTTGTGGGCTGCTGGAGAGATGTTGGCTGCACCATGACCCAGATGGAGTTTTAACATTGAATGCG
GAGAACACTAATTATGCCTATCAAGTTCCAAACTTCCATAAATGTGAAATCTGTCTACTATCTTTTCCAAAAGAATCCCAGTTTCAACGC
CACATGAGGGATCACGAGCGAAATGACAAGCCACATCGATGTGACCAGTGCCCCCAAACATTTAATGTTGAATTCAACCTGACACTTCAT
AAATGCACCCACAGCGGGGAAGATCCTACCTGCCCTGTGTGTAACAAGAAATTCTCCAGAGTGGCTAGTCTCAAAGCGCATATTATGCTA
CATGAAAAGGAAGAGGTTTCTGCGGCACTGAAACAAGGCCAAATTACACCAACAGAGCTCTGTCAAAAATGTCTCTCTCTTATCAAGAAG
ACCAAGTTTCTAAATGCCTACATTACTGTGTCAGAAGAGGTGGCCTTAAAACAAGCTGAAGAATCAGAAAAGAGATATAAGAATGGACAG
TCACTTGGGGATTTAGATGGAATTCCTATTGCAGTAAAAGACAATTTCAGCACTTCTGGCATTGAGACAACATGTGCATCAAATATGCTG
AAAGGTTATATACCACCTTATAATGCTACAGTAGTTCAGAAGTTGTTGGATCAGGGAGCTCTACTAATGGGAAAAACAAATTTAGATGAG
TTTGCTATGGGATCTGGGAGCACAGATGGTGTATTTGGACCAGTTAAAAACCCCTGGAGTTATTCAAAACAATATAGAGAAAAGAGGAAG
CAGAATCCCCACAGCGAGAATGAAGATTCAGACTGGCTGATAACTGGAGGAAGCTCAGGTGGGAGTGCAGCTGCTGTATCGGCGTTCACA
TGCTACGCGGCTTTAGGATCAGATACAGGAGGATCGACCAGAAATCCTGCTGCCCACTGTGGGCTTGTTGGTTTCAAACCAAGCTATGGC
TTAGTTTCCCGTCATGGTCTCATTCCCCTGGTGAATTCGATGGATGTGCCAGGAATCTTAACCAGATGTGTGGATGATGCAGCAATTGTG
TTGGGTGCACTGGCCGGACCTGACCCCAGGGACTCTACCACAGTACATGAACCTATTAATAAACCATTCATGCTTCCCAGTTTGGCAGAT
GTGAGCAAACTATGTATAGGAATTCCAAAGGAATATCTTGTACCGGAATTATCAAGTGAAGTACAGTCTCTTTGGTCCAAAGCTGCTGAC
CTCTTTGAGTCTGAGGGGGCCAAAGTAATTGAAGTATCCCTTCCTCACACCAGTTATTCAATTGTCTGCTACCATGTATTGTGCACATCA
GAAGTGGCATCGAATATGGCAAGATTTGATGGGCTACAATATGGTCACAGATGTGACATTGATGTGTCCACTGAAGCCATGTATGCTGCA
ACCAGACGAGAAGGGTTTAATGATGTGGTGAGAGGAAGAATTCTCTCAGGAAACTTTTTCTTATTAAAAGAAAACTATGAAAATTATTTT
GTCAAAGCACAGAAAGTGAGACGCCTCATTGCTAATGACTTTGTAAATGCTTTTAACTCTGGAGTAGATGTCTTGCTAACTCCCACCACC
TTGAGTGAGGCAGTACCATACTTGGAGTTCATCAAAGAGGACAACAGAACCCGAAGTGCCCAGGATGATATTTTTACACAAGCTGTAAAT
ATGGCAGGATTGCCAGCAGTGAGTATCCCTGTTGCACTCTCAAACCAAGGGTTGCCAATAGGACTGCAGTTTATTGGACGTGCGTTTTGT
GACCAGCAGCTTCTTACAGTAGCCAAATGGTTTGAAAAACAAGTACAGTTTCCTGTTATTCAACTTCAAGAACTCATGGATGATTGTTCA
GCAGTCCTTGAAAATGAAAAGTTAGCCTCTGTCTCTCTAAAACAGTAAACATATCTTACAAATTAAAATGACTTTTAGGCTGGGTGCAGT
GGCTCACACCTGTAATCCCAGCACTTTGGGAGGCCAAGGCGAGCGGATCATGAGGTCAGAAGATCTAGAACAGCCTGGTCAACATGGTGA
AACCCCGTCTCTACTAAAAATACAAAAATTAGCCAGGCTTAGTGGCGGGCATCTGTAGTCCCAGCTACTCAGGAGGCTGAGGCAGGAGAA
TCACTTGAACCCTGGAGGTGGAGGTTGCAGTGAGCCGAGATCATGCCACTGCACTGCACTCCAGCCTGGGTGACAAAGCAAGACTGTGTC
TCAAAATAAATAAATAAAATAAAATAAAATGACGTACAGAGATTCTATATTCTAGAGAGTCAAATGGTCTTGCTCAATTCTTGTAATTAG
