FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42981

FusionGeneSummary for ZMYND8_SULF2

check button Fusion gene summary
Fusion gene informationFusion gene name: ZMYND8_SULF2
Fusion gene ID: 42981
HgeneTgene
Gene symbol

ZMYND8

SULF2

Gene ID

23613

55959

Gene namezinc finger MYND-type containing 8sulfatase 2
SynonymsPRKCBP1|PRO2893|RACK7HSULF-2
Cytomap

20q13.12

20q13.12

Type of geneprotein-codingprotein-coding
Descriptionprotein kinase C-binding protein 1CTCL tumor antigen se14-3cutaneous T-cell lymphoma-associated antigen se14-3predicted protein of HQ2893zinc finger MYND domain-containing protein 8extracellular sulfatase Sulf-2
Modification date2018052620180519
UniProtAcc

Q9ULU4

Q8IWU5

Ensembl transtripts involved in fusion geneENST00000311275, ENST00000360911, 
ENST00000458360, ENST00000262975, 
ENST00000471951, ENST00000352431, 
ENST00000396281, ENST00000446994, 
ENST00000536340, ENST00000355972, 
ENST00000540497, ENST00000461685, 
ENST00000372023, ENST00000468376, 
ENST00000359930, ENST00000484875, 
ENST00000361612, ENST00000467815, 
ENST00000478766, 
Fusion gene scores* DoF score12 X 9 X 6=6483 X 3 X 4=36
# samples 134
** MAII scorelog2(13/648*10)=-2.31748218985617
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ZMYND8 [Title/Abstract] AND SULF2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneSULF2

GO:0030177

positive regulation of Wnt signaling pathway

19520866

TgeneSULF2

GO:0030201

heparan sulfate proteoglycan metabolic process

18687675


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVOVTCGA-09-1673-01AZMYND8chr20

45976600

-SULF2chr20

46319039

-
TCGARVUCECTCGA-AX-A3GI-01AZMYND8chr20

45976600

-SULF2chr20

46331414

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000311275ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000311275ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000311275ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000311275ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46319039

-
5CDS-intronENST00000311275ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000360911ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000360911ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000360911ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000360911ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46319039

-
5CDS-intronENST00000360911ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000458360ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000458360ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000458360ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000458360ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46319039

-
5CDS-intronENST00000458360ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46319039

-
In-frameENST00000262975ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46319039

-
In-frameENST00000262975ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46319039

-
In-frameENST00000262975ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46319039

-
In-frameENST00000262975ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46319039

-
5CDS-intronENST00000262975ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000471951ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000471951ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000471951ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000471951ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46319039

-
5CDS-intronENST00000471951ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000352431ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000352431ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000352431ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000352431ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46319039

-
5CDS-intronENST00000352431ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000396281ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000396281ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000396281ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000396281ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46319039

-
5CDS-intronENST00000396281ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46319039

-
In-frameENST00000446994ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46319039

-
In-frameENST00000446994ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46319039

-
In-frameENST00000446994ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46319039

-
In-frameENST00000446994ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46319039

-
5CDS-intronENST00000446994ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000536340ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000536340ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000536340ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000536340ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46319039

-
5CDS-intronENST00000536340ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46319039

-
In-frameENST00000355972ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46319039

-
In-frameENST00000355972ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46319039

-
In-frameENST00000355972ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46319039

-
In-frameENST00000355972ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46319039

-
5CDS-intronENST00000355972ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000540497ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000540497ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000540497ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000540497ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46319039

-
5CDS-intronENST00000540497ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000461685ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000461685ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000461685ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000461685ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46319039

-
5CDS-intronENST00000461685ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000372023ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000372023ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000372023ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000372023ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46319039

-
5CDS-intronENST00000372023ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46319039

-
intron-3CDSENST00000468376ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46319039

-
intron-3CDSENST00000468376ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46319039

-
intron-3CDSENST00000468376ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46319039

-
intron-3CDSENST00000468376ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46319039

-
intron-intronENST00000468376ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46319039

-
Frame-shitENST00000311275ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46331414

-
Frame-shitENST00000311275ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46331414

-
Frame-shitENST00000311275ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46331414

-
Frame-shitENST00000311275ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46331414

-
5CDS-intronENST00000311275ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000360911ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000360911ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000360911ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000360911ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46331414

-
5CDS-intronENST00000360911ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000458360ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000458360ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000458360ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000458360ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46331414

-
5CDS-intronENST00000458360ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46331414

-
Frame-shitENST00000262975ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46331414

-
Frame-shitENST00000262975ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46331414

-
Frame-shitENST00000262975ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46331414

-
Frame-shitENST00000262975ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46331414

-
5CDS-intronENST00000262975ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000471951ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000471951ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000471951ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000471951ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46331414

-
5CDS-intronENST00000471951ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000352431ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000352431ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000352431ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000352431ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46331414

-
5CDS-intronENST00000352431ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000396281ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000396281ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000396281ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000396281ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46331414

-
5CDS-intronENST00000396281ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46331414

-
Frame-shitENST00000446994ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46331414

-
Frame-shitENST00000446994ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46331414

-
Frame-shitENST00000446994ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46331414

-
Frame-shitENST00000446994ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46331414

-
5CDS-intronENST00000446994ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000536340ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000536340ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000536340ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000536340ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46331414

-
5CDS-intronENST00000536340ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46331414

-
Frame-shitENST00000355972ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46331414

-
Frame-shitENST00000355972ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46331414

-
Frame-shitENST00000355972ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46331414

-
Frame-shitENST00000355972ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46331414

-
5CDS-intronENST00000355972ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000540497ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000540497ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000540497ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000540497ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46331414

-
5CDS-intronENST00000540497ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000461685ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000461685ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000461685ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000461685ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46331414

-
5CDS-intronENST00000461685ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000372023ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000372023ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000372023ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46331414

-
In-frameENST00000372023ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46331414

-
5CDS-intronENST00000372023ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46331414

-
intron-3CDSENST00000468376ENST00000359930ZMYND8chr20

45976600

-SULF2chr20

46331414

-
intron-3CDSENST00000468376ENST00000484875ZMYND8chr20

45976600

-SULF2chr20

46331414

-
intron-3CDSENST00000468376ENST00000361612ZMYND8chr20

45976600

-SULF2chr20

46331414

-
intron-3CDSENST00000468376ENST00000467815ZMYND8chr20

45976600

-SULF2chr20

46331414

-
intron-intronENST00000468376ENST00000478766ZMYND8chr20

45976600

-SULF2chr20

46331414

-

Top

FusionProtFeatures for ZMYND8_SULF2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZMYND8

Q9ULU4

SULF2

Q8IWU5

Exhibits arylsulfatase activity and highly specificendoglucosamine-6-sulfatase activity. It can remove sulfate fromthe C-6 position of glucosamine within specific subregions ofintact heparin.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ZMYND8_SULF2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZMYND8_ENST00000262975_chr20_45976600_-_SULF2_ENST00000359930_chr20_46319039_-_690aa
MDISTRSKGLPHRPHHQXQRELLPHVQEDVPAQASPHGHQPCSPPRPXGFSPTIFTPLPKRISAHHAELQLRAQPGQTLDHALHGAHEAH
PHGIHQHAPAEALADPHVGGRLHGDDLQHAGXDGRAGQHVHRIHRRPRLPHRPVWPGEREIHAIXVXHQGPVLREGPQRGSRLSESPHRP
QHXPGPHHPGHCRPGHTCGYGREIHPQAAGHGAAGESVSLEKEDEGLAGLLLGGERQAATQERQXQGGRPGGELSAQVPACEGPVSACXV
PDGVXAAGTEVAVCGGRHGEAEAAXVQGPHAAGRQQSPLQPRAQVLRAGQRGLHLXQRGLQAQPGRTPEKTLQEEVQGQLCPQSLHPLSG
HRGGRQGVPRRPGXCRPAPKPHQAALARGPXGPRXQGWWGLQWHWRPSRLLSRQPHXSDTSVLHPRERHSPVXPGPVQVPAGLERPQAAH
RPRDXNPAEQNXEPEGSPRSPEEKAARRMXLSQNQLPHPAQRPPQAQRLQSASFQEGPAREGQGVAVAGAEAQEETPQAAQAPAEQRHVQ
HARPHVLHPRQPALADGAFLDTGAFLCLHQRQQXHVLVHEDHQXDSQFPLLXICNWLPRVLXSQHRPLPADECSEHTGQGCPQPATRTAH

>In-frame_ZMYND8_ENST00000262975_chr20_45976600_-_SULF2_ENST00000484875_chr20_46319039_-_690aa
MDISTRSKGLPHRPHHQXQRELLPHVQEDVPAQASPHGHQPCSPPRPXGFSPTIFTPLPKRISAHHAELQLRAQPGQTLDHALHGAHEAH
PHGIHQHAPAEALADPHVGGRLHGDDLQHAGXDGRAGQHVHRIHRRPRLPHRPVWPGEREIHAIXVXHQGPVLREGPQRGSRLSESPHRP
QHXPGPHHPGHCRPGHTCGYGREIHPQAAGHGAAGESVSLEKEDEGLAGLLLGGERQAATQERQXQGGRPGGELSAQVPACEGPVSACXV
PDGVXAAGTEVAVCGGRHGEAEAAXVQGPHAAGRQQSPLQPRAQVLRAGQRGLHLXQRGLQAQPGRTPEKTLQEEVQGQLCPQSLHPLSG
HRGGRQGVPRRPGXCRPAPKPHQAALARGPXGPRXQGWWGLQWHWRPSRLLSRQPHXSDTSVLHPRERHSPVXPGPVQVPAGLERPQAAH
RPRDXNPAEQNXEPEGSPRSPEEKAARRMXLSQNQLPHPAQRPPQAQRLQSASFQEGPAREGQGVAVAGAEAQEETPQAAQAPAEQRHVQ
HARPHVLHPRQPALADGAFLDTGAFLCLHQRQQXHVLVHEDHQXDSQFPLLXICNWLPRVLXSQHRPLPADECSEHTGQGCPQPATRTAH

>In-frame_ZMYND8_ENST00000262975_chr20_45976600_-_SULF2_ENST00000361612_chr20_46319039_-_672aa
MDISTRSKGLPHRPHHQXQRELLPHVQEDVPAQASPHGHQPCSPPRPXGFSPTIFTPLPKRISAHHAELQLRAQPGQTLDHALHGAHEAH
PHGIHQHAPAEALADPHVGGRLHGDDLQHAGXDGRAGQHVHRIHRRPRLPHRPVWPGEREIHAIXVXHQGPVLREGPQRGSRLSESPHRP
QHXPGPHHPGHCRPGHTCGYGREIHPQAAGHGAAGESVSLEKEDEGLAGLLLGGERQAATQERQXQGGRPGGELSAQVPACEGPVSACXV
PDGVXAAGTEVAVCGGRHGEAEAAXVQGPHAAGRQQSPLQPRAQVLRAGQRGLHLXQRGLQAQPGRTPEKTLQEEVQGQLCPQSLHPLSG
HRGGRQGVPRRPGXCRPAPKPHQAALARGPXGPRXQGWWGLQWHWRPSRLLSRQPHXSDTSVLHPRERHSPVXPGPVQVPAGLERPQAAH
RPRDXNPAEQNXEPEGSPRSPEEKAARRMXLSQNQLPHPAQRPPQAQRLQSASFQEGPAREGQGVAVAGAEAQEETPQAAQAPAEQRHVQ
HARPHVLHPRQPALADGAFLDTGAFLCLHQRQQXHVLVHEDHQXDSQFPLLXICNWLPRVLXSQHRPLPADECSEHTGQGCPQPATRTAH

>In-frame_ZMYND8_ENST00000262975_chr20_45976600_-_SULF2_ENST00000467815_chr20_46319039_-_687aa
MDISTRSKGLPHRPHHQXQRELLPHVQEDVPAQASPHGHQPCSPPRPXGFSPTIFTPLPKRISAHHAELQLRAQPGQTLDHALHGAHEAH
PHGIHQHAPAEALADPHVGGRLHGDDLQHAGXDGRAGQHVHRIHRRPRLPHRPVWPGEREIHAIXVXHQGPVLREGPQRGSRLSESPHRP
QHXPGPHHPGHCRPGHTCGYGREIHPQAAGHGAAGESVSLEKEDEGLAGLLLGGERQAATQERQXQGGRPGGELSAQVPACEGPVSACXV
PDGVXAAGTEVAVCGGRHGEAEAAXVQGPHAAGRQQSPLQPRAQVLRAGQRGLHLXQRGLQAQPGRTPEKTLQEEVQGQLCPQSLHPLSG
HRGGRQGVPRRPGXCRPAPKPHQAALARGPXGPRXQGWWGLQWHWRPSRLLSRQPHXSDTSVLHPRERHSPVXPGPVQVPAGLERPQAAH
RPRDXNPAEQNXEPEGSPRSPEEKAARRMXLSQNQLPHPAQRPPQAQRLQSASFQEGPAREGQGVAVAGAEAQEETPQAAQAPAEQRHVQ
HARPHVLHPRQPALADGAFLDTGAFLCLHQRQQXHVLVHEDHQXDSQFPLLXICNWLPRVLXSQHRPLPADECSEHTGQGCPQPATRTAH

>In-frame_ZMYND8_ENST00000446994_chr20_45976600_-_SULF2_ENST00000359930_chr20_46319039_-_690aa
MDISTRSKGLPHRPHHQXQRELLPHVQEDVPAQASPHGHQPCSPPRPXGFSPTIFTPLPKRISAHHAELQLRAQPGQTLDHALHGAHEAH
PHGIHQHAPAEALADPHVGGRLHGDDLQHAGXDGRAGQHVHRIHRRPRLPHRPVWPGEREIHAIXVXHQGPVLREGPQRGSRLSESPHRP
QHXPGPHHPGHCRPGHTCGYGREIHPQAAGHGAAGESVSLEKEDEGLAGLLLGGERQAATQERQXQGGRPGGELSAQVPACEGPVSACXV
PDGVXAAGTEVAVCGGRHGEAEAAXVQGPHAAGRQQSPLQPRAQVLRAGQRGLHLXQRGLQAQPGRTPEKTLQEEVQGQLCPQSLHPLSG
HRGGRQGVPRRPGXCRPAPKPHQAALARGPXGPRXQGWWGLQWHWRPSRLLSRQPHXSDTSVLHPRERHSPVXPGPVQVPAGLERPQAAH
RPRDXNPAEQNXEPEGSPRSPEEKAARRMXLSQNQLPHPAQRPPQAQRLQSASFQEGPAREGQGVAVAGAEAQEETPQAAQAPAEQRHVQ
HARPHVLHPRQPALADGAFLDTGAFLCLHQRQQXHVLVHEDHQXDSQFPLLXICNWLPRVLXSQHRPLPADECSEHTGQGCPQPATRTAH

>In-frame_ZMYND8_ENST00000446994_chr20_45976600_-_SULF2_ENST00000484875_chr20_46319039_-_690aa
MDISTRSKGLPHRPHHQXQRELLPHVQEDVPAQASPHGHQPCSPPRPXGFSPTIFTPLPKRISAHHAELQLRAQPGQTLDHALHGAHEAH
PHGIHQHAPAEALADPHVGGRLHGDDLQHAGXDGRAGQHVHRIHRRPRLPHRPVWPGEREIHAIXVXHQGPVLREGPQRGSRLSESPHRP
QHXPGPHHPGHCRPGHTCGYGREIHPQAAGHGAAGESVSLEKEDEGLAGLLLGGERQAATQERQXQGGRPGGELSAQVPACEGPVSACXV
PDGVXAAGTEVAVCGGRHGEAEAAXVQGPHAAGRQQSPLQPRAQVLRAGQRGLHLXQRGLQAQPGRTPEKTLQEEVQGQLCPQSLHPLSG
HRGGRQGVPRRPGXCRPAPKPHQAALARGPXGPRXQGWWGLQWHWRPSRLLSRQPHXSDTSVLHPRERHSPVXPGPVQVPAGLERPQAAH
RPRDXNPAEQNXEPEGSPRSPEEKAARRMXLSQNQLPHPAQRPPQAQRLQSASFQEGPAREGQGVAVAGAEAQEETPQAAQAPAEQRHVQ
HARPHVLHPRQPALADGAFLDTGAFLCLHQRQQXHVLVHEDHQXDSQFPLLXICNWLPRVLXSQHRPLPADECSEHTGQGCPQPATRTAH

>In-frame_ZMYND8_ENST00000446994_chr20_45976600_-_SULF2_ENST00000361612_chr20_46319039_-_672aa
MDISTRSKGLPHRPHHQXQRELLPHVQEDVPAQASPHGHQPCSPPRPXGFSPTIFTPLPKRISAHHAELQLRAQPGQTLDHALHGAHEAH
PHGIHQHAPAEALADPHVGGRLHGDDLQHAGXDGRAGQHVHRIHRRPRLPHRPVWPGEREIHAIXVXHQGPVLREGPQRGSRLSESPHRP
QHXPGPHHPGHCRPGHTCGYGREIHPQAAGHGAAGESVSLEKEDEGLAGLLLGGERQAATQERQXQGGRPGGELSAQVPACEGPVSACXV
PDGVXAAGTEVAVCGGRHGEAEAAXVQGPHAAGRQQSPLQPRAQVLRAGQRGLHLXQRGLQAQPGRTPEKTLQEEVQGQLCPQSLHPLSG
HRGGRQGVPRRPGXCRPAPKPHQAALARGPXGPRXQGWWGLQWHWRPSRLLSRQPHXSDTSVLHPRERHSPVXPGPVQVPAGLERPQAAH
RPRDXNPAEQNXEPEGSPRSPEEKAARRMXLSQNQLPHPAQRPPQAQRLQSASFQEGPAREGQGVAVAGAEAQEETPQAAQAPAEQRHVQ
HARPHVLHPRQPALADGAFLDTGAFLCLHQRQQXHVLVHEDHQXDSQFPLLXICNWLPRVLXSQHRPLPADECSEHTGQGCPQPATRTAH

>In-frame_ZMYND8_ENST00000446994_chr20_45976600_-_SULF2_ENST00000467815_chr20_46319039_-_687aa
MDISTRSKGLPHRPHHQXQRELLPHVQEDVPAQASPHGHQPCSPPRPXGFSPTIFTPLPKRISAHHAELQLRAQPGQTLDHALHGAHEAH
PHGIHQHAPAEALADPHVGGRLHGDDLQHAGXDGRAGQHVHRIHRRPRLPHRPVWPGEREIHAIXVXHQGPVLREGPQRGSRLSESPHRP
QHXPGPHHPGHCRPGHTCGYGREIHPQAAGHGAAGESVSLEKEDEGLAGLLLGGERQAATQERQXQGGRPGGELSAQVPACEGPVSACXV
PDGVXAAGTEVAVCGGRHGEAEAAXVQGPHAAGRQQSPLQPRAQVLRAGQRGLHLXQRGLQAQPGRTPEKTLQEEVQGQLCPQSLHPLSG
HRGGRQGVPRRPGXCRPAPKPHQAALARGPXGPRXQGWWGLQWHWRPSRLLSRQPHXSDTSVLHPRERHSPVXPGPVQVPAGLERPQAAH
RPRDXNPAEQNXEPEGSPRSPEEKAARRMXLSQNQLPHPAQRPPQAQRLQSASFQEGPAREGQGVAVAGAEAQEETPQAAQAPAEQRHVQ
HARPHVLHPRQPALADGAFLDTGAFLCLHQRQQXHVLVHEDHQXDSQFPLLXICNWLPRVLXSQHRPLPADECSEHTGQGCPQPATRTAH

>In-frame_ZMYND8_ENST00000355972_chr20_45976600_-_SULF2_ENST00000359930_chr20_46319039_-_690aa
MDISTRSKGLPHRPHHQXQRELLPHVQEDVPAQASPHGHQPCSPPRPXGFSPTIFTPLPKRISAHHAELQLRAQPGQTLDHALHGAHEAH
PHGIHQHAPAEALADPHVGGRLHGDDLQHAGXDGRAGQHVHRIHRRPRLPHRPVWPGEREIHAIXVXHQGPVLREGPQRGSRLSESPHRP
QHXPGPHHPGHCRPGHTCGYGREIHPQAAGHGAAGESVSLEKEDEGLAGLLLGGERQAATQERQXQGGRPGGELSAQVPACEGPVSACXV
PDGVXAAGTEVAVCGGRHGEAEAAXVQGPHAAGRQQSPLQPRAQVLRAGQRGLHLXQRGLQAQPGRTPEKTLQEEVQGQLCPQSLHPLSG
HRGGRQGVPRRPGXCRPAPKPHQAALARGPXGPRXQGWWGLQWHWRPSRLLSRQPHXSDTSVLHPRERHSPVXPGPVQVPAGLERPQAAH
RPRDXNPAEQNXEPEGSPRSPEEKAARRMXLSQNQLPHPAQRPPQAQRLQSASFQEGPAREGQGVAVAGAEAQEETPQAAQAPAEQRHVQ
HARPHVLHPRQPALADGAFLDTGAFLCLHQRQQXHVLVHEDHQXDSQFPLLXICNWLPRVLXSQHRPLPADECSEHTGQGCPQPATRTAH

>In-frame_ZMYND8_ENST00000355972_chr20_45976600_-_SULF2_ENST00000484875_chr20_46319039_-_690aa
MDISTRSKGLPHRPHHQXQRELLPHVQEDVPAQASPHGHQPCSPPRPXGFSPTIFTPLPKRISAHHAELQLRAQPGQTLDHALHGAHEAH
PHGIHQHAPAEALADPHVGGRLHGDDLQHAGXDGRAGQHVHRIHRRPRLPHRPVWPGEREIHAIXVXHQGPVLREGPQRGSRLSESPHRP
QHXPGPHHPGHCRPGHTCGYGREIHPQAAGHGAAGESVSLEKEDEGLAGLLLGGERQAATQERQXQGGRPGGELSAQVPACEGPVSACXV
PDGVXAAGTEVAVCGGRHGEAEAAXVQGPHAAGRQQSPLQPRAQVLRAGQRGLHLXQRGLQAQPGRTPEKTLQEEVQGQLCPQSLHPLSG
HRGGRQGVPRRPGXCRPAPKPHQAALARGPXGPRXQGWWGLQWHWRPSRLLSRQPHXSDTSVLHPRERHSPVXPGPVQVPAGLERPQAAH
RPRDXNPAEQNXEPEGSPRSPEEKAARRMXLSQNQLPHPAQRPPQAQRLQSASFQEGPAREGQGVAVAGAEAQEETPQAAQAPAEQRHVQ
HARPHVLHPRQPALADGAFLDTGAFLCLHQRQQXHVLVHEDHQXDSQFPLLXICNWLPRVLXSQHRPLPADECSEHTGQGCPQPATRTAH

>In-frame_ZMYND8_ENST00000355972_chr20_45976600_-_SULF2_ENST00000361612_chr20_46319039_-_672aa
MDISTRSKGLPHRPHHQXQRELLPHVQEDVPAQASPHGHQPCSPPRPXGFSPTIFTPLPKRISAHHAELQLRAQPGQTLDHALHGAHEAH
PHGIHQHAPAEALADPHVGGRLHGDDLQHAGXDGRAGQHVHRIHRRPRLPHRPVWPGEREIHAIXVXHQGPVLREGPQRGSRLSESPHRP
QHXPGPHHPGHCRPGHTCGYGREIHPQAAGHGAAGESVSLEKEDEGLAGLLLGGERQAATQERQXQGGRPGGELSAQVPACEGPVSACXV
PDGVXAAGTEVAVCGGRHGEAEAAXVQGPHAAGRQQSPLQPRAQVLRAGQRGLHLXQRGLQAQPGRTPEKTLQEEVQGQLCPQSLHPLSG
HRGGRQGVPRRPGXCRPAPKPHQAALARGPXGPRXQGWWGLQWHWRPSRLLSRQPHXSDTSVLHPRERHSPVXPGPVQVPAGLERPQAAH
RPRDXNPAEQNXEPEGSPRSPEEKAARRMXLSQNQLPHPAQRPPQAQRLQSASFQEGPAREGQGVAVAGAEAQEETPQAAQAPAEQRHVQ
HARPHVLHPRQPALADGAFLDTGAFLCLHQRQQXHVLVHEDHQXDSQFPLLXICNWLPRVLXSQHRPLPADECSEHTGQGCPQPATRTAH

>In-frame_ZMYND8_ENST00000355972_chr20_45976600_-_SULF2_ENST00000467815_chr20_46319039_-_687aa
MDISTRSKGLPHRPHHQXQRELLPHVQEDVPAQASPHGHQPCSPPRPXGFSPTIFTPLPKRISAHHAELQLRAQPGQTLDHALHGAHEAH
PHGIHQHAPAEALADPHVGGRLHGDDLQHAGXDGRAGQHVHRIHRRPRLPHRPVWPGEREIHAIXVXHQGPVLREGPQRGSRLSESPHRP
QHXPGPHHPGHCRPGHTCGYGREIHPQAAGHGAAGESVSLEKEDEGLAGLLLGGERQAATQERQXQGGRPGGELSAQVPACEGPVSACXV
PDGVXAAGTEVAVCGGRHGEAEAAXVQGPHAAGRQQSPLQPRAQVLRAGQRGLHLXQRGLQAQPGRTPEKTLQEEVQGQLCPQSLHPLSG
HRGGRQGVPRRPGXCRPAPKPHQAALARGPXGPRXQGWWGLQWHWRPSRLLSRQPHXSDTSVLHPRERHSPVXPGPVQVPAGLERPQAAH
RPRDXNPAEQNXEPEGSPRSPEEKAARRMXLSQNQLPHPAQRPPQAQRLQSASFQEGPAREGQGVAVAGAEAQEETPQAAQAPAEQRHVQ
HARPHVLHPRQPALADGAFLDTGAFLCLHQRQQXHVLVHEDHQXDSQFPLLXICNWLPRVLXSQHRPLPADECSEHTGQGCPQPATRTAH

>In-frame_ZMYND8_ENST00000360911_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_761aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000360911_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_761aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000360911_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_743aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000360911_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_758aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000458360_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_761aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000458360_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_761aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000458360_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_743aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000458360_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_758aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000471951_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_761aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000471951_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_761aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000471951_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_743aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000471951_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_758aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000352431_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_761aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000352431_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_761aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000352431_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_743aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000352431_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_758aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000396281_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_766aa
MFSSLQKSFNLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDL
ITNDSVSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQ
TLMSVDDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGL
DIPADMDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCV
EDATGKLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGD
AAQPRNLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNL
REVRGHLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHW
QTAPFWTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPR

>In-frame_ZMYND8_ENST00000396281_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_766aa
MFSSLQKSFNLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDL
ITNDSVSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQ
TLMSVDDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGL
DIPADMDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCV
EDATGKLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGD
AAQPRNLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNL
REVRGHLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHW
QTAPFWTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPR

>In-frame_ZMYND8_ENST00000396281_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_748aa
MFSSLQKSFNLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDL
ITNDSVSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQ
TLMSVDDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGL
DIPADMDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCV
EDATGKLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGD
AAQPRNLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNL
REVRGHLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHW
QTAPFWTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPR

>In-frame_ZMYND8_ENST00000396281_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_763aa
MFSSLQKSFNLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDL
ITNDSVSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQ
TLMSVDDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGL
DIPADMDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCV
EDATGKLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGD
AAQPRNLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNL
REVRGHLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHW
QTAPFWTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPR

>In-frame_ZMYND8_ENST00000536340_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_768aa
MVFLEEFEARSCLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLT
DLITNDSVSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKR
LQTLMSVDDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIA
GLDIPADMDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQ
CVEDATGKLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGL
GDAAQPRNLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIK
NLREVRGHLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQ
HWQTAPFWTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCN

>In-frame_ZMYND8_ENST00000536340_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_768aa
MVFLEEFEARSCLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLT
DLITNDSVSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKR
LQTLMSVDDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIA
GLDIPADMDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQ
CVEDATGKLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGL
GDAAQPRNLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIK
NLREVRGHLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQ
HWQTAPFWTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCN

>In-frame_ZMYND8_ENST00000536340_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_750aa
MVFLEEFEARSCLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLT
DLITNDSVSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKR
LQTLMSVDDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIA
GLDIPADMDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQ
CVEDATGKLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGL
GDAAQPRNLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIK
NLREVRGHLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQ
HWQTAPFWTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCN

>In-frame_ZMYND8_ENST00000536340_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_765aa
MVFLEEFEARSCLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLT
DLITNDSVSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKR
LQTLMSVDDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIA
GLDIPADMDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQ
CVEDATGKLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGL
GDAAQPRNLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIK
NLREVRGHLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQ
HWQTAPFWTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCN

>In-frame_ZMYND8_ENST00000540497_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_761aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000540497_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_761aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000540497_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_743aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000540497_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_758aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000461685_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_761aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000461685_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_761aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000461685_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_743aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000461685_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_758aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000372023_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_761aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000372023_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_761aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000372023_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_743aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD

>In-frame_ZMYND8_ENST00000372023_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_758aa
MHPQSLAEEEIKTEQEVVEGMDISTRSKAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDS
VSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSV
DDSMETIYNMLVETGELDNTYIVYTADHGYHIGQFGLVKGKSMPYEFDIRVPFYVRGPNVEAGCLNPHIVLNIDLAPTILDIAGLDIPAD
MDGKSILKLLDTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQCVEDATG
KLKLHKCKGPMRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPR
NLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRG
HLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPF
WTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZMYND8_ENST00000262975_chr20_45976600_-_SULF2_ENST00000359930_chr20_46319039_-_2071nt
ATGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTA
CCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAA
CGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCAT
CCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCT
GGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAA
ATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCT
CAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGA
CACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACA
CAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTA
CCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCAT
GCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTA
CAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGC
CATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCC
TGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACA
TCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACAT
CGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGA
CTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGA
GAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAG
CATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAG
CGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTA
CTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCAT
GGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCA
ATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTA

>In-frame_ZMYND8_ENST00000262975_chr20_45976600_-_SULF2_ENST00000484875_chr20_46319039_-_2071nt
ATGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTA
CCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAA
CGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCAT
CCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCT
GGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAA
ATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCT
CAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGA
CACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACA
CAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTA
CCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCAT
GCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTA
CAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGC
CATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCC
TGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACA
TCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACAT
CGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGA
CTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGA
GAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAG
CATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAG
CGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTA
CTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCAT
GGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCA
ATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTA

>In-frame_ZMYND8_ENST00000262975_chr20_45976600_-_SULF2_ENST00000361612_chr20_46319039_-_2017nt
ATGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTA
CCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAA
CGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCAT
CCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCT
GGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAA
ATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCT
CAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGA
CACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACA
CAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTA
CCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCAT
GCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTA
CAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGC
CATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCC
TGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACA
TCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACAT
CGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGA
CTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGA
GAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAG
CATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAG
CGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTA
CTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCAT
GGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCA

>In-frame_ZMYND8_ENST00000262975_chr20_45976600_-_SULF2_ENST00000467815_chr20_46319039_-_2062nt
ATGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTA
CCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAA
CGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCAT
CCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCT
GGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAA
ATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCT
CAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGA
CACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACA
CAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTA
CCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCAT
GCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTA
CAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGC
CATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCC
TGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACA
TCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACAT
CGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGA
CTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGA
GAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAG
CATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAG
CGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTA
CTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCAT
GGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGATGGAGGAAGCTATGAGCAATACAGGCA

>In-frame_ZMYND8_ENST00000446994_chr20_45976600_-_SULF2_ENST00000359930_chr20_46319039_-_2071nt
ATGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTA
CCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAA
CGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCAT
CCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCT
GGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAA
ATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCT
CAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGA
CACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACA
CAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTA
CCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCAT
GCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTA
CAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGC
CATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCC
TGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACA
TCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACAT
CGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGA
CTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGA
GAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAG
CATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAG
CGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTA
CTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCAT
GGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCA
ATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTA

>In-frame_ZMYND8_ENST00000446994_chr20_45976600_-_SULF2_ENST00000484875_chr20_46319039_-_2071nt
ATGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTA
CCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAA
CGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCAT
CCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCT
GGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAA
ATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCT
CAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGA
CACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACA
CAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTA
CCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCAT
GCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTA
CAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGC
CATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCC
TGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACA
TCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACAT
CGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGA
CTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGA
GAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAG
CATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAG
CGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTA
CTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCAT
GGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCA
ATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTA

>In-frame_ZMYND8_ENST00000446994_chr20_45976600_-_SULF2_ENST00000361612_chr20_46319039_-_2017nt
ATGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTA
CCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAA
CGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCAT
CCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCT
GGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAA
ATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCT
CAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGA
CACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACA
CAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTA
CCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCAT
GCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTA
CAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGC
CATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCC
TGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACA
TCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACAT
CGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGA
CTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGA
GAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAG
CATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAG
CGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTA
CTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCAT
GGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCA

>In-frame_ZMYND8_ENST00000446994_chr20_45976600_-_SULF2_ENST00000467815_chr20_46319039_-_2062nt
ATGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTA
CCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAA
CGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCAT
CCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCT
GGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAA
ATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCT
CAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGA
CACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACA
CAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTA
CCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCAT
GCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTA
CAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGC
CATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCC
TGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACA
TCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACAT
CGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGA
CTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGA
GAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAG
CATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAG
CGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTA
CTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCAT
GGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGATGGAGGAAGCTATGAGCAATACAGGCA

>In-frame_ZMYND8_ENST00000355972_chr20_45976600_-_SULF2_ENST00000359930_chr20_46319039_-_2071nt
ATGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTA
CCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAA
CGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCAT
CCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCT
GGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAA
ATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCT
CAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGA
CACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACA
CAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTA
CCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCAT
GCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTA
CAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGC
CATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCC
TGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACA
TCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACAT
CGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGA
CTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGA
GAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAG
CATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAG
CGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTA
CTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCAT
GGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCA
ATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTA

>In-frame_ZMYND8_ENST00000355972_chr20_45976600_-_SULF2_ENST00000484875_chr20_46319039_-_2071nt
ATGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTA
CCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAA
CGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCAT
CCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCT
GGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAA
ATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCT
CAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGA
CACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACA
CAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTA
CCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCAT
GCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTA
CAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGC
CATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCC
TGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACA
TCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACAT
CGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGA
CTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGA
GAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAG
CATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAG
CGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTA
CTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCAT
GGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCA
ATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTA

>In-frame_ZMYND8_ENST00000355972_chr20_45976600_-_SULF2_ENST00000361612_chr20_46319039_-_2017nt
ATGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTA
CCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAA
CGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCAT
CCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCT
GGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAA
ATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCT
CAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGA
CACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACA
CAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTA
CCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCAT
GCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTA
CAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGC
CATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCC
TGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACA
TCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACAT
CGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGA
CTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGA
GAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAG
CATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAG
CGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTA
CTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCAT
GGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCA

>In-frame_ZMYND8_ENST00000355972_chr20_45976600_-_SULF2_ENST00000467815_chr20_46319039_-_2062nt
ATGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTA
CCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAA
CGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCAT
CCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCT
GGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAA
ATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCT
CAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGA
CACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACA
CAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTA
CCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCAT
GCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTA
CAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGC
CATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCC
TGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACA
TCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACAT
CGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGA
CTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGA
GAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAG
CATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAG
CGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTA
CTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCAT
GGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGATGGAGGAAGCTATGAGCAATACAGGCA

>In-frame_ZMYND8_ENST00000360911_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_2283nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA

>In-frame_ZMYND8_ENST00000360911_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_2283nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA

>In-frame_ZMYND8_ENST00000360911_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_2229nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC

>In-frame_ZMYND8_ENST00000360911_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_2274nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAA

>In-frame_ZMYND8_ENST00000458360_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_2283nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA

>In-frame_ZMYND8_ENST00000458360_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_2283nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA

>In-frame_ZMYND8_ENST00000458360_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_2229nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC

>In-frame_ZMYND8_ENST00000458360_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_2274nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAA

>In-frame_ZMYND8_ENST00000471951_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_2283nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA

>In-frame_ZMYND8_ENST00000471951_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_2283nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA

>In-frame_ZMYND8_ENST00000471951_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_2229nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC

>In-frame_ZMYND8_ENST00000471951_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_2274nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAA

>In-frame_ZMYND8_ENST00000352431_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_2283nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA

>In-frame_ZMYND8_ENST00000352431_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_2283nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA

>In-frame_ZMYND8_ENST00000352431_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_2229nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC

>In-frame_ZMYND8_ENST00000352431_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_2274nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAA

>In-frame_ZMYND8_ENST00000396281_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_2298nt
ATGTTTTCATCGCTGCAGAAATCCTTCAACTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACT
CGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAA
AACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTC
ATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCC
CACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAAC
CCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAG
ACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACC
GCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTG
AGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTG
GACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATG
AGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTT
CTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTG
GAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAG
TACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAG
AAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGAT
GCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACT
GGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTG
GACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTG
AGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTC
AAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAG
AAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGG
CAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAG
ACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTG
AACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGG
ACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGA

>In-frame_ZMYND8_ENST00000396281_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_2298nt
ATGTTTTCATCGCTGCAGAAATCCTTCAACTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACT
CGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAA
AACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTC
ATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCC
CACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAAC
CCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAG
ACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACC
GCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTG
AGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTG
GACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATG
AGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTT
CTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTG
GAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAG
TACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAG
AAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGAT
GCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACT
GGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTG
GACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTG
AGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTC
AAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAG
AAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGG
CAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAG
ACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTG
AACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGG
ACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGA

>In-frame_ZMYND8_ENST00000396281_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_2244nt
ATGTTTTCATCGCTGCAGAAATCCTTCAACTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACT
CGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAA
AACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTC
ATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCC
CACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAAC
CCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAG
ACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACC
GCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTG
AGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTG
GACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATG
AGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTT
CTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTG
GAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAG
TACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAG
AAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGAT
GCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACT
GGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTG
GACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTG
AGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTC
AAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAG
AAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGG
CAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAG
ACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTG
AACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGG

>In-frame_ZMYND8_ENST00000396281_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_2289nt
ATGTTTTCATCGCTGCAGAAATCCTTCAACTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACT
CGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAA
AACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTC
ATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCC
CACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAAC
CCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAG
ACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACC
GCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTG
AGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTG
GACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATG
AGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTT
CTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTG
GAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAG
TACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAG
AAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGAT
GCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACT
GGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTG
GACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTG
AGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTC
AAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAG
AAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGG
CAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAG
ACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTG
AACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGG
ACTCGAAACATGGACCTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCC

>In-frame_ZMYND8_ENST00000536340_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_2304nt
ATGGTGTTTCTGGAAGAGTTTGAAGCTAGATCCTGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATC
TCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTC
CTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACA
GACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCA
GCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCG
CCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGC
TTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTA
TACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTC
TACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCA
GGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAG
AAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAG
AACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAG
TGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTG
CCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTC
AAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTG
GGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGT
GGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGT
GACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAG
AACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGC
CGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGC
AAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAG
CACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATC
AATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAAT
GCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAAC
CCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATG

>In-frame_ZMYND8_ENST00000536340_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_2304nt
ATGGTGTTTCTGGAAGAGTTTGAAGCTAGATCCTGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATC
TCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTC
CTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACA
GACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCA
GCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCG
CCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGC
TTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTA
TACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTC
TACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCA
GGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAG
AAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAG
AACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAG
TGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTG
CCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTC
AAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTG
GGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGT
GGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGT
GACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAG
AACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGC
CGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGC
AAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAG
CACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATC
AATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAAT
GCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAAC
CCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATG

>In-frame_ZMYND8_ENST00000536340_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_2250nt
ATGGTGTTTCTGGAAGAGTTTGAAGCTAGATCCTGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATC
TCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTC
CTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACA
GACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCA
GCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCG
CCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGC
TTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTA
TACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTC
TACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCA
GGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAG
AAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAG
AACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAG
TGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTG
CCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTC
AAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTG
GGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGT
GGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGT
GACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAG
AACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGC
CGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGC
AAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAG
CACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATC
AATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAAT
GCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAAC
CCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGGGACAACTGTGGGAAGGCTGGGAAGGTTAA

>In-frame_ZMYND8_ENST00000536340_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_2295nt
ATGGTGTTTCTGGAAGAGTTTGAAGCTAGATCCTGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATC
TCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTC
CTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACA
GACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCA
GCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCG
CCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGC
TTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTA
TACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTC
TACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCA
GGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAG
AAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAG
AACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAG
TGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTG
CCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTC
AAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTG
GGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGT
GGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGT
GACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAG
AACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGC
CGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGC
AAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAG
CACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATC
AATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAAT
GCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAAC
CCCCGGACTCGAAACATGGACCTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCT

>In-frame_ZMYND8_ENST00000540497_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_2283nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA

>In-frame_ZMYND8_ENST00000540497_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_2283nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA

>In-frame_ZMYND8_ENST00000540497_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_2229nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC

>In-frame_ZMYND8_ENST00000540497_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_2274nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAA

>In-frame_ZMYND8_ENST00000461685_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_2283nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA

>In-frame_ZMYND8_ENST00000461685_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_2283nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA

>In-frame_ZMYND8_ENST00000461685_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_2229nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC

>In-frame_ZMYND8_ENST00000461685_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_2274nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAA

>In-frame_ZMYND8_ENST00000372023_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_2283nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA

>In-frame_ZMYND8_ENST00000372023_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_2283nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA

>In-frame_ZMYND8_ENST00000372023_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_2229nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC

>In-frame_ZMYND8_ENST00000372023_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_2274nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZMYND8_ENST00000262975_chr20_45976600_-_SULF2_ENST00000359930_chr20_46319039_-_3805nt
CGGCTTTACACTCCGATTTGCCGGGGCAGCCAATCGGGGATGAGCTTTTATTAGGCGGCCAGATCATCAGCCGAAGTGCCAAACCCTTTT
TCTGTGAGAACTAGGAGCCTGTCCTCCATGTTTTATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGTCCCAAATCTGCC
AGCCTGTTCTCTCTTCCTAACTGTGGAAAAATGAGACGGTTGCTTGAACATTTGTTGGCTTGGCTGAAGAGGAAATAAAAACAGAACAGG
AGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACG
TCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCA
CGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGG
CCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACG
ATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGC
CTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAAT
CCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATC
CTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGA
GGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGT
CAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAG
TGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGT
GACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCC
ATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCAC
TGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCC
ATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGAC
CACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGG
CCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGG
AAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAAC
AACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTC
TGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACT
GGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTA
CACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGA
GGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAA
GGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTG
ATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAG
CAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCG
TATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCC
AAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGG
AACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACAT
TTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTT
TTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGT
TGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGA
AAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTC
AAAACCCCAGCCAATGACCAGCAGTTGGTATGAAGAACCTTTGACATTTTGTAAAAGGCCATTTCTTGGGAGTTTTTTGGTGTGTCTGTT
TTTTTAAAGTATTCAAGATACTACCAGTCAACATCTTTTTGGAAGAAAATGCCTTGGGTTTAGAAGATTTTCTTAAAAGGGGAGTAGATG
GTTGTAGATTGACTAAAAAGTCTACCATACTTCAAGGGACTACAGGTAAGTCTCATAGTATACCAGCTTTGGTACTTCATTTTTTAAAAA
AGTATTAATCAATTGCAAAGAAATTCGCCTTGGCCAACCCTTCTTTGTGTATCAGGTAGTCTAACCTGATACAAGTAGTTGACAGATTTC
AACTATCAATCACCAGTCCAACCCATTTCTCATTTAACAGATGACGGAGATAATCCCTAAAAGCACCCACATTTGTTTCAATGCCCCAAA
CAGGCCAAGGCTCCCTAGCAACTCCCTAGTGGCGTTTTTTAACTTCTCAGAAACTGTTACCATTATTTGAAATAGGCTTCCTTAACCTCC

>In-frame_ZMYND8_ENST00000262975_chr20_45976600_-_SULF2_ENST00000484875_chr20_46319039_-_3311nt
CGGCTTTACACTCCGATTTGCCGGGGCAGCCAATCGGGGATGAGCTTTTATTAGGCGGCCAGATCATCAGCCGAAGTGCCAAACCCTTTT
TCTGTGAGAACTAGGAGCCTGTCCTCCATGTTTTATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGTCCCAAATCTGCC
AGCCTGTTCTCTCTTCCTAACTGTGGAAAAATGAGACGGTTGCTTGAACATTTGTTGGCTTGGCTGAAGAGGAAATAAAAACAGAACAGG
AGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACG
TCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCA
CGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGG
CCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACG
ATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGC
CTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAAT
CCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATC
CTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGA
GGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGT
CAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAG
TGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGT
GACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCC
ATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCAC
TGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCC
ATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGAC
CACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGG
CCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGG
AAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAAC
AACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTC
TGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACT
GGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTA
CACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGA
GGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAA
GGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTG
ATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAG
CAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCG
TATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCC
AAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGG
AACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACAT
TTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTT
TTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGT
TGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGA
AAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTC

>In-frame_ZMYND8_ENST00000262975_chr20_45976600_-_SULF2_ENST00000361612_chr20_46319039_-_3256nt
CGGCTTTACACTCCGATTTGCCGGGGCAGCCAATCGGGGATGAGCTTTTATTAGGCGGCCAGATCATCAGCCGAAGTGCCAAACCCTTTT
TCTGTGAGAACTAGGAGCCTGTCCTCCATGTTTTATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGTCCCAAATCTGCC
AGCCTGTTCTCTCTTCCTAACTGTGGAAAAATGAGACGGTTGCTTGAACATTTGTTGGCTTGGCTGAAGAGGAAATAAAAACAGAACAGG
AGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACG
TCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCA
CGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGG
CCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACG
ATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGC
CTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAAT
CCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATC
CTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGA
GGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGT
CAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAG
TGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGT
GACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCC
ATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCAC
TGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCC
ATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGAC
CACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGG
CCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGG
AAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAAC
AACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTC
TGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACT
GGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTA
CACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGA
GGAAGCTATGAGCAATACAGGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATC
ACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCAC
TCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGA
TTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGA
GAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCT
AAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACG
TTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATA
TATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAAC
GCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTA
TGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAA
AAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAAGAACCTTTGACATTTTGTAA

>In-frame_ZMYND8_ENST00000262975_chr20_45976600_-_SULF2_ENST00000467815_chr20_46319039_-_3040nt
CGGCTTTACACTCCGATTTGCCGGGGCAGCCAATCGGGGATGAGCTTTTATTAGGCGGCCAGATCATCAGCCGAAGTGCCAAACCCTTTT
TCTGTGAGAACTAGGAGCCTGTCCTCCATGTTTTATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGTCCCAAATCTGCC
AGCCTGTTCTCTCTTCCTAACTGTGGAAAAATGAGACGGTTGCTTGAACATTTGTTGGCTTGGCTGAAGAGGAAATAAAAACAGAACAGG
AGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACG
TCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCA
CGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGG
CCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACG
ATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGC
CTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAAT
CCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATC
CTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGA
GGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGT
CAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAG
TGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGT
GACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCC
ATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCAC
TGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCC
ATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGAC
CACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGG
CCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGG
AAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAAC
AACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTC
TGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACT
GGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTA
CACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGATGGAGGAAGCTAT
GAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAA
GGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGC
AGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAG
AGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAA
GTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAA
AGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAA
GCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGC
ACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAA

>In-frame_ZMYND8_ENST00000446994_chr20_45976600_-_SULF2_ENST00000359930_chr20_46319039_-_3610nt
GTTAATTCTCAGGCTCTGTTGGGGGTGGTCAGAAATCTAATTTCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCA
TGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTAC
CCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAAC
GCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATC
CACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTG
GTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAA
TCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTC
AACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGAC
ACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACAC
AAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTAC
CAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATG
CGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTAC
AAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCC
ATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCT
GAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACAT
CGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATC
GACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGAC
TGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAG
AAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGC
ATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGC
GCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTAC
TTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATG
GAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAA
TACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAA
GAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCT
GTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAA
CTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACC
ACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCAT
TGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGA
CAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATA
AACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAAT
AAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGT
TCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTG
ATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAAT
GACCAGCAGTTGGTATGAAGAACCTTTGACATTTTGTAAAAGGCCATTTCTTGGGAGTTTTTTGGTGTGTCTGTTTTTTTAAAGTATTCA
AGATACTACCAGTCAACATCTTTTTGGAAGAAAATGCCTTGGGTTTAGAAGATTTTCTTAAAAGGGGAGTAGATGGTTGTAGATTGACTA
AAAAGTCTACCATACTTCAAGGGACTACAGGTAAGTCTCATAGTATACCAGCTTTGGTACTTCATTTTTTAAAAAAGTATTAATCAATTG
CAAAGAAATTCGCCTTGGCCAACCCTTCTTTGTGTATCAGGTAGTCTAACCTGATACAAGTAGTTGACAGATTTCAACTATCAATCACCA
GTCCAACCCATTTCTCATTTAACAGATGACGGAGATAATCCCTAAAAGCACCCACATTTGTTTCAATGCCCCAAACAGGCCAAGGCTCCC
TAGCAACTCCCTAGTGGCGTTTTTTAACTTCTCAGAAACTGTTACCATTATTTGAAATAGGCTTCCTTAACCTCCTTTACCCTTAACCCA

>In-frame_ZMYND8_ENST00000446994_chr20_45976600_-_SULF2_ENST00000484875_chr20_46319039_-_3116nt
GTTAATTCTCAGGCTCTGTTGGGGGTGGTCAGAAATCTAATTTCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCA
TGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTAC
CCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAAC
GCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATC
CACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTG
GTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAA
TCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTC
AACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGAC
ACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACAC
AAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTAC
CAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATG
CGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTAC
AAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCC
ATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCT
GAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACAT
CGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATC
GACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGAC
TGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAG
AAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGC
ATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGC
GCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTAC
TTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATG
GAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAA
TACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAA
GAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCT
GTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAA
CTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACC
ACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCAT
TGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGA
CAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATA
AACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAAT
AAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGT
TCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTG
ATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAAT

>In-frame_ZMYND8_ENST00000446994_chr20_45976600_-_SULF2_ENST00000361612_chr20_46319039_-_3061nt
GTTAATTCTCAGGCTCTGTTGGGGGTGGTCAGAAATCTAATTTCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCA
TGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTAC
CCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAAC
GCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATC
CACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTG
GTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAA
TCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTC
AACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGAC
ACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACAC
AAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTAC
CAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATG
CGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTAC
AAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCC
ATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCT
GAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACAT
CGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATC
GACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGAC
TGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAG
AAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGC
ATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGC
GCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTAC
TTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATG
GAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAA
TACAGGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGG
CAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGA
CAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGC
TGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAG
ATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCT
TTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCA
GTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTAC
ATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTG
TAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGAT
GTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTT
AAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAAGAACCTTTGACATTTTGTAAAAGGCCATTTCTTGG

>In-frame_ZMYND8_ENST00000446994_chr20_45976600_-_SULF2_ENST00000467815_chr20_46319039_-_2845nt
GTTAATTCTCAGGCTCTGTTGGGGGTGGTCAGAAATCTAATTTCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCA
TGGATATCTCTACTCGCTCCAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTAC
CCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAAC
GCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATC
CACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTG
GTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAA
TCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTC
AACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGAC
ACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACAC
AAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTAC
CAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATG
CGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTAC
AAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCC
ATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCT
GAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACAT
CGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATC
GACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGAC
TGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAG
AAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGC
ATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGC
GCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTAC
TTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATG
GAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGATGGAGGAAGCTATGAGCAATACAGGCAG
TTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACA
GAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTG
GCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAA
GTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCT
CCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTT
TAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAA
CGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGT
TGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCC

>In-frame_ZMYND8_ENST00000355972_chr20_45976600_-_SULF2_ENST00000359930_chr20_46319039_-_3681nt
ATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGTCCCAAATCTGCCAGCCTGTTCTCTCTTCCTAACTGTGGAAAAATGA
GACGGTTGCTTGAACATTTGTTGGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTC
CAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCA
TGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGC
CGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACA
TGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGG
ACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTG
ACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCA
CCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATC
GGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGG
TGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGC
TGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAG
CCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGAC
GCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGG
TGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGG
ATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGA
ACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCC
TGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACC
ACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGT
TGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCT
TCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACT
GGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACC
CCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGG
GTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTC
GAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACC
TCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGC
CTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTT
GCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAG
CTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAG
GGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGG
CTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAA
GAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAG
GAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTT
CTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTG
ATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAA
GAACCTTTGACATTTTGTAAAAGGCCATTTCTTGGGAGTTTTTTGGTGTGTCTGTTTTTTTAAAGTATTCAAGATACTACCAGTCAACAT
CTTTTTGGAAGAAAATGCCTTGGGTTTAGAAGATTTTCTTAAAAGGGGAGTAGATGGTTGTAGATTGACTAAAAAGTCTACCATACTTCA
AGGGACTACAGGTAAGTCTCATAGTATACCAGCTTTGGTACTTCATTTTTTAAAAAAGTATTAATCAATTGCAAAGAAATTCGCCTTGGC
CAACCCTTCTTTGTGTATCAGGTAGTCTAACCTGATACAAGTAGTTGACAGATTTCAACTATCAATCACCAGTCCAACCCATTTCTCATT
TAACAGATGACGGAGATAATCCCTAAAAGCACCCACATTTGTTTCAATGCCCCAAACAGGCCAAGGCTCCCTAGCAACTCCCTAGTGGCG

>In-frame_ZMYND8_ENST00000355972_chr20_45976600_-_SULF2_ENST00000484875_chr20_46319039_-_3187nt
ATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGTCCCAAATCTGCCAGCCTGTTCTCTCTTCCTAACTGTGGAAAAATGA
GACGGTTGCTTGAACATTTGTTGGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTC
CAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCA
TGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGC
CGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACA
TGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGG
ACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTG
ACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCA
CCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATC
GGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGG
TGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGC
TGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAG
CCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGAC
GCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGG
TGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGG
ATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGA
ACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCC
TGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACC
ACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGT
TGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCT
TCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACT
GGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACC
CCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGG
GTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTC
GAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACC
TCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGC
CTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTT
GCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAG
CTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAG
GGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGG
CTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAA
GAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAG
GAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTT
CTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTG
ATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAA

>In-frame_ZMYND8_ENST00000355972_chr20_45976600_-_SULF2_ENST00000361612_chr20_46319039_-_3132nt
ATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGTCCCAAATCTGCCAGCCTGTTCTCTCTTCCTAACTGTGGAAAAATGA
GACGGTTGCTTGAACATTTGTTGGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTC
CAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCA
TGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGC
CGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACA
TGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGG
ACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTG
ACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCA
CCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATC
GGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGG
TGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGC
TGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAG
CCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGAC
GCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGG
TGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGG
ATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGA
ACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCC
TGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACC
ACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGT
TGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCT
TCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACT
GGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACC
CCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGG
GTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGGGACAACTGTGGG
AAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGG
TGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACC
AGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTT
CGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTC
CCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAA
GGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGAC
ATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAAC
TTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCA
GTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACT
GAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGT

>In-frame_ZMYND8_ENST00000355972_chr20_45976600_-_SULF2_ENST00000467815_chr20_46319039_-_2916nt
ATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGTCCCAAATCTGCCAGCCTGTTCTCTCTTCCTAACTGTGGAAAAATGA
GACGGTTGCTTGAACATTTGTTGGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTC
CAAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCA
TGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGC
CGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACA
TGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGG
ACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTG
ACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCA
CCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATC
GGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGG
TGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGC
TGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAG
CCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGAC
GCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGG
TGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGG
ATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGA
ACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCC
TGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACC
ACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGT
TGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCT
TCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACT
GGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACC
CCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGG
GTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGC
CAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAAC
ATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAG
CAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCT
TTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAG
GAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGC
AGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACA
GTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCC
TTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGG

>In-frame_ZMYND8_ENST00000360911_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_3769nt
ATGTTTTATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTA
GAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAG
GAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCC
AAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATG
GTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCG
AGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATG
CTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGAC
AACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGAC
ATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACC
ATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGG
TTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTG
GACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTG
GGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCC
CTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGC
CGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTG
TACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGAT
GGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAAC
GACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTG
CAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCAC
ACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTG
CGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTC
ACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGG
TGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCC
TACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGT
TACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGA
AAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTC
CAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCT
GAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGC
CCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCT
CACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGG
GAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCT
GAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGA
AACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGA
GTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCT
CCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGAT
GAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAAGA
ACCTTTGACATTTTGTAAAAGGCCATTTCTTGGGAGTTTTTTGGTGTGTCTGTTTTTTTAAAGTATTCAAGATACTACCAGTCAACATCT
TTTTGGAAGAAAATGCCTTGGGTTTAGAAGATTTTCTTAAAAGGGGAGTAGATGGTTGTAGATTGACTAAAAAGTCTACCATACTTCAAG
GGACTACAGGTAAGTCTCATAGTATACCAGCTTTGGTACTTCATTTTTTAAAAAAGTATTAATCAATTGCAAAGAAATTCGCCTTGGCCA
ACCCTTCTTTGTGTATCAGGTAGTCTAACCTGATACAAGTAGTTGACAGATTTCAACTATCAATCACCAGTCCAACCCATTTCTCATTTA
ACAGATGACGGAGATAATCCCTAAAAGCACCCACATTTGTTTCAATGCCCCAAACAGGCCAAGGCTCCCTAGCAACTCCCTAGTGGCGTT

>In-frame_ZMYND8_ENST00000360911_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_3275nt
ATGTTTTATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTA
GAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAG
GAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCC
AAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATG
GTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCG
AGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATG
CTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGAC
AACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGAC
ATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACC
ATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGG
TTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTG
GACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTG
GGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCC
CTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGC
CGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTG
TACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGAT
GGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAAC
GACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTG
CAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCAC
ACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTG
CGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTC
ACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGG
TGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCC
TACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGT
TACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGA
AAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTC
CAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCT
GAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGC
CCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCT
CACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGG
GAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCT
GAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGA
AACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGA
GTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCT
CCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGAT
GAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAAGA

>In-frame_ZMYND8_ENST00000360911_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_3220nt
ATGTTTTATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTA
GAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAG
GAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCC
AAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATG
GTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCG
AGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATG
CTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGAC
AACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGAC
ATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACC
ATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGG
TTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTG
GACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTG
GGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCC
CTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGC
CGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTG
TACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGAT
GGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAAC
GACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTG
CAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCAC
ACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTG
CGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTC
ACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGG
TGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCC
TACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGT
TACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGGGACAACTGTGGGAA
GGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTG
ATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAG
CAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCG
TATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCC
AAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGG
AACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACAT
TTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTT
TTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGT
TGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGA
AAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTC

>In-frame_ZMYND8_ENST00000360911_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_3004nt
ATGTTTTATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTA
GAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAG
GAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCC
AAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATG
GTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCG
AGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATG
CTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGAC
AACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGAC
ATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACC
ATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGG
TTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTG
GACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTG
GGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCC
CTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGC
CGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTG
TACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGAT
GGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAAC
GACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTG
CAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCAC
ACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTG
CGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTC
ACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGG
TGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCC
TACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGT
TACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCA
GAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACAT
AGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCA
AGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTT
TGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGA
AAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAG
TCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGT
GCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTT
CATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTG

>In-frame_ZMYND8_ENST00000458360_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_3783nt
GGAGCCTGTCCTCCATGTTTTATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAG
AACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGC
CACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACG
GCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACA
GGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTC
AGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGG
AATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGA
CGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGC
CATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTG
ACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGC
GGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAG
ACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGG
CGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGG
GCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCA
GCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGG
TGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACC
AAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCT
ACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACG
AGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACA
AAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACA
AGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAG
GCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACA
ATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATC
TCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGA
GGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGC
AGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAA
CAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTAT
TGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGG
AAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACC
CTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATT
TTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGC
AACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTG
GTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAAT
CCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTC
CAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATG
TCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGC
AGTTGGTATGAAGAACCTTTGACATTTTGTAAAAGGCCATTTCTTGGGAGTTTTTTGGTGTGTCTGTTTTTTTAAAGTATTCAAGATACT
ACCAGTCAACATCTTTTTGGAAGAAAATGCCTTGGGTTTAGAAGATTTTCTTAAAAGGGGAGTAGATGGTTGTAGATTGACTAAAAAGTC
TACCATACTTCAAGGGACTACAGGTAAGTCTCATAGTATACCAGCTTTGGTACTTCATTTTTTAAAAAAGTATTAATCAATTGCAAAGAA
ATTCGCCTTGGCCAACCCTTCTTTGTGTATCAGGTAGTCTAACCTGATACAAGTAGTTGACAGATTTCAACTATCAATCACCAGTCCAAC
CCATTTCTCATTTAACAGATGACGGAGATAATCCCTAAAAGCACCCACATTTGTTTCAATGCCCCAAACAGGCCAAGGCTCCCTAGCAAC
TCCCTAGTGGCGTTTTTTAACTTCTCAGAAACTGTTACCATTATTTGAAATAGGCTTCCTTAACCTCCTTTACCCTTAACCCAACAGGGA

>In-frame_ZMYND8_ENST00000458360_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_3289nt
GGAGCCTGTCCTCCATGTTTTATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAG
AACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGC
CACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACG
GCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACA
GGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTC
AGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGG
AATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGA
CGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGC
CATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTG
ACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGC
GGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAG
ACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGG
CGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGG
GCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCA
GCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGG
TGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACC
AAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCT
ACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACG
AGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACA
AAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACA
AGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAG
GCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACA
ATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATC
TCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGA
GGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGC
AGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAA
CAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTAT
TGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGG
AAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACC
CTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATT
TTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGC
AACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTG
GTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAAT
CCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTC
CAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATG
TCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGC

>In-frame_ZMYND8_ENST00000458360_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_3234nt
GGAGCCTGTCCTCCATGTTTTATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAG
AACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGC
CACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACG
GCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACA
GGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTC
AGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGG
AATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGA
CGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGC
CATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTG
ACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGC
GGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAG
ACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGG
CGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGG
GCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCA
GCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGG
TGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACC
AAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCT
ACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACG
AGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACA
AAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACA
AGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAG
GCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACA
ATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATC
TCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGA
GGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGG
GACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAA
AAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTC
TGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAA
AATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCT
TGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTT
TGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCAC
AAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAAT
CAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGA
AAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTT
TTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATT

>In-frame_ZMYND8_ENST00000458360_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_3018nt
GGAGCCTGTCCTCCATGTTTTATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAG
AACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGC
CACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACG
GCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACA
GGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTC
AGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGG
AATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGA
CGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGC
CATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTG
ACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGC
GGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAG
ACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGG
CGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGG
GCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCA
GCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGG
TGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACC
AAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCT
ACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACG
AGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACA
AAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACA
AGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAG
GCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACA
ATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATC
TCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGA
GGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGC
GTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGG
ACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGA
GGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATT
TTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAG
AAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCA
TAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAG
AGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCT
GAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTT

>In-frame_ZMYND8_ENST00000471951_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_3760nt
AAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATG
GATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTC
GGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTAC
CTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGC
CATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAAC
TACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGG
AAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTAC
ATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTC
CCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGAC
ATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTG
AAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAG
GAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAG
TGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAAC
CTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAA
CTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTA
GGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGAC
TTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTC
CAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAA
ATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCAC
AAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAG
AAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGAC
AACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGG
ACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTG
ATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAG
TGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCA
GAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACAT
AGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCA
AGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTT
TGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGA
AAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAG
TCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGT
GCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTT
CATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTG
TCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATT
TCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTA
TTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAAGAACCTTTGAC
ATTTTGTAAAAGGCCATTTCTTGGGAGTTTTTTGGTGTGTCTGTTTTTTTAAAGTATTCAAGATACTACCAGTCAACATCTTTTTGGAAG
AAAATGCCTTGGGTTTAGAAGATTTTCTTAAAAGGGGAGTAGATGGTTGTAGATTGACTAAAAAGTCTACCATACTTCAAGGGACTACAG
GTAAGTCTCATAGTATACCAGCTTTGGTACTTCATTTTTTAAAAAAGTATTAATCAATTGCAAAGAAATTCGCCTTGGCCAACCCTTCTT
TGTGTATCAGGTAGTCTAACCTGATACAAGTAGTTGACAGATTTCAACTATCAATCACCAGTCCAACCCATTTCTCATTTAACAGATGAC
GGAGATAATCCCTAAAAGCACCCACATTTGTTTCAATGCCCCAAACAGGCCAAGGCTCCCTAGCAACTCCCTAGTGGCGTTTTTTAACTT

>In-frame_ZMYND8_ENST00000471951_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_3266nt
AAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATG
GATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTC
GGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTAC
CTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGC
CATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAAC
TACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGG
AAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTAC
ATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTC
CCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGAC
ATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTG
AAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAG
GAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAG
TGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAAC
CTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAA
CTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTA
GGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGAC
TTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTC
CAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAA
ATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCAC
AAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAG
AAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGAC
AACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGG
ACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTG
ATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAG
TGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCA
GAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACAT
AGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCA
AGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTT
TGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGA
AAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAG
TCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGT
GCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTT
CATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTG
TCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATT
TCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTA
TTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAAGAACCTTTGAC

>In-frame_ZMYND8_ENST00000471951_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_3211nt
AAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATG
GATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTC
GGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTAC
CTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGC
CATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAAC
TACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGG
AAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTAC
ATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTC
CCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGAC
ATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTG
AAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAG
GAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAG
TGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAAC
CTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAA
CTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTA
GGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGAC
TTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTC
CAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAA
ATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCAC
AAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAG
AAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGAC
AACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGG
ACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTG
ATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAG
TGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGGGACAACTGTGGGAAGGCTGGGAA
GGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGC
AGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAG
AGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAA
GTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAA
AGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAA
GCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGC
ACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAA
CCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACAT
TTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATG
AAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCA

>In-frame_ZMYND8_ENST00000471951_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_2995nt
AAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATG
GATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTC
GGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTAC
CTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGC
CATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAAC
TACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGG
AAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTAC
ATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTC
CCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGAC
ATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTG
AAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAG
GAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAG
TGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAAC
CTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAA
CTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTA
GGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGAC
TTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTC
CAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAA
ATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCAC
AAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAG
AAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGAC
AACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGG
ACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTG
ATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAG
TGTAACCCCCGGACTCGAAACATGGACCTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAG
AGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATC
ACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCAC
TCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGA
TTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGA
GAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCT
AAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACG
TTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATA
TATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAAC

>In-frame_ZMYND8_ENST00000352431_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_3762nt
ATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCA
TGGATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGG
TCGGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATT
ACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCA
GCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACA
ACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGC
GGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGT
ACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGG
TCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGG
ACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACT
TGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCC
AGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGA
AGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCA
ACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAA
AACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACG
TAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGG
ACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAG
TCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACA
AAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGC
ACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGC
AGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACG
ACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGA
GGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGC
TGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGC
AGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGC
CAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAAC
ATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAG
CAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCT
TTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAG
GAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGC
AGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACA
GTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCC
TTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGG
TGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTA
TTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTG
TATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAAGAACCTTTG
ACATTTTGTAAAAGGCCATTTCTTGGGAGTTTTTTGGTGTGTCTGTTTTTTTAAAGTATTCAAGATACTACCAGTCAACATCTTTTTGGA
AGAAAATGCCTTGGGTTTAGAAGATTTTCTTAAAAGGGGAGTAGATGGTTGTAGATTGACTAAAAAGTCTACCATACTTCAAGGGACTAC
AGGTAAGTCTCATAGTATACCAGCTTTGGTACTTCATTTTTTAAAAAAGTATTAATCAATTGCAAAGAAATTCGCCTTGGCCAACCCTTC
TTTGTGTATCAGGTAGTCTAACCTGATACAAGTAGTTGACAGATTTCAACTATCAATCACCAGTCCAACCCATTTCTCATTTAACAGATG
ACGGAGATAATCCCTAAAAGCACCCACATTTGTTTCAATGCCCCAAACAGGCCAAGGCTCCCTAGCAACTCCCTAGTGGCGTTTTTTAAC

>In-frame_ZMYND8_ENST00000352431_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_3268nt
ATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCA
TGGATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGG
TCGGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATT
ACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCA
GCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACA
ACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGC
GGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGT
ACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGG
TCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGG
ACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACT
TGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCC
AGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGA
AGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCA
ACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAA
AACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACG
TAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGG
ACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAG
TCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACA
AAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGC
ACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGC
AGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACG
ACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGA
GGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGC
TGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGC
AGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGC
CAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAAC
ATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAG
CAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCT
TTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAG
GAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGC
AGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACA
GTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCC
TTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGG
TGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTA
TTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTG
TATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAAGAACCTTTG

>In-frame_ZMYND8_ENST00000352431_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_3213nt
ATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCA
TGGATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGG
TCGGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATT
ACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCA
GCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACA
ACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGC
GGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGT
ACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGG
TCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGG
ACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACT
TGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCC
AGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGA
AGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCA
ACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAA
AACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACG
TAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGG
ACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAG
TCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACA
AAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGC
ACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGC
AGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACG
ACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGA
GGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGC
TGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGC
AGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGGGACAACTGTGGGAAGGCTGGG
AAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCA
GCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGC
AGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAA
AAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCG
AAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAG
AAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTA
GCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGG
AACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGAC
ATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAA
TGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCC

>In-frame_ZMYND8_ENST00000352431_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_2997nt
ATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCA
TGGATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGG
TCGGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATT
ACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCA
GCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACA
ACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGC
GGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGT
ACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGG
TCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGG
ACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACT
TGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCC
AGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGA
AGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCA
ACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAA
AACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACG
TAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGG
ACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAG
TCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACA
AAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGC
ACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGC
AGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACG
ACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGA
GGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGC
TGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGC
AGTGTAACCCCCGGACTCGAAACATGGACCTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGA
AGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCA
TCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGC
ACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTG
GATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGA
GAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTT
CTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGA
CGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTA
TATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAA

>In-frame_ZMYND8_ENST00000396281_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_3961nt
ATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGTCCCAAATCTGCCAGCCTGTTCTCTCTTCCTAACTGTGGAAAAATGA
GACGGTTGCTTGAACATTTGTTGGCAGCATTCCTGCCTGAAGTATTCAGCTCCTCTAGGCTGTTACAAGCCAAATAATGGTTCCCTTGAA
TGCAGCCTTCCTCCATGATCAATACACCTTTGAATGTTTTCATCGCTGCAGAAATCCTTCAACTTGGCTGAAGAGGAAATAAAAACAGAA
CAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCA
CCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGC
TCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGG
CCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAG
CACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAA
TTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACG
GGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCA
TATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGAC
CTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGG
CCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGAC
AATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCG
TGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGC
GGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGC
CTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTG
GACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAA
GATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTAC
ATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAG
ATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAA
ATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAG
GTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGC
CTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAAT
AACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTC
AACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGG
AGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAG
TTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACA
GAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTG
GCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAA
GTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCT
CCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTT
TAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAA
CGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGT
TGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCC
CAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCA
GATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTC
CCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAG
TTGGTATGAAGAACCTTTGACATTTTGTAAAAGGCCATTTCTTGGGAGTTTTTTGGTGTGTCTGTTTTTTTAAAGTATTCAAGATACTAC
CAGTCAACATCTTTTTGGAAGAAAATGCCTTGGGTTTAGAAGATTTTCTTAAAAGGGGAGTAGATGGTTGTAGATTGACTAAAAAGTCTA
CCATACTTCAAGGGACTACAGGTAAGTCTCATAGTATACCAGCTTTGGTACTTCATTTTTTAAAAAAGTATTAATCAATTGCAAAGAAAT
TCGCCTTGGCCAACCCTTCTTTGTGTATCAGGTAGTCTAACCTGATACAAGTAGTTGACAGATTTCAACTATCAATCACCAGTCCAACCC
ATTTCTCATTTAACAGATGACGGAGATAATCCCTAAAAGCACCCACATTTGTTTCAATGCCCCAAACAGGCCAAGGCTCCCTAGCAACTC
CCTAGTGGCGTTTTTTAACTTCTCAGAAACTGTTACCATTATTTGAAATAGGCTTCCTTAACCTCCTTTACCCTTAACCCAACAGGGATT

>In-frame_ZMYND8_ENST00000396281_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_3467nt
ATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGTCCCAAATCTGCCAGCCTGTTCTCTCTTCCTAACTGTGGAAAAATGA
GACGGTTGCTTGAACATTTGTTGGCAGCATTCCTGCCTGAAGTATTCAGCTCCTCTAGGCTGTTACAAGCCAAATAATGGTTCCCTTGAA
TGCAGCCTTCCTCCATGATCAATACACCTTTGAATGTTTTCATCGCTGCAGAAATCCTTCAACTTGGCTGAAGAGGAAATAAAAACAGAA
CAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCA
CCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGC
TCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGG
CCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAG
CACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAA
TTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACG
GGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCA
TATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGAC
CTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGG
CCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGAC
AATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCG
TGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGC
GGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGC
CTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTG
GACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAA
GATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTAC
ATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAG
ATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAA
ATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAG
GTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGC
CTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAAT
AACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTC
AACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGG
AGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAG
TTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACA
GAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTG
GCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAA
GTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCT
CCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTT
TAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAA
CGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGT
TGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCC
CAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCA
GATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTC
CCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAG

>In-frame_ZMYND8_ENST00000396281_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_3412nt
ATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGTCCCAAATCTGCCAGCCTGTTCTCTCTTCCTAACTGTGGAAAAATGA
GACGGTTGCTTGAACATTTGTTGGCAGCATTCCTGCCTGAAGTATTCAGCTCCTCTAGGCTGTTACAAGCCAAATAATGGTTCCCTTGAA
TGCAGCCTTCCTCCATGATCAATACACCTTTGAATGTTTTCATCGCTGCAGAAATCCTTCAACTTGGCTGAAGAGGAAATAAAAACAGAA
CAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCA
CCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGC
TCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGG
CCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAG
CACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAA
TTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACG
GGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCA
TATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGAC
CTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGG
CCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGAC
AATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCG
TGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGC
GGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGC
CTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTG
GACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAA
GATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTAC
ATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAG
ATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAA
ATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAG
GTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGC
CTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAAT
AACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTC
AACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGG
AGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGGGA
CAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAA
ACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTG
GAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAA
TGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTG
GAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTG
TCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAA
AAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCA
ACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAA
ATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTT
TTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGT

>In-frame_ZMYND8_ENST00000396281_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_3196nt
ATAAGTATTGACATTACACAGTGTTAACAATGCATCCACAGAGTCCCAAATCTGCCAGCCTGTTCTCTCTTCCTAACTGTGGAAAAATGA
GACGGTTGCTTGAACATTTGTTGGCAGCATTCCTGCCTGAAGTATTCAGCTCCTCTAGGCTGTTACAAGCCAAATAATGGTTCCCTTGAA
TGCAGCCTTCCTCCATGATCAATACACCTTTGAATGTTTTCATCGCTGCAGAAATCCTTCAACTTGGCTGAAGAGGAAATAAAAACAGAA
CAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCA
CCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGC
TCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGG
CCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAG
CACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAA
TTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACG
GGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCA
TATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGAC
CTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGG
CCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGAC
AATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCG
TGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGC
GGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGC
CTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTG
GACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAA
GATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTAC
ATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAG
ATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAA
ATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAG
GTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGC
CTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAAT
AACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTC
AACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGG
AGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGACCTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGT
CGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGAC
CTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGG
CCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTT
TGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAA
GCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATA
GGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAG
GCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGA
AGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCA

>In-frame_ZMYND8_ENST00000536340_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_3836nt
GTCACATGGCTCAGTAGCCATTAGCCATAGCTTGATTTTGCAAACTGGCAAGGGCCTGGCACACCTTTCCTTCCACCAGGGCATGGTGTT
TCTGGAAGAGTTTGAAGCTAGATCCTGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCG
CTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAA
CTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCAT
CACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCA
CGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCC
GGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGAC
CCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGC
CGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAG
GGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGA
CATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAG
GGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCT
GCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGA
GGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTA
CTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAA
GTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGC
CGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGG
AGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGA
CCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAG
GGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAA
GCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAA
ACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCA
GACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGAC
TCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAA
CACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGAC
TCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACC
TTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTG
ACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCA
GTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATA
CCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCG
AGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATC
CTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGA
CAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGT
GACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCT
GTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCC
CAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAAT
TTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAAGAACCTTTGACATTTTGTAAAAGGC
CATTTCTTGGGAGTTTTTTGGTGTGTCTGTTTTTTTAAAGTATTCAAGATACTACCAGTCAACATCTTTTTGGAAGAAAATGCCTTGGGT
TTAGAAGATTTTCTTAAAAGGGGAGTAGATGGTTGTAGATTGACTAAAAAGTCTACCATACTTCAAGGGACTACAGGTAAGTCTCATAGT
ATACCAGCTTTGGTACTTCATTTTTTAAAAAAGTATTAATCAATTGCAAAGAAATTCGCCTTGGCCAACCCTTCTTTGTGTATCAGGTAG
TCTAACCTGATACAAGTAGTTGACAGATTTCAACTATCAATCACCAGTCCAACCCATTTCTCATTTAACAGATGACGGAGATAATCCCTA
AAAGCACCCACATTTGTTTCAATGCCCCAAACAGGCCAAGGCTCCCTAGCAACTCCCTAGTGGCGTTTTTTAACTTCTCAGAAACTGTTA

>In-frame_ZMYND8_ENST00000536340_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_3342nt
GTCACATGGCTCAGTAGCCATTAGCCATAGCTTGATTTTGCAAACTGGCAAGGGCCTGGCACACCTTTCCTTCCACCAGGGCATGGTGTT
TCTGGAAGAGTTTGAAGCTAGATCCTGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCG
CTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAA
CTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCAT
CACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCA
CGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCC
GGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGAC
CCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGC
CGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAG
GGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGA
CATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAG
GGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCT
GCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGA
GGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTA
CTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAA
GTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGC
CGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGG
AGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGA
CCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAG
GGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAA
GCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAA
ACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCA
GACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGAC
TCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAA
CACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGAC
TCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACC
TTCTTCCAAATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTG
ACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCA
GTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATA
CCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCG
AGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATC
CTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGA
CAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGT
GACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCT
GTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCC
CAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAAT
TTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAAGAACCTTTGACATTTTGTAAAAGGC

>In-frame_ZMYND8_ENST00000536340_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_3287nt
GTCACATGGCTCAGTAGCCATTAGCCATAGCTTGATTTTGCAAACTGGCAAGGGCCTGGCACACCTTTCCTTCCACCAGGGCATGGTGTT
TCTGGAAGAGTTTGAAGCTAGATCCTGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCG
CTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAA
CTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCAT
CACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCA
CGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCC
GGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGAC
CCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGC
CGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAG
GGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGA
CATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAG
GGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCT
GCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGA
GGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTA
CTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAA
GTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGC
CGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGG
AGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGA
CCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAG
GGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAA
GCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAA
ACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCA
GACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGAC
TCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAA
CACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGAC
TCGAAACATGGACCTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAAC
AGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATT
GGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGA
AGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCC
TCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTT
TTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCA
ACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGG
TTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATC
CCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCC
AGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGT
CCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCA

>In-frame_ZMYND8_ENST00000536340_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_3071nt
GTCACATGGCTCAGTAGCCATTAGCCATAGCTTGATTTTGCAAACTGGCAAGGGCCTGGCACACCTTTCCTTCCACCAGGGCATGGTGTT
TCTGGAAGAGTTTGAAGCTAGATCCTGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCG
CTCCAAAGCTTTCTTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAA
CTCCCGCTTTTATAACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCAT
CACCAATGACAGCGTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCA
CGGCCCTGAGGATTCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCC
GGACAAACACTGGATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGAC
CCTCATGTCGGTGGACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGC
CGACCACGGTTACCACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAG
GGGCCCCAACGTGGAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGA
CATACCTGCGGATATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAG
GGTCTGGCGGGACTCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCT
GCCCAAGTACCAGCGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGA
GGACGCCACGGGGAAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTA
CTACGGGCAGGGCAGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAA
GTACAAGGCCAGCTATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGC
CGCCCAGCCCCGAAACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGG
AGGCCTTCCCGACTACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGA
CCTGTACAAGTCCCTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAG
GGAAGTCCGAGGTCACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAA
GCACAGAGGCTCCAGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAA
ACTCCGCAAGCTGCTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCA
GACGGCGCCTTTCTGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGAC
TCACAATTTCCTCTTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAA
CACACTGGACAGGGATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGAC
TCGAAACATGGACCTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAA
ATCACTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAG
GCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATG
ACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAG
CTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGA
GATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTC
TTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTC
AGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTA
CATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGT

>In-frame_ZMYND8_ENST00000540497_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_3733nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA
CTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAA
TGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAG
ATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGC
ACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATT
TCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTT
GGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTA
GCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATG
TAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAA
AAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTT
TTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAG
TATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAAGAACCTTTGACATTTTGTAAAAGGCCATTTCTTGGGAG
TTTTTTGGTGTGTCTGTTTTTTTAAAGTATTCAAGATACTACCAGTCAACATCTTTTTGGAAGAAAATGCCTTGGGTTTAGAAGATTTTC
TTAAAAGGGGAGTAGATGGTTGTAGATTGACTAAAAAGTCTACCATACTTCAAGGGACTACAGGTAAGTCTCATAGTATACCAGCTTTGG
TACTTCATTTTTTAAAAAAGTATTAATCAATTGCAAAGAAATTCGCCTTGGCCAACCCTTCTTTGTGTATCAGGTAGTCTAACCTGATAC
AAGTAGTTGACAGATTTCAACTATCAATCACCAGTCCAACCCATTTCTCATTTAACAGATGACGGAGATAATCCCTAAAAGCACCCACAT
TTGTTTCAATGCCCCAAACAGGCCAAGGCTCCCTAGCAACTCCCTAGTGGCGTTTTTTAACTTCTCAGAAACTGTTACCATTATTTGAAA

>In-frame_ZMYND8_ENST00000540497_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_3239nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA
CTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAA
TGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAG
ATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGC
ACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATT
TCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTT
GGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTA
GCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATG
TAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAA
AAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTT
TTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAG

>In-frame_ZMYND8_ENST00000540497_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_3184nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTC
CAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCT
GAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGC
CCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCT
CACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGG
GAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCT
GAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGA
AACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGA
GTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCT
CCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGAT
GAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAAGA

>In-frame_ZMYND8_ENST00000540497_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_2968nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAA
CTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACC
ATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAG
GATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGC
ATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAA
ATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCA
CAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAG
AGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACA

>In-frame_ZMYND8_ENST00000461685_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_3733nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA
CTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAA
TGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAG
ATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGC
ACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATT
TCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTT
GGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTA
GCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATG
TAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAA
AAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTT
TTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAG
TATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAAGAACCTTTGACATTTTGTAAAAGGCCATTTCTTGGGAG
TTTTTTGGTGTGTCTGTTTTTTTAAAGTATTCAAGATACTACCAGTCAACATCTTTTTGGAAGAAAATGCCTTGGGTTTAGAAGATTTTC
TTAAAAGGGGAGTAGATGGTTGTAGATTGACTAAAAAGTCTACCATACTTCAAGGGACTACAGGTAAGTCTCATAGTATACCAGCTTTGG
TACTTCATTTTTTAAAAAAGTATTAATCAATTGCAAAGAAATTCGCCTTGGCCAACCCTTCTTTGTGTATCAGGTAGTCTAACCTGATAC
AAGTAGTTGACAGATTTCAACTATCAATCACCAGTCCAACCCATTTCTCATTTAACAGATGACGGAGATAATCCCTAAAAGCACCCACAT
TTGTTTCAATGCCCCAAACAGGCCAAGGCTCCCTAGCAACTCCCTAGTGGCGTTTTTTAACTTCTCAGAAACTGTTACCATTATTTGAAA

>In-frame_ZMYND8_ENST00000461685_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_3239nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA
CTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAA
TGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAG
ATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGC
ACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATT
TCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTT
GGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTA
GCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATG
TAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAA
AAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTT
TTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAG

>In-frame_ZMYND8_ENST00000461685_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_3184nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTC
CAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCT
GAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGC
CCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCT
CACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGG
GAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCT
GAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGA
AACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGA
GTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCT
CCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGAT
GAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAAGA

>In-frame_ZMYND8_ENST00000461685_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_2968nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAA
CTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACC
ATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAG
GATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGC
ATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAA
ATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCA
CAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAG
AGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACA

>In-frame_ZMYND8_ENST00000372023_chr20_45976600_-_SULF2_ENST00000359930_chr20_46331414_-_3733nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA
CTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAA
TGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAG
ATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGC
ACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATT
TCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTT
GGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTA
GCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATG
TAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAA
AAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTT
TTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAG
TATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAAGAACCTTTGACATTTTGTAAAAGGCCATTTCTTGGGAG
TTTTTTGGTGTGTCTGTTTTTTTAAAGTATTCAAGATACTACCAGTCAACATCTTTTTGGAAGAAAATGCCTTGGGTTTAGAAGATTTTC
TTAAAAGGGGAGTAGATGGTTGTAGATTGACTAAAAAGTCTACCATACTTCAAGGGACTACAGGTAAGTCTCATAGTATACCAGCTTTGG
TACTTCATTTTTTAAAAAAGTATTAATCAATTGCAAAGAAATTCGCCTTGGCCAACCCTTCTTTGTGTATCAGGTAGTCTAACCTGATAC
AAGTAGTTGACAGATTTCAACTATCAATCACCAGTCCAACCCATTTCTCATTTAACAGATGACGGAGATAATCCCTAAAAGCACCCACAT
TTGTTTCAATGCCCCAAACAGGCCAAGGCTCCCTAGCAACTCCCTAGTGGCGTTTTTTAACTTCTCAGAAACTGTTACCATTATTTGAAA

>In-frame_ZMYND8_ENST00000372023_chr20_45976600_-_SULF2_ENST00000484875_chr20_46331414_-_3239nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCA
CTGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAA
TGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAG
ATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGC
ACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATT
TCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTT
GGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTA
GCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATG
TAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGAGTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAA
AAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCTCCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTT
TTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGATGAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAG

>In-frame_ZMYND8_ENST00000372023_chr20_45976600_-_SULF2_ENST00000361612_chr20_46331414_-_3184nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGGACTTAAAGATGGAGGAAGCTATGAGCAATACAGGGGACAACTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTC
CAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACCATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCT
GAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAGGATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGC
CCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGCATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCT
CACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAAATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGG
GAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCACAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCT
GAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAGAGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGA
AACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACATGGGAACTTTTAGGGGAACCTAATAAGAAATCCCAATTTTCAGGA
GTGGTGGTGTCAATAAACGCTCTGTGGCCAGTGTAAAAGAAAATCCCTCGCAGTTGTGGACATTTCTGTTCCTGTCCAGATACCATTTCT
CCTAGTATTTCTTTGTTATGTCCCAGAACTGATGTTTTTTTTTTAAGGTACTGAAAAGAAATGAAGTTGATGTATGTCCCAAGTTTTGAT
GAAACTGTATTTGTAAAAAAAATTTTGTAGTTTAAGTATTGTCATACAGTGTTCAAAACCCCAGCCAATGACCAGCAGTTGGTATGAAGA

>In-frame_ZMYND8_ENST00000372023_chr20_45976600_-_SULF2_ENST00000467815_chr20_46331414_-_2968nt
ATGCATCCACAGAGCTTGGCTGAAGAGGAAATAAAAACAGAACAGGAGGTGGTAGAGGGCATGGATATCTCTACTCGCTCCAAAGCTTTC
TTCGGGAAGTATCTTAATGAATACAACGGCTCCTACGTGCCACCCGGCTGGAAGGAGTGGGTCGGACTCCTTAAAAACTCCCGCTTTTAT
AACTACACGCTGTGTCGGAACGGGGTGAAAGAGAAGCACGGCTCCGACTACTCCAAGGATTACCTCACAGACCTCATCACCAATGACAGC
GTGAGCTTCTTCCGCACGTCCAAGAAGATGTACCCGCACAGGCCAGTCCTCATGGTCATCAGCCATGCAGCCCCCCACGGCCCTGAGGAT
TCAGCCCCACAATATTCACGCCTCTTCCCAAACGCATCTCAGCACATCACGCCGAGCTACAACTACGCGCCCAACCCGGACAAACACTGG
ATCATGCGCTACACGGGGCCCATGAAGCCCATCCACATGGAATTCACCAACATGCTCCAGCGGAAGCGCTTGCAGACCCTCATGTCGGTG
GACGACTCCATGGAGACGATTTACAACATGCTGGTTGAGACGGGCGAGCTGGACAACACGTACATCGTATACACCGCCGACCACGGTTAC
CACATCGGCCAGTTTGGCCTGGTGAAAGGGAAATCCATGCCATATGAGTTTGACATCAGGGTCCCGTTCTACGTGAGGGGCCCCAACGTG
GAAGCCGGCTGTCTGAATCCCCACATCGTCCTCAACATTGACCTGGCCCCCACCATCCTGGACATTGCAGGCCTGGACATACCTGCGGAT
ATGGACGGGAAATCCATCCTCAAGCTGCTGGACACGGAGCGGCCGGTGAATCGGTTTCACTTGAAAAAGAAGATGAGGGTCTGGCGGGAC
TCCTTCTTGGTGGAGAGAGGCAAGCTGCTACACAAGAGAGACAATGACAAGGTGGACGCCCAGGAGGAGAACTTTCTGCCCAAGTACCAG
CGTGTGAAGGACCTGTGTCAGCGTGCTGAGTACCAGACGGCGTGTGAGCAGCTGGGACAGAAGTGGCAGTGTGTGGAGGACGCCACGGGG
AAGCTGAAGCTGCATAAGTGCAAGGGCCCCATGCGGCTGGGCGGCAGCAGAGCCCTCTCCAACCTCGTGCCCAAGTACTACGGGCAGGGC
AGCGAGGCCTGCACCTGTGACAGCGGGGACTACAAGCTCAGCCTGGCCGGACGCCGGAAAAAACTCTTCAAGAAGAAGTACAAGGCCAGC
TATGTCCGCAGTCGCTCCATCCGCTCAGTGGCCATCGAGGTGGACGGCAGGGTGTACCACGTAGGCCTGGGTGATGCCGCCCAGCCCCGA
AACCTCACCAAGCGGCACTGGCCAGGGGCCCCTGAGGACCAAGATGACAAGGATGGTGGGGACTTCAGTGGCACTGGAGGCCTTCCCGAC
TACTCAGCCGCCAACCCCATTAAAGTGACACATCGGTGCTACATCCTAGAGAACGACACAGTCCAGTGTGACCTGGACCTGTACAAGTCC
CTGCAGGCCTGGAAAGACCACAAGCTGCACATCGACCACGAGATTGAAACCCTGCAGAACAAAATTAAGAACCTGAGGGAAGTCCGAGGT
CACCTGAAGAAAAAGCGGCCAGAAGAATGTGACTGTCACAAAATCAGCTACCACACCCAGCACAAAGGCCGCCTCAAGCACAGAGGCTCC
AGTCTGCATCCTTTCAGGAAGGGCCTGCAAGAGAAGGACAAGGTGTGGCTGTTGCGGGAGCAGAAGCGCAAGAAGAAACTCCGCAAGCTG
CTCAAGCGCCTGCAGAACAACGACACGTGCAGCATGCCAGGCCTCACGTGCTTCACCCACGACAACCAGCACTGGCAGACGGCGCCTTTC
TGGACACTGGGGCCTTTCTGTGCCTGCACCAGCGCCAACAATAACACGTACTGGTGCATGAGGACCATCAATGAGACTCACAATTTCCTC
TTCTGTGAATTTGCAACTGGCTTCCTAGAGTACTTTGATCTCAACACAGACCCCTACCAGCTGATGAATGCAGTGAACACACTGGACAGG
GATGTCCTCAACCAGCTACACGTACAGCTCATGGAGCTGAGGAGCTGCAAGGGTTACAAGCAGTGTAACCCCCGGACTCGAAACATGGAC
CTGGATGGAGGAAGCTATGAGCAATACAGGCAGTTTCAGCGTCGAAAGTGGCCAGAAATGAAGAGACCTTCTTCCAAATCACTGGGACAA
CTGTGGGAAGGCTGGGAAGGTTAAGAAACAACAGAGGTGGACCTCCAAAAACATAGAGGCATCACCTGACTGCACAGGCAATGAAAAACC
ATGTGGGTGATTTCCAGCAGACCTGTGGTATTGGCCAGGAGGCCTGAGAAAGCAAGCACGCACTCTCAGTCAACATGACAGATTCTGGAG
GATAACCAGCAGGAGCAGAGATAACTTCAGGAAGTCCATTTTTGCCCCTGCTTTTGCTTTGGATTATACCTCACCAGCTGCACAAAATGC
ATTTTTTCGTATCAAAAAGTCACCACTAACCCTCCCCCAGAAGCTCACAAAGGAAAACGGAGAGAGCGAGCGAGAGAGATTTCCTTGGAA
ATTTCTCCCAAGGGCGAAAGTCATTGGAATTTTTAAATCATAGGGGAAAAGCAGTCCTGTTCTAAATCCTCTTATTCTTTTGGTTTGTCA
CAAAGAAGGAACTAAGAAGCAGGACAGAGGCAACGTGGAGAGGCTGAAAACAGTGCAGAGACGTTTGACAATGAGTCAGTAGCACAAAAG
AGATGACATTTACCTAGCACTATAAACCCTGGTTGCCTCTGAAGAAACTGCCTTCATTGTATATATGTGACTATTTACATGTAATCAACA


Top

FusionGenePPI for ZMYND8_SULF2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZMYND8FHOD1, E2F6, SMARCA4, INTS1, INTS3, INTS5, INTS6, BCL6, CSNK1E, ATN1, RERE, USP7, SUPT4H1, ZFYVE9, SOX2, HDAC1, PBXIP1, ZBTB7A, HECW2, KCTD17, CSNK2A2, CHD4, HDAC2, KRAS, PSMD5, RBBP7, TSPYL1, MBD2, MTA1, MTA2, ZNF592, CHERP, MGA, CDK2AP1, RBM8A, ZNF687, VWA9, KDM5C, RPS27L, ZCCHC17, ESF1, MBD3, GATAD2A, ZNF532, DDX24, GATAD2B, MTA3, TSPYL2, FOXJ2, P4HA3, LLGL2, ZNF408SULF2MYC, PTCH1, CASQ2, NAAA, PON2, CSGALNACT2, APP, LRRC4C, DEFA1, GPR156, OS9, KBTBD7, SDC2, DKK3, DEFA5, TRPC4AP, GNS


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZMYND8_SULF2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ZMYND8_SULF2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSULF2C0014175Endometriosis2CTD_human