GTTCTTGTTAATACAGTCATTCCATGGAATTACTTTTTAAAATTCCTGTGACAATTAATAATAAATAACGTGTCAGCATTTAGTAAGCAT
CCACTAAGTGTACAATACTTCTACAATAACACAAGATACCTGTTCCTCAAAGACAATGCATTCTGCCATAATGTTCATTAAAGAGTTTAC
AGTAAAAATAAGATTAGGGATAAACTTCTCAAAAATTGTACATCTGTGTAACTAAAGCACTAACAAAAACATGAATAGTCCTTCTAGAGG
TAACTTGGATAGCCTAGGCAGGCAACTTATCATGTGGTGAAGGCCGCCTCAGGGGTTGTTAAAAATGCACAGAAACAATTGAGTGCGATT
ATTGGCTTCTGAGCGCTGAGCAGAGCAGGTGGAAGAGGAACTTTGAGCACAGGAGGAAATGCAACCAGTCAGGGCCCAGAATCATGCAAA
TCTCAGGGGTATGCCTCTCTGGGGAGGAGCTCCACTTGCAGGGACTCCTTTTATTTCCCTAAGAAAGAGCTGAAATGACTGAGAACTTTC
CTTTCCTCCTTAGAGTTACAATTTTACTTCTGCTATTCCGGAGCCCATGCCTAGAAGCCAGAACAACTCCATGTTACACTGAGTTCATGC
TCCTATTTACTGATCACAAATGAGCTCATTAATGTCATCGAAACATTTATTGTAACCTAACAGACCATCACAGATTGGAAACTTGGTAGA
TAGCAGAGCATGGTATTAGTGAAAAAGGTTCAAAATACACAAGTAACATACACTCTGAAAAACATGCAGATAATTTGCTGATGAAGCAGA
AGAGGGGATGCGCATGGCAAGAACTTGCCTTACCCCAGATTCTCTATATCTCATGGTTTCCTTTTCCTCTTGACTGTCTTTACGAGTGTT
TTTTATTTGGGACCCTCGAGCCCAGAGATATTAATGGATATCTGTATTCAATATTTGACAAAATCTAATGGAAACCATCCATTTACTCAT
GATAAGGCTTCATCACTGGATTTCTGTGTCTTCACTAGAACACCATTGTCATCTCATATTGATCAGGTATTTTAATCTAGCACTTACATA
TTGTTGATAAATGAAAGCTGAATTGTTACTTAATAAATTCACTTTGTTTAGTAAAAAAAAATTGTTTTCTAAATATGACGTTCATGAAGA
GAAAATAATGAGTCAGAATCATCTGCAGAACCACTGGAATGTTTCATCGTCACCTGTTAGTTTTCATAAACAGTTTTCTGTCCTCTCTGA
GATCCTCCCGCTCCCAAATACTCAACCTGATTAACTTCACATAAAAGTCTTATGTGCCAGGCTTAGTAATATTCCTATAGATTTTGACTC
TGAATCCCTGAAAGAGGAAGAAATCCATGAGAGAAAATTGCATTACTTTATAGCAAGAGGAAACCGTTTTAAGTTTTTTAATTGCTCAGA
CACCACAACATCCTAGATGGAGGAAACCATTTTAGTTGAAGGAGCAAATATGATGTCAAAAGCAAGTAAATAAACAAACCGTTGCCCCAA
TCTGTTTTTATGTAATGAATTTAAAAAAAAAGAGAGAGAGAGAGAGATGGGCTCTCCCTGTGTTGCCCAGGCTAGTCTCAAACTCCTGGG
CTCAAGTGATCTGCCTCCCTCAGCCTCCCAAAGTGCTGAGATTAAAGACGTGAGCCACCACACCTGGCCGAAATAATAATATTCAATATT
ATATATTCAATGATATTATTCAGTATTCAATATTATTTCAAATAATATTAAATCTCTTGTTCCTGTATCTCTACATGAGCTGCACTAATA
ATTTGAATCTGGAAATTAAAAAGTGAAACATTTACCGTTCTCATATACTGATACCCAACTACCATGAAATGATACCTAATTTGTTTTTCT
TTTCTCTTCATTTTTACTCTTAATCTAGTAGGTCTCATTTTGCCAAGTCACTGTCTGGGAATTTAAGTGGCAAATACTTTCTTTGTCTCA


Top

FusionGenePPI for ZNF236_QRSL1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZNF236QRSL1KRT8, XRCC6, GATC, GPBP1L1, GATB, USP47, ARSG


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZNF236_QRSL1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ZNF236_QRSL1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource