FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42967

FusionGeneSummary for ZMYND11_SORBS2

check button Fusion gene summary
Fusion gene informationFusion gene name: ZMYND11_SORBS2
Fusion gene ID: 42967
HgeneTgene
Gene symbol

ZMYND11

SORBS2

Gene ID

10771

8470

Gene namezinc finger MYND-type containing 11sorbin and SH3 domain containing 2
SynonymsBRAM1|BS69|MRD30ARGBP2|PRO0618
Cytomap

10p15.3

4q35.1

Type of geneprotein-codingprotein-coding
Descriptionzinc finger MYND domain-containing protein 11adenovirus 5 E1A-binding proteinbone morphogenetic protein receptor-associated molecule 1sorbin and SH3 domain-containing protein 2Arg binding protein 2Arg/Abl-interacting protein 2arg-binding protein 2
Modification date2018052220180523
UniProtAcc

Q15326

O94875

Ensembl transtripts involved in fusion geneENST00000381602, ENST00000397962, 
ENST00000309776, ENST00000509513, 
ENST00000397959, ENST00000381591, 
ENST00000403354, ENST00000381607, 
ENST00000402736, ENST00000602682, 
ENST00000381604, ENST00000381584, 
ENST00000558098, ENST00000545619, 
ENST00000535374, ENST00000473115, 
ENST00000448662, ENST00000431808, 
ENST00000284776, ENST00000437304, 
ENST00000319471, ENST00000449407, 
ENST00000355634, ENST00000393528, 
ENST00000418609, ENST00000498125, 
Fusion gene scores* DoF score6 X 5 X 5=15011 X 12 X 7=924
# samples 1215
** MAII scorelog2(12/150*10)=-0.321928094887362
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/924*10)=-2.62293035092018
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ZMYND11 [Title/Abstract] AND SORBS2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneZMYND11

GO:0051607

defense response to virus

26845565


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-DH-A669-02AZMYND11chr10

293406

+SORBS2chr4

186515089

-
TCGARVLGGTCGA-DH-A669-01AZMYND11chr10

293406

+SORBS2chr4

186515089

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000381602ENST00000448662ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381602ENST00000431808ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381602ENST00000284776ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381602ENST00000437304ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381602ENST00000319471ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381602ENST00000449407ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381602ENST00000355634ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381602ENST00000393528ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381602ENST00000418609ZMYND11chr10

293406

+SORBS2chr4

186515089

-
5CDS-intronENST00000381602ENST00000498125ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397962ENST00000448662ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397962ENST00000431808ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397962ENST00000284776ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397962ENST00000437304ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397962ENST00000319471ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397962ENST00000449407ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397962ENST00000355634ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397962ENST00000393528ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397962ENST00000418609ZMYND11chr10

293406

+SORBS2chr4

186515089

-
5CDS-intronENST00000397962ENST00000498125ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000309776ENST00000448662ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000309776ENST00000431808ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000309776ENST00000284776ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000309776ENST00000437304ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000309776ENST00000319471ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000309776ENST00000449407ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000309776ENST00000355634ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000309776ENST00000393528ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000309776ENST00000418609ZMYND11chr10

293406

+SORBS2chr4

186515089

-
5CDS-intronENST00000309776ENST00000498125ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000509513ENST00000448662ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000509513ENST00000431808ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000509513ENST00000284776ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000509513ENST00000437304ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000509513ENST00000319471ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000509513ENST00000449407ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000509513ENST00000355634ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000509513ENST00000393528ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000509513ENST00000418609ZMYND11chr10

293406

+SORBS2chr4

186515089

-
5CDS-intronENST00000509513ENST00000498125ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397959ENST00000448662ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397959ENST00000431808ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397959ENST00000284776ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397959ENST00000437304ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397959ENST00000319471ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397959ENST00000449407ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397959ENST00000355634ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397959ENST00000393528ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000397959ENST00000418609ZMYND11chr10

293406

+SORBS2chr4

186515089

-
5CDS-intronENST00000397959ENST00000498125ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381591ENST00000448662ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381591ENST00000431808ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381591ENST00000284776ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381591ENST00000437304ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381591ENST00000319471ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381591ENST00000449407ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381591ENST00000355634ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381591ENST00000393528ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381591ENST00000418609ZMYND11chr10

293406

+SORBS2chr4

186515089

-
5CDS-intronENST00000381591ENST00000498125ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000403354ENST00000448662ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000403354ENST00000431808ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000403354ENST00000284776ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000403354ENST00000437304ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000403354ENST00000319471ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000403354ENST00000449407ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000403354ENST00000355634ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000403354ENST00000393528ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000403354ENST00000418609ZMYND11chr10

293406

+SORBS2chr4

186515089

-
5CDS-intronENST00000403354ENST00000498125ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381607ENST00000448662ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381607ENST00000431808ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381607ENST00000284776ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381607ENST00000437304ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381607ENST00000319471ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381607ENST00000449407ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381607ENST00000355634ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381607ENST00000393528ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381607ENST00000418609ZMYND11chr10

293406

+SORBS2chr4

186515089

-
5CDS-intronENST00000381607ENST00000498125ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000402736ENST00000448662ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000402736ENST00000431808ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000402736ENST00000284776ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000402736ENST00000437304ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000402736ENST00000319471ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000402736ENST00000449407ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000402736ENST00000355634ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000402736ENST00000393528ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000402736ENST00000418609ZMYND11chr10

293406

+SORBS2chr4

186515089

-
5CDS-intronENST00000402736ENST00000498125ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000602682ENST00000448662ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000602682ENST00000431808ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000602682ENST00000284776ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000602682ENST00000437304ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000602682ENST00000319471ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000602682ENST00000449407ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000602682ENST00000355634ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000602682ENST00000393528ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000602682ENST00000418609ZMYND11chr10

293406

+SORBS2chr4

186515089

-
5CDS-intronENST00000602682ENST00000498125ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381604ENST00000448662ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381604ENST00000431808ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381604ENST00000284776ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381604ENST00000437304ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381604ENST00000319471ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381604ENST00000449407ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381604ENST00000355634ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381604ENST00000393528ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381604ENST00000418609ZMYND11chr10

293406

+SORBS2chr4

186515089

-
5CDS-intronENST00000381604ENST00000498125ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381584ENST00000448662ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381584ENST00000431808ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381584ENST00000284776ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381584ENST00000437304ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381584ENST00000319471ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381584ENST00000449407ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381584ENST00000355634ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381584ENST00000393528ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000381584ENST00000418609ZMYND11chr10

293406

+SORBS2chr4

186515089

-
5CDS-intronENST00000381584ENST00000498125ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000558098ENST00000448662ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000558098ENST00000431808ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000558098ENST00000284776ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000558098ENST00000437304ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000558098ENST00000319471ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000558098ENST00000449407ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000558098ENST00000355634ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000558098ENST00000393528ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000558098ENST00000418609ZMYND11chr10

293406

+SORBS2chr4

186515089

-
5CDS-intronENST00000558098ENST00000498125ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000545619ENST00000448662ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000545619ENST00000431808ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000545619ENST00000284776ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000545619ENST00000437304ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000545619ENST00000319471ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000545619ENST00000449407ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000545619ENST00000355634ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000545619ENST00000393528ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000545619ENST00000418609ZMYND11chr10

293406

+SORBS2chr4

186515089

-
5CDS-intronENST00000545619ENST00000498125ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000535374ENST00000448662ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000535374ENST00000431808ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000535374ENST00000284776ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000535374ENST00000437304ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000535374ENST00000319471ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000535374ENST00000449407ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000535374ENST00000355634ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000535374ENST00000393528ZMYND11chr10

293406

+SORBS2chr4

186515089

-
In-frameENST00000535374ENST00000418609ZMYND11chr10

293406

+SORBS2chr4

186515089

-
5CDS-intronENST00000535374ENST00000498125ZMYND11chr10

293406

+SORBS2chr4

186515089

-
3UTR-3CDSENST00000473115ENST00000448662ZMYND11chr10

293406

+SORBS2chr4

186515089

-
3UTR-3CDSENST00000473115ENST00000431808ZMYND11chr10

293406

+SORBS2chr4

186515089

-
3UTR-3CDSENST00000473115ENST00000284776ZMYND11chr10

293406

+SORBS2chr4

186515089

-
3UTR-3CDSENST00000473115ENST00000437304ZMYND11chr10

293406

+SORBS2chr4

186515089

-
3UTR-3CDSENST00000473115ENST00000319471ZMYND11chr10

293406

+SORBS2chr4

186515089

-
3UTR-3CDSENST00000473115ENST00000449407ZMYND11chr10

293406

+SORBS2chr4

186515089

-
3UTR-3CDSENST00000473115ENST00000355634ZMYND11chr10

293406

+SORBS2chr4

186515089

-
3UTR-3CDSENST00000473115ENST00000393528ZMYND11chr10

293406

+SORBS2chr4

186515089

-
3UTR-3CDSENST00000473115ENST00000418609ZMYND11chr10

293406

+SORBS2chr4

186515089

-
3UTR-intronENST00000473115ENST00000498125ZMYND11chr10

293406

+SORBS2chr4

186515089

-

Top

FusionProtFeatures for ZMYND11_SORBS2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZMYND11

Q15326

SORBS2

O94875


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZMYND11chr10:293406chr4:186515089ENST00000309776+1215168_238369563DomainBromo
HgeneZMYND11chr10:293406chr4:186515089ENST00000309776+1215280_331369563DomainPWWP
HgeneZMYND11chr10:293406chr4:186515089ENST00000381591+1215168_238409603DomainBromo
HgeneZMYND11chr10:293406chr4:186515089ENST00000381591+1215280_331409603DomainPWWP
HgeneZMYND11chr10:293406chr4:186515089ENST00000381604+1215168_238369563DomainBromo
HgeneZMYND11chr10:293406chr4:186515089ENST00000381604+1215280_331369563DomainPWWP
HgeneZMYND11chr10:293406chr4:186515089ENST00000397959+1013168_238324518DomainBromo
HgeneZMYND11chr10:293406chr4:186515089ENST00000397962+1215168_238409603DomainBromo
HgeneZMYND11chr10:293406chr4:186515089ENST00000397962+1215280_331409603DomainPWWP
HgeneZMYND11chr10:293406chr4:186515089ENST00000509513+1214168_238408568DomainBromo
HgeneZMYND11chr10:293406chr4:186515089ENST00000509513+1214280_331408568DomainPWWP
HgeneZMYND11chr10:293406chr4:186515089ENST00000558098+1113168_238409569DomainBromo
HgeneZMYND11chr10:293406chr4:186515089ENST00000558098+1113280_331409569DomainPWWP
HgeneZMYND11chr10:293406chr4:186515089ENST00000602682+912168_238324518DomainBromo
HgeneZMYND11chr10:293406chr4:186515089ENST00000381591+1215394_400409603MotifNuclear localization signal
HgeneZMYND11chr10:293406chr4:186515089ENST00000397962+1215394_400409603MotifNuclear localization signal
HgeneZMYND11chr10:293406chr4:186515089ENST00000509513+1214394_400408568MotifNuclear localization signal
HgeneZMYND11chr10:293406chr4:186515089ENST00000558098+1113394_400409569MotifNuclear localization signal
HgeneZMYND11chr10:293406chr4:186515089ENST00000309776+1215100_148369563Zinc fingerPHD-type
HgeneZMYND11chr10:293406chr4:186515089ENST00000381591+1215100_148409603Zinc fingerPHD-type
HgeneZMYND11chr10:293406chr4:186515089ENST00000381604+1215100_148369563Zinc fingerPHD-type
HgeneZMYND11chr10:293406chr4:186515089ENST00000397959+1013100_148324518Zinc fingerPHD-type
HgeneZMYND11chr10:293406chr4:186515089ENST00000397962+1215100_148409603Zinc fingerPHD-type
HgeneZMYND11chr10:293406chr4:186515089ENST00000509513+1214100_148408568Zinc fingerPHD-type
HgeneZMYND11chr10:293406chr4:186515089ENST00000558098+1113100_148409569Zinc fingerPHD-type
HgeneZMYND11chr10:293406chr4:186515089ENST00000602682+912100_148324518Zinc fingerPHD-type
TgeneSORBS2chr10:293406chr4:186515089ENST00000319471-1923931_934659732Compositional biasNote=Poly-Pro
TgeneSORBS2chr10:293406chr4:186515089ENST00000393528-1923640_652594667Compositional biasNote=His-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000393528-1923931_934594667Compositional biasNote=Poly-Pro
TgeneSORBS2chr10:293406chr4:186515089ENST00000418609-1115931_9349321005Compositional biasNote=Poly-Pro
TgeneSORBS2chr10:293406chr4:186515089ENST00000437304-1923931_934752825Compositional biasNote=Poly-Pro
TgeneSORBS2chr10:293406chr4:186515089ENST00000448662-1721640_652589662Compositional biasNote=His-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000448662-1721931_934589662Compositional biasNote=Poly-Pro
TgeneSORBS2chr10:293406chr4:186515089ENST00000449407-1721640_652572645Compositional biasNote=His-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000449407-1721931_934572645Compositional biasNote=Poly-Pro
TgeneSORBS2chr10:293406chr4:186515089ENST00000284776-17211041_110010281101DomainSH3 3
TgeneSORBS2chr10:293406chr4:186515089ENST00000319471-19231041_1100659732DomainSH3 3
TgeneSORBS2chr10:293406chr4:186515089ENST00000319471-1923863_922659732DomainSH3 1
TgeneSORBS2chr10:293406chr4:186515089ENST00000319471-1923938_999659732DomainSH3 2
TgeneSORBS2chr10:293406chr4:186515089ENST00000393528-19231041_1100594667DomainSH3 3
TgeneSORBS2chr10:293406chr4:186515089ENST00000393528-1923863_922594667DomainSH3 1
TgeneSORBS2chr10:293406chr4:186515089ENST00000393528-1923938_999594667DomainSH3 2
TgeneSORBS2chr10:293406chr4:186515089ENST00000418609-11151041_11009321005DomainSH3 3
TgeneSORBS2chr10:293406chr4:186515089ENST00000418609-1115938_9999321005DomainSH3 2
TgeneSORBS2chr10:293406chr4:186515089ENST00000431808-18221041_110010281101DomainSH3 3
TgeneSORBS2chr10:293406chr4:186515089ENST00000437304-19231041_1100752825DomainSH3 3
TgeneSORBS2chr10:293406chr4:186515089ENST00000437304-1923863_922752825DomainSH3 1
TgeneSORBS2chr10:293406chr4:186515089ENST00000437304-1923938_999752825DomainSH3 2
TgeneSORBS2chr10:293406chr4:186515089ENST00000448662-17211041_1100589662DomainSH3 3
TgeneSORBS2chr10:293406chr4:186515089ENST00000448662-1721863_922589662DomainSH3 1
TgeneSORBS2chr10:293406chr4:186515089ENST00000448662-1721938_999589662DomainSH3 2
TgeneSORBS2chr10:293406chr4:186515089ENST00000449407-17211041_1100572645DomainSH3 3
TgeneSORBS2chr10:293406chr4:186515089ENST00000449407-1721863_922572645DomainSH3 1
TgeneSORBS2chr10:293406chr4:186515089ENST00000449407-1721938_999572645DomainSH3 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZMYND11chr10:293406chr4:186515089ENST00000397959+1013280_331324518DomainPWWP
HgeneZMYND11chr10:293406chr4:186515089ENST00000602682+912280_331324518DomainPWWP
HgeneZMYND11chr10:293406chr4:186515089ENST00000309776+1215394_400369563MotifNuclear localization signal
HgeneZMYND11chr10:293406chr4:186515089ENST00000381604+1215394_400369563MotifNuclear localization signal
HgeneZMYND11chr10:293406chr4:186515089ENST00000397959+1013394_400324518MotifNuclear localization signal
HgeneZMYND11chr10:293406chr4:186515089ENST00000602682+912394_400324518MotifNuclear localization signal
HgeneZMYND11chr10:293406chr4:186515089ENST00000309776+1215563_598369563Zinc fingerMYND-type
HgeneZMYND11chr10:293406chr4:186515089ENST00000381591+1215563_598409603Zinc fingerMYND-type
HgeneZMYND11chr10:293406chr4:186515089ENST00000381604+1215563_598369563Zinc fingerMYND-type
HgeneZMYND11chr10:293406chr4:186515089ENST00000397959+1013563_598324518Zinc fingerMYND-type
HgeneZMYND11chr10:293406chr4:186515089ENST00000397962+1215563_598409603Zinc fingerMYND-type
HgeneZMYND11chr10:293406chr4:186515089ENST00000509513+1214563_598408568Zinc fingerMYND-type
HgeneZMYND11chr10:293406chr4:186515089ENST00000558098+1113563_598409569Zinc fingerMYND-type
HgeneZMYND11chr10:293406chr4:186515089ENST00000602682+912563_598324518Zinc fingerMYND-type
TgeneSORBS2chr10:293406chr4:186515089ENST00000284776-1721167_18210281101Compositional biasNote=Pro-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000284776-1721640_65210281101Compositional biasNote=His-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000284776-1721931_93410281101Compositional biasNote=Poly-Pro
TgeneSORBS2chr10:293406chr4:186515089ENST00000319471-1923167_182659732Compositional biasNote=Pro-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000319471-1923640_652659732Compositional biasNote=His-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000355634-2024167_18211281201Compositional biasNote=Pro-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000355634-2024640_65211281201Compositional biasNote=His-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000355634-2024931_93411281201Compositional biasNote=Poly-Pro
TgeneSORBS2chr10:293406chr4:186515089ENST00000393528-1923167_182594667Compositional biasNote=Pro-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000418609-1115167_1829321005Compositional biasNote=Pro-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000418609-1115640_6529321005Compositional biasNote=His-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000431808-1822167_18210281101Compositional biasNote=Pro-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000431808-1822640_65210281101Compositional biasNote=His-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000431808-1822931_93410281101Compositional biasNote=Poly-Pro
TgeneSORBS2chr10:293406chr4:186515089ENST00000437304-1923167_182752825Compositional biasNote=Pro-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000437304-1923640_652752825Compositional biasNote=His-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000448662-1721167_182589662Compositional biasNote=Pro-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000449407-1721167_182572645Compositional biasNote=Pro-rich
TgeneSORBS2chr10:293406chr4:186515089ENST00000284776-172166_12710281101DomainSoHo
TgeneSORBS2chr10:293406chr4:186515089ENST00000284776-1721863_92210281101DomainSH3 1
TgeneSORBS2chr10:293406chr4:186515089ENST00000284776-1721938_99910281101DomainSH3 2
TgeneSORBS2chr10:293406chr4:186515089ENST00000319471-192366_127659732DomainSoHo
TgeneSORBS2chr10:293406chr4:186515089ENST00000355634-20241041_110011281201DomainSH3 3
TgeneSORBS2chr10:293406chr4:186515089ENST00000355634-202466_12711281201DomainSoHo
TgeneSORBS2chr10:293406chr4:186515089ENST00000355634-2024863_92211281201DomainSH3 1
TgeneSORBS2chr10:293406chr4:186515089ENST00000355634-2024938_99911281201DomainSH3 2
TgeneSORBS2chr10:293406chr4:186515089ENST00000393528-192366_127594667DomainSoHo
TgeneSORBS2chr10:293406chr4:186515089ENST00000418609-111566_1279321005DomainSoHo
TgeneSORBS2chr10:293406chr4:186515089ENST00000418609-1115863_9229321005DomainSH3 1
TgeneSORBS2chr10:293406chr4:186515089ENST00000431808-182266_12710281101DomainSoHo
TgeneSORBS2chr10:293406chr4:186515089ENST00000431808-1822863_92210281101DomainSH3 1
TgeneSORBS2chr10:293406chr4:186515089ENST00000431808-1822938_99910281101DomainSH3 2
TgeneSORBS2chr10:293406chr4:186515089ENST00000437304-192366_127752825DomainSoHo
TgeneSORBS2chr10:293406chr4:186515089ENST00000448662-172166_127589662DomainSoHo
TgeneSORBS2chr10:293406chr4:186515089ENST00000449407-172166_127572645DomainSoHo


Top

FusionGeneSequence for ZMYND11_SORBS2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_481aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGDSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDN
WFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGR
FWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDV

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_481aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGDSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDN
WFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGR
FWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDV

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_481aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGDSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDN
WFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGR
FWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDV

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_481aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGDSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDN
WFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGR
FWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDV

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_481aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGDSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDN
WFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGR
FWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDV

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_481aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGDSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDN
WFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGR
FWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDV

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_481aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGDSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDN
WFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGR
FWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDV

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_481aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGDSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDN
WFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGR
FWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDV

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_481aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGDSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDN
WFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGR
FWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDV

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_402aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD
SEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDE

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_388aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFC
YPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
SKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEK

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_451aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYR
SYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQ
EPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_397aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EISIKKKNTNKQEMGTYLRFIVSRMKERKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLS
NARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQR
FLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRE

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_442aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDE
FRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADA
QLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRF
FGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRR

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_465aa
MVIFTSLHRYVIFISCIIVINWYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECH
LPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVD
VPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAK
MKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAES
SISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRT

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_482aa
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGD
EIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPD
NWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREG
RFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVID

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_362aa
MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNK
HPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHEIPNHELVWAKMKGFGFWPAKVMQ
KEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVT
QEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKR

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_277aa
MGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWP
AKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNE
QLKVTQEPRAKKGRRNQSVEPKKEPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFFGTFPG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1443nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1443nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1443nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1443nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1443nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1443nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1443nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1443nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1443nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1206nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATA
GATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAA
GTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGAC
AGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGT
TTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATT
CCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTG
GAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCC
TCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCA
CAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAG
CTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTT

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1164nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGT
TATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAAT
CAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGG
CTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAA
TCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGA
GCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGG
GAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1353nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGA
AGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCG
AGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAAC
TGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAA
GAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAAC
ATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGA
TTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAA
GAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAA
GGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTC
ATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTG

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1191nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTG
AATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGT
GAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1326nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGAC
TGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAG
TTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACA
TACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGG
CTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCC
CAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCAT
GAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAAT
CATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTC
TTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGT
ATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGA
GGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGT
AATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTG
TATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1395nt
ATGGTGATTTTTACATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATG
CACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAA
GCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCAT
TTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGT
AGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCC
CGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGAC
GTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACC
GTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTT
TGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAA
ATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGG
GCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGT
GATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCC
AGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAA
AAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAAT
GAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACC

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1446nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_1086nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_831nt
ATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATG
TACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCA
AATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCA
GCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATT
CAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGT
TTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAG
CAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTT
ACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAA
AGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_4057nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA
ATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAG
GCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATT
CTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGT
AATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAA
TAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAA
GAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACA
ATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGA
AAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGAT
ATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTT
TTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACA
GGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCA
GGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCT
GCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTAT
GGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACA
GACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACA
GATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAA
TGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAG
TTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGA
TGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGA
AAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAA
ATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTAAGAGA

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_4057nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA
ATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAG
GCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATT
CTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGT
AATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAA
TAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAA
GAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACA
ATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGA
AAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGAT
ATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTT
TTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACA
GGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCA
GGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCT
GCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTAT
GGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACA
GACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACA
GATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAA
TGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAG
TTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGA
TGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGA
AAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAA
ATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTAAGAGA

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_4057nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA
ATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAG
GCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATT
CTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGT
AATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAA
TAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAA
GAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACA
ATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGA
AAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGAT
ATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTT
TTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACA
GGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCA
GGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCT
GCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTAT
GGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACA
GACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACA
GATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAA
TGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAG
TTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGA
TGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGA
AAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAA
ATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTAAGAGA

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_2196nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_2196nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_2195nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_2179nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_2178nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA

>In-frame_ZMYND11_ENST00000381602_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_4057nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA
ATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAG
GCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATT
CTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGT
AATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAA
TAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAA
GAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACA
ATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGA
AAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGAT
ATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTT
TTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACA
GGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCA
GGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCT
GCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTAT
GGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACA
GACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACA
GATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAA
TGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAG
TTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGA
TGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGA
AAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAA
ATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTAAGAGA

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_4057nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA
ATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAG
GCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATT
CTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGT
AATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAA
TAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAA
GAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACA
ATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGA
AAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGAT
ATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTT
TTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACA
GGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCA
GGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCT
GCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTAT
GGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACA
GACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACA
GATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAA
TGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAG
TTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGA
TGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGA
AAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAA
ATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTAAGAGA

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_4057nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA
ATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAG
GCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATT
CTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGT
AATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAA
TAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAA
GAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACA
ATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGA
AAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGAT
ATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTT
TTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACA
GGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCA
GGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCT
GCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTAT
GGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACA
GACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACA
GATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAA
TGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAG
TTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGA
TGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGA
AAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAA
ATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTAAGAGA

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_4057nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA
ATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAG
GCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATT
CTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGT
AATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAA
TAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAA
GAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACA
ATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGA
AAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGAT
ATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTT
TTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACA
GGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCA
GGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCT
GCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTAT
GGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACA
GACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACA
GATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAA
TGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAG
TTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGA
TGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGA
AAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAA
ATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTAAGAGA

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_2196nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_2196nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_2195nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_2179nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_2178nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA

>In-frame_ZMYND11_ENST00000397962_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_4057nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA
ATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAG
GCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATT
CTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGT
AATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAA
TAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAA
GAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACA
ATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGA
AAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGAT
ATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTT
TTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACA
GGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCA
GGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCT
GCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTAT
GGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACA
GACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACA
GATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAA
TGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAG
TTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGA
TGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGA
AAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAA
ATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTAAGAGA

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_4057nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA
ATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAG
GCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATT
CTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGT
AATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAA
TAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAA
GAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACA
ATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGA
AAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGAT
ATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTT
TTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACA
GGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCA
GGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCT
GCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTAT
GGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACA
GACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACA
GATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAA
TGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAG
TTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGA
TGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGA
AAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAA
ATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTAAGAGA

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_4057nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA
ATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAG
GCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATT
CTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGT
AATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAA
TAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAA
GAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACA
ATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGA
AAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGAT
ATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTT
TTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACA
GGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCA
GGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCT
GCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTAT
GGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACA
GACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACA
GATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAA
TGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAG
TTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGA
TGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGA
AAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAA
ATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTAAGAGA

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_4057nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA
ATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAG
GCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATT
CTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGT
AATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAA
TAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAA
GAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACA
ATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGA
AAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGAT
ATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTT
TTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACA
GGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCA
GGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCT
GCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTAT
GGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACA
GACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACA
GATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAA
TGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAG
TTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGA
TGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGA
AAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAA
ATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTAAGAGA

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_2196nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_2196nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_2195nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_2179nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_2178nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA

>In-frame_ZMYND11_ENST00000309776_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_4057nt
AGTGTTCTTGCAGGGCTGCTGATGGGTGGTCCTGTTCTTTTCGCGGTCCTGTTTGCGCAGAGATGAAACGGGGAACTTAGCGTATCCCTA
CCGCTCTTTTTGATGACAGGAGTAAAGGGCTGTTCAGACTACCTAAACAATGTTGTTAAGAGAAGCACTCGTACTTCTCAGACTTCGCTG
TTCCGGACCCCGCGAGCCAGGGGCAGGCACCGGGTCCACCCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCT
CGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGTAGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATA
TGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGAC
GACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTA
CAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAA
CTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAA
ATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGT
CTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGA
TGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGT
ACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAG
CTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACA
CATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTA
TACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACG
TTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGA
AGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATG
AGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAG
GACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTC
AGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACG
GCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTT
CTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAAT
GCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCC
CTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAA
ATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAG
GCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATT
CTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGT
AATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAA
TAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAA
GAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACA
ATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGA
AAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGAT
ATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTT
TTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACA
GGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCA
GGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCT
GCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTAT
GGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACA
GACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACA
GATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAA
TGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAG
TTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGA
TGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGA
AAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAA
ATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTAAGAGA

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_3835nt
CCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCTCGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGT
AGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGA
CGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAG
CCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAG
AGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTG
AACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAG
AGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGC
AGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGG
AGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCA
TTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCT
ATGGAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCT
TTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTG
GGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTT
CTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGC
TGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCA
CCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGC
GTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGG
AGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTA
CTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGC
CTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAG
TAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTG
ACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCT
CCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGG
GAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGA
CAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGA
GTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTG
CAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAA
GTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAA
AAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGT
GTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATT
ATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATA
ATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATT
TCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATA
TTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAG
AACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATG
TACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCT
TTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCA
TTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGA
AGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAAT
TAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCAT
ATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAAT
TCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTT

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_3835nt
CCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCTCGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGT
AGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGA
CGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAG
CCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAG
AGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTG
AACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAG
AGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGC
AGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGG
AGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCA
TTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCT
ATGGAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCT
TTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTG
GGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTT
CTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGC
TGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCA
CCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGC
GTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGG
AGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTA
CTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGC
CTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAG
TAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTG
ACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCT
CCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGG
GAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGA
CAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGA
GTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTG
CAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAA
GTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAA
AAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGT
GTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATT
ATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATA
ATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATT
TCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATA
TTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAG
AACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATG
TACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCT
TTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCA
TTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGA
AGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAAT
TAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCAT
ATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAAT
TCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTT

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_3835nt
CCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCTCGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGT
AGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGA
CGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAG
CCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAG
AGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTG
AACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAG
AGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGC
AGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGG
AGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCA
TTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCT
ATGGAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCT
TTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTG
GGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTT
CTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGC
TGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCA
CCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGC
GTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGG
AGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTA
CTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGC
CTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAG
TAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTG
ACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCT
CCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGG
GAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGA
CAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGA
GTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTG
CAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAA
GTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAA
AAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGT
GTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATT
ATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATA
ATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATT
TCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATA
TTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAG
AACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATG
TACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCT
TTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCA
TTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGA
AGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAAT
TAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCAT
ATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAAT
TCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTT

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1974nt
CCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCTCGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGT
AGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGA
CGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAG
CCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAG
AGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTG
AACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAG
AGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGC
AGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGG
AGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCA
TTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCT
ATGGAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCT
TTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTG
GGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTT
CTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGC
TGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCA
CCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGC
GTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGG
AGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTA
CTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGC
CTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAG
TAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTG

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1974nt
CCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCTCGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGT
AGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGA
CGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAG
CCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAG
AGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTG
AACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAG
AGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGC
AGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGG
AGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCA
TTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCT
ATGGAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCT
TTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTG
GGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTT
CTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGC
TGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCA
CCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGC
GTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGG
AGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTA
CTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGC
CTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAG
TAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTG

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1973nt
CCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCTCGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGT
AGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGA
CGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAG
CCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAG
AGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTG
AACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAG
AGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGC
AGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGG
AGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCA
TTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCT
ATGGAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCT
TTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTG
GGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTT
CTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGC
TGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCA
CCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGC
GTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGG
AGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTA
CTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGC
CTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAG
TAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTG

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1957nt
CCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCTCGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGT
AGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGA
CGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAG
CCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAG
AGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTG
AACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAG
AGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGC
AGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGG
AGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCA
TTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCT
ATGGAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCT
TTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTG
GGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTT
CTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGC
TGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCA
CCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGC
GTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGG
AGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTA
CTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGC
CTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAG
TAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTG

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1956nt
CCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCTCGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGT
AGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGA
CGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAG
CCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAG
AGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTG
AACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAG
AGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGC
AGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGG
AGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCA
TTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCT
ATGGAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCT
TTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTG
GGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTT
CTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGC
TGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCA
CCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGC
GTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGG
AGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTA
CTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGC
CTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAG
TAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTG

>In-frame_ZMYND11_ENST00000509513_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_3835nt
CCGGGGCTGAGCTGCGGCGGCGCCTGACAATGCCCCCTCGCGCCCCGGCCTCGGCGCCCGCTCCCGGCTCCAGCGCGCCTGCACGTACGT
AGCCTTCACGTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGA
CGTGGGGAAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAG
CCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAG
AGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTG
AACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAG
AGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGC
AGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGG
AGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCA
TTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCT
ATGGAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCT
TTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTG
GGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTT
CTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGC
TGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCA
CCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGC
GTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGG
AGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTA
CTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGC
CTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAG
TAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTG
ACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCT
CCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGG
GAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGA
CAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGA
GTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTG
CAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAA
GTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAA
AAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGT
GTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATT
ATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATA
ATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATT
TCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATA
TTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAG
AACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATG
TACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCT
TTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCA
TTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGA
AGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAAT
TAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCAT
ATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAAT
TCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTT

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_3484nt
GTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAA
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCC
GTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAG
GATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCC
GCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGA
TTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCA
AGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC
TAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAA
AAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTG
TTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTAC
ACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAG
AGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTT
TTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTG
TGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAA
TGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATT
TCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATC
TCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTT
ACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTG
TAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAA
AAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACT
TTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTT
TTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTA
ATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGT
CAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATT
TCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAG
GTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTT
GCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTG
ACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTC

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_3484nt
GTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAA
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCC
GTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAG
GATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCC
GCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGA
TTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCA
AGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC
TAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAA
AAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTG
TTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTAC
ACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAG
AGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTT
TTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTG
TGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAA
TGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATT
TCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATC
TCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTT
ACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTG
TAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAA
AAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACT
TTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTT
TTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTA
ATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGT
CAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATT
TCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAG
GTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTT
GCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTG
ACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTC

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_3484nt
GTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAA
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCC
GTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAG
GATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCC
GCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGA
TTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCA
AGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC
TAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAA
AAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTG
TTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTAC
ACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAG
AGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTT
TTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTG
TGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAA
TGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATT
TCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATC
TCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTT
ACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTG
TAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAA
AAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACT
TTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTT
TTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTA
ATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGT
CAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATT
TCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAG
GTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTT
GCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTG
ACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTC

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1623nt
GTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAA
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCC
GTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAG
GATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCC
GCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGA
TTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCA
AGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC
TAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1623nt
GTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAA
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCC
GTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAG
GATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCC
GCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGA
TTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCA
AGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC
TAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1622nt
GTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAA
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCC
GTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAG
GATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCC
GCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGA
TTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCA
AGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC
TAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAA

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1606nt
GTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAA
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCC
GTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAG
GATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCC
GCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGA
TTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCA
AGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1605nt
GTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAA
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCC
GTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAG
GATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCC
GCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGA
TTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCA
AGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC

>In-frame_ZMYND11_ENST00000397959_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_3484nt
GTGTGTGTGGATACGGAGTGCATGTGTGGAGACAGAGGAATATGCTCCAACAAATTTCGGATAGAGGCGCCGAAGACAGGACGTGGGGAA
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCC
GTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAG
GATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCC
GCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGA
TTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCA
AGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC
TAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAA
AAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTG
TTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTAC
ACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAG
AGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTT
TTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTG
TGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAA
TGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATT
TCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATC
TCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTT
ACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTG
TAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAA
AAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACT
TTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTT
TTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTA
ATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGT
CAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATT
TCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAG
GTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTT
GCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTG
ACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTC

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_3882nt
GCGGCCGCCCCGCGCGCATCGCCATGTGAGCGGCTGCCGCGGCTTCGCGGGGACCCAACTTTCCCGGGCGGCGGCGCCCAACTTCCCGCC
GCCCGCTCCGGCCCCGCAGGCCCGCGGCGCCAGGGGAAGACGCGAGTAAGTGCGGGCGGCGGTGCCCTCCCGGCCCTCACCCCGCACGCG
GCGACCCGGCCGCCTAGCCTCCCTCGCTCAGGCGCGACCGCGGCGTTCTCTGAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAA
AAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCG
TATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGT
CGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAAC
AGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTG
TTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACA
GGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCC
GATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTT
CAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAA
AGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCC
TTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGT
CGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCA
CGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAA
GAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAA
GAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACC
GTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGA
TGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCC
TCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTT
CCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGG
TCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATT
TAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCC
CCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGT
GTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACAT
GTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTT
TCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAA
TACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCAT
GAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACA
CCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCAT
ATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGT
TGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGA
GGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATC
ATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTA
CACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTT
TTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTT
GTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATC
TCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAA
TGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTG
TCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTC
TTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTA
AAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCT
AATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTA

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_3882nt
GCGGCCGCCCCGCGCGCATCGCCATGTGAGCGGCTGCCGCGGCTTCGCGGGGACCCAACTTTCCCGGGCGGCGGCGCCCAACTTCCCGCC
GCCCGCTCCGGCCCCGCAGGCCCGCGGCGCCAGGGGAAGACGCGAGTAAGTGCGGGCGGCGGTGCCCTCCCGGCCCTCACCCCGCACGCG
GCGACCCGGCCGCCTAGCCTCCCTCGCTCAGGCGCGACCGCGGCGTTCTCTGAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAA
AAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCG
TATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGT
CGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAAC
AGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTG
TTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACA
GGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCC
GATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTT
CAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAA
AGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCC
TTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGT
CGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCA
CGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAA
GAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAA
GAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACC
GTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGA
TGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCC
TCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTT
CCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGG
TCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATT
TAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCC
CCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGT
GTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACAT
GTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTT
TCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAA
TACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCAT
GAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACA
CCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCAT
ATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGT
TGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGA
GGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATC
ATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTA
CACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTT
TTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTT
GTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATC
TCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAA
TGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTG
TCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTC
TTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTA
AAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCT
AATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTA

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_3882nt
GCGGCCGCCCCGCGCGCATCGCCATGTGAGCGGCTGCCGCGGCTTCGCGGGGACCCAACTTTCCCGGGCGGCGGCGCCCAACTTCCCGCC
GCCCGCTCCGGCCCCGCAGGCCCGCGGCGCCAGGGGAAGACGCGAGTAAGTGCGGGCGGCGGTGCCCTCCCGGCCCTCACCCCGCACGCG
GCGACCCGGCCGCCTAGCCTCCCTCGCTCAGGCGCGACCGCGGCGTTCTCTGAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAA
AAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCG
TATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGT
CGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAAC
AGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTG
TTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACA
GGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCC
GATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTT
CAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAA
AGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCC
TTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGT
CGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCA
CGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAA
GAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAA
GAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACC
GTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGA
TGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCC
TCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTT
CCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGG
TCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATT
TAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCC
CCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGT
GTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACAT
GTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTT
TCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAA
TACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCAT
GAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACA
CCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCAT
ATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGT
TGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGA
GGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATC
ATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTA
CACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTT
TTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTT
GTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATC
TCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAA
TGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTG
TCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTC
TTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTA
AAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCT
AATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTA

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_2021nt
GCGGCCGCCCCGCGCGCATCGCCATGTGAGCGGCTGCCGCGGCTTCGCGGGGACCCAACTTTCCCGGGCGGCGGCGCCCAACTTCCCGCC
GCCCGCTCCGGCCCCGCAGGCCCGCGGCGCCAGGGGAAGACGCGAGTAAGTGCGGGCGGCGGTGCCCTCCCGGCCCTCACCCCGCACGCG
GCGACCCGGCCGCCTAGCCTCCCTCGCTCAGGCGCGACCGCGGCGTTCTCTGAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAA
AAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCG
TATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGT
CGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAAC
AGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTG
TTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACA
GGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCC
GATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTT
CAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAA
AGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCC
TTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGT
CGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCA
CGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAA
GAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAA
GAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACC
GTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGA
TGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCC
TCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTT
CCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGG
TCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATT

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_2021nt
GCGGCCGCCCCGCGCGCATCGCCATGTGAGCGGCTGCCGCGGCTTCGCGGGGACCCAACTTTCCCGGGCGGCGGCGCCCAACTTCCCGCC
GCCCGCTCCGGCCCCGCAGGCCCGCGGCGCCAGGGGAAGACGCGAGTAAGTGCGGGCGGCGGTGCCCTCCCGGCCCTCACCCCGCACGCG
GCGACCCGGCCGCCTAGCCTCCCTCGCTCAGGCGCGACCGCGGCGTTCTCTGAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAA
AAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCG
TATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGT
CGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAAC
AGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTG
TTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACA
GGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCC
GATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTT
CAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAA
AGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCC
TTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGT
CGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCA
CGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAA
GAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAA
GAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACC
GTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGA
TGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCC
TCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTT
CCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGG
TCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATT

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_2020nt
GCGGCCGCCCCGCGCGCATCGCCATGTGAGCGGCTGCCGCGGCTTCGCGGGGACCCAACTTTCCCGGGCGGCGGCGCCCAACTTCCCGCC
GCCCGCTCCGGCCCCGCAGGCCCGCGGCGCCAGGGGAAGACGCGAGTAAGTGCGGGCGGCGGTGCCCTCCCGGCCCTCACCCCGCACGCG
GCGACCCGGCCGCCTAGCCTCCCTCGCTCAGGCGCGACCGCGGCGTTCTCTGAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAA
AAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCG
TATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGT
CGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAAC
AGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTG
TTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACA
GGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCC
GATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTT
CAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAA
AGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCC
TTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGT
CGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCA
CGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAA
GAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAA
GAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACC
GTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGA
TGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCC
TCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTT
CCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGG
TCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATT

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_2004nt
GCGGCCGCCCCGCGCGCATCGCCATGTGAGCGGCTGCCGCGGCTTCGCGGGGACCCAACTTTCCCGGGCGGCGGCGCCCAACTTCCCGCC
GCCCGCTCCGGCCCCGCAGGCCCGCGGCGCCAGGGGAAGACGCGAGTAAGTGCGGGCGGCGGTGCCCTCCCGGCCCTCACCCCGCACGCG
GCGACCCGGCCGCCTAGCCTCCCTCGCTCAGGCGCGACCGCGGCGTTCTCTGAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAA
AAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCG
TATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGT
CGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAAC
AGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTG
TTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACA
GGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCC
GATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTT
CAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAA
AGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCC
TTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGT
CGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCA
CGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAA
GAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAA
GAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACC
GTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGA
TGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCC
TCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTT
CCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGG
TCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATT

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_2003nt
GCGGCCGCCCCGCGCGCATCGCCATGTGAGCGGCTGCCGCGGCTTCGCGGGGACCCAACTTTCCCGGGCGGCGGCGCCCAACTTCCCGCC
GCCCGCTCCGGCCCCGCAGGCCCGCGGCGCCAGGGGAAGACGCGAGTAAGTGCGGGCGGCGGTGCCCTCCCGGCCCTCACCCCGCACGCG
GCGACCCGGCCGCCTAGCCTCCCTCGCTCAGGCGCGACCGCGGCGTTCTCTGAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAA
AAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCG
TATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGT
CGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAAC
AGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTG
TTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACA
GGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCC
GATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTT
CAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAA
AGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCC
TTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGT
CGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCA
CGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAA
GAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAA
GAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACC
GTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGA
TGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCC
TCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTT
CCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGG
TCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATT

>In-frame_ZMYND11_ENST00000381591_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_3882nt
GCGGCCGCCCCGCGCGCATCGCCATGTGAGCGGCTGCCGCGGCTTCGCGGGGACCCAACTTTCCCGGGCGGCGGCGCCCAACTTCCCGCC
GCCCGCTCCGGCCCCGCAGGCCCGCGGCGCCAGGGGAAGACGCGAGTAAGTGCGGGCGGCGGTGCCCTCCCGGCCCTCACCCCGCACGCG
GCGACCCGGCCGCCTAGCCTCCCTCGCTCAGGCGCGACCGCGGCGTTCTCTGAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAA
AAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCG
TATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGT
CGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAAC
AGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTG
TTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACA
GGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCC
GATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTT
CAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAA
AGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCC
TTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGT
CGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCA
CGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAA
GAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAA
GAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACC
GTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGA
TGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCC
TCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTT
CCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGG
TCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATT
TAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCC
CCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGT
GTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACAT
GTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTT
TCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAA
TACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCAT
GAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACA
CCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCAT
ATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGT
TGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGA
GGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATC
ATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTA
CACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTT
TTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTT
GTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATC
TCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAA
TGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTG
TCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTC
TTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTA
AAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCT
AATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTA

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_3484nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC
TAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAA
AAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTG
TTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTAC
ACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAG
AGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTT
TTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTG
TGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAA
TGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATT
TCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATC
TCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTT
ACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTG
TAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAA
AAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACT
TTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTT
TTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTA
ATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGT
CAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATT
TCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAG
GTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTT
GCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTG
ACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTC

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_3484nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC
TAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAA
AAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTG
TTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTAC
ACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAG
AGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTT
TTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTG
TGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAA
TGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATT
TCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATC
TCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTT
ACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTG
TAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAA
AAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACT
TTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTT
TTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTA
ATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGT
CAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATT
TCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAG
GTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTT
GCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTG
ACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTC

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_3484nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC
TAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAA
AAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTG
TTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTAC
ACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAG
AGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTT
TTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTG
TGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAA
TGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATT
TCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATC
TCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTT
ACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTG
TAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAA
AAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACT
TTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTT
TTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTA
ATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGT
CAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATT
TCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAG
GTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTT
GCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTG
ACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTC

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1623nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC
TAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAA

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1623nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC
TAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAA

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1622nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC
TAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAA

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1606nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1605nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC

>In-frame_ZMYND11_ENST00000403354_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_3484nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGA
AAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCT
GGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATG
AGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTA
TCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGG
AACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAG
ATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAAT
TCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCG
TCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCA
CCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTC
TAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAA
AAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTG
TTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTAC
ACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAG
AGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTT
TTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTG
TGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAA
TGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATT
TCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATC
TCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTT
ACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTG
TAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAA
AAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACT
TTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTT
TTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTA
ATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGT
CAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATT
TCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAG
GTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTT
GCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTG
ACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTC

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_3562nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTT
ACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGT
TTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTG
AAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGC
ATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCA
GTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTC
CTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGC
TCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTT
TCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTG
AAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAG
CCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACA
CGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCA
GGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAA
TGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAA
CTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTT
AATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAA
ACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTT
GCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAG
CAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTA
CACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATT
TTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATT
ATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCC
TAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTG
GGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAAC
TGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTAC
GTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTA
TCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTT
ATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGA
AGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAA
GTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATT
TAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCT
TACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATC

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_3562nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTT
ACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGT
TTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTG
AAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGC
ATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCA
GTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTC
CTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGC
TCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTT
TCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTG
AAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAG
CCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACA
CGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCA
GGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAA
TGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAA
CTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTT
AATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAA
ACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTT
GCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAG
CAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTA
CACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATT
TTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATT
ATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCC
TAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTG
GGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAAC
TGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTAC
GTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTA
TCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTT
ATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGA
AGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAA
GTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATT
TAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCT
TACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATC

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_3562nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTT
ACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGT
TTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTG
AAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGC
ATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCA
GTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTC
CTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGC
TCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTT
TCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTG
AAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAG
CCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACA
CGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCA
GGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAA
TGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAA
CTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTT
AATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAA
ACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTT
GCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAG
CAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTA
CACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATT
TTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATT
ATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCC
TAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTG
GGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAAC
TGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTAC
GTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTA
TCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTT
ATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGA
AGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAA
GTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATT
TAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCT
TACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATC

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1701nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTT
ACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGT
TTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTG
AAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGC
ATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCA
GTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTC
CTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGC
TCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTT
TCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTG
AAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAG
CCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACA

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1701nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTT
ACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGT
TTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTG
AAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGC
ATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCA
GTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTC
CTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGC
TCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTT
TCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTG
AAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAG
CCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACA

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1700nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTT
ACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGT
TTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTG
AAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGC
ATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCA
GTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTC
CTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGC
TCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTT
TCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTG
AAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAG
CCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACA

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1684nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTT
ACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGT
TTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTG
AAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGC
ATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCA
GTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTC
CTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGC
TCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTT
TCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTG
AAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAG
CCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACA

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1683nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTT
ACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGT
TTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTG
AAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGC
ATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCA
GTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTC
CTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGC
TCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTT
TCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTG
AAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAG
CCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACA

>In-frame_ZMYND11_ENST00000381607_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_3562nt
GCGGCGGGAAGGAGGCGGCACCGGAGGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAAC
AGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGA
AGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAG
CTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAG
GAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGG
CTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAG
AGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAG
CAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTT
ACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGT
TTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTG
AAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGC
ATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCA
GTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTC
CTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGC
TCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTT
TCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTG
AAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAG
CCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACA
CGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCA
GGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAA
TGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAA
CTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTT
AATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAA
ACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTT
GCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAG
CAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTA
CACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATT
TTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATT
ATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCC
TAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTG
GGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAAC
TGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTAC
GTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTA
TCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTT
ATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGA
AGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAA
GTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATT
TAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCT
TACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATC

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_3606nt
GGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAG
ACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTAT
TACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGA
AACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGA
AAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTT
GTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGA
GATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGC
TGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACAC
ATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTAT
ACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGT
TCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAA
GCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGA
GGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGG
ACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCA
GGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGG
CTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTC
TGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATG
CGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCC
TCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAA
TGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGG
CGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTC
TTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTA
ATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAAT
AGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAG
AGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAA
TGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAA
AGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATA
TGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTT
TAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAG
GAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAG
GTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTG
CTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATG
GCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAG
ACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAG
ATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAAT
GTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGT
TCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGAT
GCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAA
AAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAA
TTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTAAGAGAA

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_3606nt
GGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAG
ACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTAT
TACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGA
AACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGA
AAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTT
GTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGA
GATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGC
TGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACAC
ATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTAT
ACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGT
TCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAA
GCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGA
GGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGG
ACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCA
GGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGG
CTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTC
TGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATG
CGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCC
TCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAA
TGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGG
CGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTC
TTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTA
ATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAAT
AGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAG
AGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAA
TGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAA
AGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATA
TGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTT
TAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAG
GAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAG
GTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTG
CTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATG
GCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAG
ACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAG
ATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAAT
GTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGT
TCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGAT
GCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAA
AAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAA
TTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTAAGAGAA

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_3606nt
GGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAG
ACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTAT
TACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGA
AACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGA
AAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTT
GTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGA
GATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGC
TGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACAC
ATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTAT
ACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGT
TCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAA
GCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGA
GGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGG
ACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCA
GGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGG
CTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTC
TGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATG
CGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCC
TCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAA
TGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGG
CGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTC
TTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTA
ATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAAT
AGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAG
AGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAA
TGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAA
AGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATA
TGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTT
TAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAG
GAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAG
GTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTG
CTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATG
GCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAG
ACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAG
ATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAAT
GTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGT
TCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGAT
GCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAA
AAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAA
TTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTAAGAGAA

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1745nt
GGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAG
ACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTAT
TACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGA
AACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGA
AAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTT
GTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGA
GATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGC
TGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACAC
ATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTAT
ACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGT
TCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAA
GCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGA
GGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGG
ACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCA
GGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGG
CTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTC
TGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATG
CGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCC
TCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAA

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1745nt
GGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAG
ACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTAT
TACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGA
AACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGA
AAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTT
GTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGA
GATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGC
TGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACAC
ATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTAT
ACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGT
TCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAA
GCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGA
GGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGG
ACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCA
GGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGG
CTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTC
TGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATG
CGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCC
TCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAA

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1744nt
GGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAG
ACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTAT
TACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGA
AACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGA
AAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTT
GTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGA
GATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGC
TGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACAC
ATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTAT
ACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGT
TCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAA
GCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGA
GGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGG
ACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCA
GGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGG
CTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTC
TGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATG
CGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCC
TCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAA

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1728nt
GGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAG
ACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTAT
TACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGA
AACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGA
AAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTT
GTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGA
GATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGC
TGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACAC
ATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTAT
ACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGT
TCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAA
GCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGA
GGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGG
ACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCA
GGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGG
CTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTC
TGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATG
CGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCC
TCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAA

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1727nt
GGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAG
ACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTAT
TACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGA
AACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGA
AAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTT
GTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGA
GATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGC
TGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACAC
ATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTAT
ACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGT
TCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAA
GCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGA
GGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGG
ACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCA
GGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGG
CTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTC
TGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATG
CGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCC
TCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAA

>In-frame_ZMYND11_ENST00000402736_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_3606nt
GGGGAGGGCCGGGCGCGGCGGCGGCGGCGGTGGAGGAGCCGGAGCATAATGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAG
ACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTAT
TACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGA
AACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGA
AAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTT
GTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGA
GATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGC
TGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACAC
ATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTAT
ACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGT
TCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAA
GCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGA
GGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGG
ACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCA
GGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGG
CTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTC
TGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATG
CGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCC
TCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAA
TGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGG
CGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTC
TTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTA
ATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAAT
AGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAG
AGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAA
TGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAA
AGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATA
TGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTT
TAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAG
GAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAG
GTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTG
CTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATG
GCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAG
ACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAG
ATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAAT
GTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGT
TCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGAT
GCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAA
AAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAA
TTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTATTCCAACTTGTTAAACTAAGAGAA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_3397nt
GCAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTG
AGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCA
CCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAG
AAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCT
CCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCG
TGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTT
GCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAA
TGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGG
CCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTG
ATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCA
GTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAA
AGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATG
AAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCA
AATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCT
GCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAA
CCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTG
CTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAA
AAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAA
TTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTT
TACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGC
AAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCAT
TTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTA
TTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAA
AAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAG
ATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGA
ATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATT
TTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGT
GTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATT
TAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATG
ACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGAT
CTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTC
CTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTC
TGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGA
ATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTT
CAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCT
GTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAA
TTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTC

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_3397nt
GCAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTG
AGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCA
CCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAG
AAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCT
CCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCG
TGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTT
GCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAA
TGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGG
CCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTG
ATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCA
GTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAA
AGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATG
AAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCA
AATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCT
GCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAA
CCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTG
CTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAA
AAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAA
TTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTT
TACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGC
AAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCAT
TTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTA
TTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAA
AAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAG
ATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGA
ATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATT
TTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGT
GTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATT
TAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATG
ACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGAT
CTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTC
CTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTC
TGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGA
ATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTT
CAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCT
GTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAA
TTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTC

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_3397nt
GCAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTG
AGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCA
CCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAG
AAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCT
CCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCG
TGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTT
GCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAA
TGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGG
CCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTG
ATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCA
GTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAA
AGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATG
AAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCA
AATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCT
GCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAA
CCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTG
CTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAA
AAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAA
TTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTT
TACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGC
AAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCAT
TTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTA
TTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAA
AAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAG
ATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGA
ATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATT
TTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGT
GTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATT
TAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATG
ACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGAT
CTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTC
CTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTC
TGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGA
ATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTT
CAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCT
GTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAA
TTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTC

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1536nt
GCAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTG
AGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCA
CCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAG
AAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCT
CCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCG
TGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTT
GCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAA
TGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGG
CCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTG
ATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCA
GTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAA
AGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATG
AAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCA
AATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCT
GCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAA
CCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTG
CTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1536nt
GCAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTG
AGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCA
CCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAG
AAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCT
CCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCG
TGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTT
GCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAA
TGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGG
CCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTG
ATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCA
GTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAA
AGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATG
AAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCA
AATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCT
GCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAA
CCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTG
CTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1535nt
GCAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTG
AGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCA
CCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAG
AAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCT
CCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCG
TGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTT
GCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAA
TGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGG
CCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTG
ATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCA
GTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAA
AGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATG
AAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCA
AATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCT
GCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAA
CCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTG
CTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAA

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1519nt
GCAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTG
AGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCA
CCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAG
AAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCT
CCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCG
TGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTT
GCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAA
TGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGG
CCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTG
ATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCA
GTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAA
AGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATG
AAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCA
AATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCT
GCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAA
CCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTG

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1518nt
GCAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTG
AGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCA
CCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAG
AAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCT
CCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCG
TGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTT
GCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAA
TGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGG
CCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTG
ATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCA
GTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAA
AGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATG
AAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCA
AATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCT
GCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAA
CCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTG

>In-frame_ZMYND11_ENST00000602682_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_3397nt
GCAGCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTG
AGATTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCA
CCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAG
AAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCT
CCCGCATGAAGGAGAGGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCG
TGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTT
GCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAA
TGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGG
CCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTG
ATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCA
GTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAA
AGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATG
AAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCA
AATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCT
GCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAA
CCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTG
CTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAA
AAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAA
TTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTT
TACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGC
AAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCAT
TTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTA
TTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAA
AAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAG
ATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGA
ATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATT
TTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGT
GTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATT
TAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATG
ACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGAT
CTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTC
CTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTC
TGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGA
ATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTT
CAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCT
GTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAA
TTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTC

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_3744nt
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTAC
ATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGAC
CACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACA
AGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGT
GTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTG
CCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAG
GGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCA
AGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGG
AGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTT
TTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGG
GTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTC
TGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCT
GCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCAC
CAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCG
TCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGA
GCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTAC
TTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCC
TGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGT
AGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGA
CACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTC
CAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGG
AATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGAC
AACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAG
TTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGC
AAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAG
TTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAA
AGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTG
TACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTA
TTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAA
TTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTT
CCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATAT
TGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGA
ACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGT
ACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTT
TATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCAT
TTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAA
GAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATT
AAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATA
TTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATT
CTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTA

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_3744nt
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTAC
ATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGAC
CACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACA
AGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGT
GTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTG
CCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAG
GGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCA
AGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGG
AGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTT
TTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGG
GTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTC
TGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCT
GCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCAC
CAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCG
TCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGA
GCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTAC
TTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCC
TGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGT
AGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGA
CACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTC
CAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGG
AATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGAC
AACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAG
TTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGC
AAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAG
TTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAA
AGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTG
TACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTA
TTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAA
TTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTT
CCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATAT
TGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGA
ACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGT
ACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTT
TATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCAT
TTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAA
GAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATT
AAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATA
TTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATT
CTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTA

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_3744nt
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTAC
ATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGAC
CACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACA
AGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGT
GTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTG
CCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAG
GGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCA
AGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGG
AGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTT
TTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGG
GTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTC
TGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCT
GCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCAC
CAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCG
TCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGA
GCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTAC
TTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCC
TGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGT
AGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGA
CACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTC
CAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGG
AATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGAC
AACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAG
TTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGC
AAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAG
TTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAA
AGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTG
TACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTA
TTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAA
TTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTT
CCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATAT
TGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGA
ACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGT
ACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTT
TATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCAT
TTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAA
GAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATT
AAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATA
TTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATT
CTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTA

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1883nt
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTAC
ATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGAC
CACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACA
AGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGT
GTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTG
CCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAG
GGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCA
AGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGG
AGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTT
TTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGG
GTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTC
TGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCT
GCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCAC
CAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCG
TCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGA
GCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTAC
TTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCC
TGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGT
AGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGA

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1883nt
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTAC
ATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGAC
CACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACA
AGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGT
GTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTG
CCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAG
GGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCA
AGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGG
AGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTT
TTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGG
GTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTC
TGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCT
GCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCAC
CAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCG
TCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGA
GCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTAC
TTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCC
TGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGT
AGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGA

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1882nt
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTAC
ATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGAC
CACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACA
AGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGT
GTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTG
CCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAG
GGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCA
AGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGG
AGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTT
TTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGG
GTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTC
TGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCT
GCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCAC
CAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCG
TCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGA
GCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTAC
TTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCC
TGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGT
AGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGA

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1866nt
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTAC
ATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGAC
CACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACA
AGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGT
GTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTG
CCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAG
GGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCA
AGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGG
AGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTT
TTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGG
GTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTC
TGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCT
GCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCAC
CAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCG
TCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGA
GCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTAC
TTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCC
TGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGT
AGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGA

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1865nt
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTAC
ATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGAC
CACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACA
AGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGT
GTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTG
CCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAG
GGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCA
AGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGG
AGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTT
TTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGG
GTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTC
TGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCT
GCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCAC
CAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCG
TCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGA
GCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTAC
TTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCC
TGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGT
AGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGA

>In-frame_ZMYND11_ENST00000381604_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_3744nt
GCTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGA
TTATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTAC
ATCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGAC
CACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACA
AGAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGT
GTTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTG
CCCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAG
GGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCA
AGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGG
AGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTT
TTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGG
GTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTC
TGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCT
GCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCAC
CAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCG
TCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGA
GCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTAC
TTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCC
TGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGT
AGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGA
CACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTC
CAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGG
AATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGAC
AACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAG
TTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGC
AAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAG
TTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAA
AGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTG
TACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTA
TTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAA
TTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTT
CCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATAT
TGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGA
ACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGT
ACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTT
TATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCAT
TTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAA
GAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATT
AAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATA
TTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATT
CTTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTA

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_3743nt
CTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGAT
TATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTACA
TCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACC
ACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAA
GAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTG
TTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGC
CCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGG
GCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAA
GAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGA
GCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTT
TACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGG
TTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCT
GAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTG
CATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACC
AGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGT
CCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAG
CTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACT
TTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCT
GAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTA
GCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGAC
ACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCC
AGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGA
ATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACA
ACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGT
TAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCA
AACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGT
TGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAA
GCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGT
ACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTAT
TTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAAT
TATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTC
CTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATT
GGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAA
CTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTA
CGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTT
ATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATT
TATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAG
AAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTA
AGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATAT
TTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTC
TTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTAT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_3743nt
CTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGAT
TATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTACA
TCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACC
ACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAA
GAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTG
TTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGC
CCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGG
GCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAA
GAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGA
GCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTT
TACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGG
TTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCT
GAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTG
CATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACC
AGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGT
CCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAG
CTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACT
TTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCT
GAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTA
GCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGAC
ACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCC
AGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGA
ATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACA
ACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGT
TAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCA
AACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGT
TGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAA
GCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGT
ACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTAT
TTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAAT
TATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTC
CTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATT
GGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAA
CTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTA
CGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTT
ATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATT
TATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAG
AAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTA
AGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATAT
TTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTC
TTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTAT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_3743nt
CTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGAT
TATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTACA
TCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACC
ACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAA
GAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTG
TTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGC
CCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGG
GCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAA
GAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGA
GCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTT
TACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGG
TTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCT
GAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTG
CATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACC
AGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGT
CCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAG
CTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACT
TTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCT
GAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTA
GCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGAC
ACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCC
AGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGA
ATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACA
ACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGT
TAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCA
AACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGT
TGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAA
GCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGT
ACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTAT
TTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAAT
TATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTC
CTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATT
GGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAA
CTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTA
CGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTT
ATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATT
TATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAG
AAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTA
AGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATAT
TTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTC
TTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTAT

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1882nt
CTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGAT
TATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTACA
TCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACC
ACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAA
GAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTG
TTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGC
CCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGG
GCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAA
GAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGA
GCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTT
TACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGG
TTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCT
GAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTG
CATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACC
AGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGT
CCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAG
CTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACT
TTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCT
GAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTA
GCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGAC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1882nt
CTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGAT
TATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTACA
TCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACC
ACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAA
GAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTG
TTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGC
CCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGG
GCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAA
GAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGA
GCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTT
TACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGG
TTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCT
GAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTG
CATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACC
AGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGT
CCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAG
CTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACT
TTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCT
GAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTA
GCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGAC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1881nt
CTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGAT
TATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTACA
TCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACC
ACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAA
GAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTG
TTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGC
CCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGG
GCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAA
GAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGA
GCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTT
TACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGG
TTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCT
GAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTG
CATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACC
AGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGT
CCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAG
CTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACT
TTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCT
GAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTA
GCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGAC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1865nt
CTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGAT
TATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTACA
TCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACC
ACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAA
GAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTG
TTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGC
CCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGG
GCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAA
GAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGA
GCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTT
TACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGG
TTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCT
GAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTG
CATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACC
AGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGT
CCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAG
CTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACT
TTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCT
GAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTA
GCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGAC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1864nt
CTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGAT
TATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTACA
TCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACC
ACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAA
GAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTG
TTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGC
CCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGG
GCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAA
GAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGA
GCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTT
TACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGG
TTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCT
GAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTG
CATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACC
AGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGT
CCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAG
CTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACT
TTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCT
GAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTA
GCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGAC

>In-frame_ZMYND11_ENST00000381584_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_3743nt
CTAAAGAAGTAAACAGGTCATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGAT
TATACGGAACCAGAAGCAGATTGCCAACATTGACCGTATTACAAAATGTGAAACAACTACATTATTCTTGAACCTATGGTGATTTTTACA
TCATTACACAGATATGTCATTTTCATTAGTTGTATCATTGTTATAAACTGGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACC
ACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAA
GAAGGATATTGGTTGCCAGGAGATGAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTG
TTGATATGTGACCTGTGTTTTCGTGTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGC
CCAGTTTGCAGGAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGG
GCTATAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAA
GAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGA
GCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTT
TACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGG
TTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCT
GAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTG
CATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACC
AGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGT
CCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAG
CTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACT
TTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCT
GAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTA
GCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGAC
ACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCC
AGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGA
ATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACA
ACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGT
TAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCA
AACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGT
TGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAA
GCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGT
ACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTAT
TTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAAT
TATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTC
CTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATT
GGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAA
CTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTA
CGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTT
ATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATT
TATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAG
AAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTA
AGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATAT
TTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTC
TTACAAGCAAAGGTCATTGTGTTTTTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTAT

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_3629nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG
AAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCT
CCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATAT
TCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTG
TTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGC
TGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTC
GGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAAT
GTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAG
AATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTAT
GAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGC
ATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGA
ATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTT
AGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGT
TCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCA
CCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACAT
ATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAG
ACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAA
AGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTA
GCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTG
ATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACT
CTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTT
TTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTAT

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_3629nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG
AAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCT
CCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATAT
TCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTG
TTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGC
TGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTC
GGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAAT
GTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAG
AATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTAT
GAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGC
ATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGA
ATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTT
AGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGT
TCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCA
CCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACAT
ATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAG
ACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAA
AGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTA
GCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTG
ATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACT
CTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTT
TTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTAT

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_3629nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG
AAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCT
CCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATAT
TCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTG
TTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGC
TGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTC
GGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAAT
GTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAG
AATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTAT
GAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGC
ATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGA
ATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTT
AGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGT
TCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCA
CCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACAT
ATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAG
ACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAA
AGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTA
GCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTG
ATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACT
CTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTT
TTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTAT

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1768nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1768nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1767nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1751nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1750nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG

>In-frame_ZMYND11_ENST00000558098_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_3629nt
ATGGCACGTTTAACAAAAAGACGACAGGCGGATACAAAAGCTATCCAGCATCTTTGGGCAGCCATTGAGATTATACGGAACCAGAAGCAG
ATTGCCAACATTGACCGTATTACAAAGTATATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTG
AAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGAT
GAGATTGACTGGGAAACAGAAAATCATGACTGGTATTGTTTTGAATGCCATTTGCCTGGAGAGGTGTTGATATGTGACCTGTGTTTTCGT
GTGTATCATTCCAAGTGTTTGTCTGATGAGTTCAGGCTTAGAGACAGCAGTAGTCCCTGGCAGTGCCCAGTTTGCAGGAGCATTAAGAAG
AAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGG
AAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATAC
CGAAGTTATGAAGAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATT
GCGAGGATGCTATATAAAGACACATGTCATGAGCTGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGAC
AACTGGTTCTGTTATCCTTGTATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG
AAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCT
CCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATAT
TCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTG
TTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGC
TGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTC
GGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAAT
GTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAG
AATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTAT
GAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGC
ATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGA
ATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTT
AGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGT
TCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCA
CCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACAT
ATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAG
ACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAA
AGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTA
GCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTG
ATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACT
CTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTT
TTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTAT

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_3269nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG
AAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCT
CCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATAT
TCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTG
TTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGC
TGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTC
GGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAAT
GTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAG
AATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTAT
GAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGC
ATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGA
ATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTT
AGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGT
TCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCA
CCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACAT
ATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAG
ACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAA
AGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTA
GCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTG
ATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACT
CTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTT
TTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTAT

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000431808_chr4_186515089_-_3269nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG
AAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCT
CCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATAT
TCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTG
TTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGC
TGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTC
GGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAAT
GTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAG
AATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTAT
GAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGC
ATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGA
ATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTT
AGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGT
TCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCA
CCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACAT
ATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAG
ACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAA
AGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTA
GCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTG
ATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACT
CTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTT
TTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTAT

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000284776_chr4_186515089_-_3269nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG
AAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCT
CCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATAT
TCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTG
TTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGC
TGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTC
GGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAAT
GTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAG
AATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTAT
GAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGC
ATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGA
ATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTT
AGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGT
TCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCA
CCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACAT
ATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAG
ACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAA
AGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTA
GCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTG
ATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACT
CTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTT
TTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTAT

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000437304_chr4_186515089_-_1408nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000319471_chr4_186515089_-_1408nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000449407_chr4_186515089_-_1407nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000355634_chr4_186515089_-_1391nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000393528_chr4_186515089_-_1390nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG

>In-frame_ZMYND11_ENST00000545619_chr10_293406_+_SORBS2_ENST00000418609_chr4_186515089_-_3269nt
ATGTCTCGAGTCCACGGTATGCACCCTAAAGAGACCACCCGTCAGCTGAGCTTAGCTGTGAAAGATGGTCTTATTGTCGAAACTCTAACA
GTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAGATGAGATTAGCATTAAGAAGAAGAATACAAAC
AAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTATAGATCTTAATAAAAAGGGGAAGGACAATAAA
CACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGAAAGTGAATGAAGGGAAATACCGAAGTTATGAA
GAGTTCAAAGCTGATGCCCAATTGCTTCTCCACAATACCGTGATTTTCTATGGAGCAGACAGTGAGCAAGCTGACATTGCGAGGATGCTA
TATAAAGACACATGTCATGAGATACCTAATCATGAGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAG
AAAGAAGACAATCAAGTCGACGTTCGCTTCTTTGGCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTC
AACATTCATCGGCTGCACGTGAAGCGCAGTATGGGTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGG
AGATTTTGGAAATCTAAGAATGAGGACCGAGGTGAGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACT
CAAGAACCAAGAGCAAAGAAAGGACGACGTAATCAAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATT
CAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGAT
GTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGG
CTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCGCCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTT
GTCATGCCTTACGGTTTCCAATGCGCCGTCACCATCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGG
ACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGTGTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAG
AAAAAAATCATGATATTTAAAAATGGTCAAATATTTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCT
CCATTTCAACATCTCCCCCCAGGCGATGTTCTCCCCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATAT
TCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGTTTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTG
TTTGCCTGCACATACATGTTGTAATATGCACAGTGATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGC
TGATTGAATGTGAGTTTTCAAATAGGAGTCTTTTTCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTC
GGTAATAATCATGACAATACAAGAGGCTGAGCTAGGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAAT
GTAATGATCAGCATCATGAACAATGAGCTCTTAGTGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAG
AATTATTCTAACAGACACCTGAAAGTATCTGTAAGCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTAT
GAGAACATATAATCCATATGATATGTTGTACATTTTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGC
ATCACAAGTATTAAAGTTGGTTTTAGCAAGGATTAGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGA
ATCCTGGCTACATTTGAGGACAGGAATATGTTGAGCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTT
AGAAGCAATGTTAAATCATTCAGGTTTTATTTTCTGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGT
TCACAGTGCCTGAATTACACCTGCTCCGAAAACTAGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCA
CCTTACAGATAAAACTTTTTATGGCATCTCTTTCATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACAT
ATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTGAGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAG
ACTAGCCTCTCCTTATCTCACAGATCACAAGCACCCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAA
AGATCGTAGAAGCCAAATGAAATGTACATATCTACTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTA
GCCTACCTTGATTTCTGTCAAGTTCATAACCAGCTTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTG
ATAAATGAATAATTCTCTTTGATGCCATTTATGAGAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACT
CTCTGTATCTGATTTTAAAAGAAAAAACTATTCATACCTGGCTTCCAGGTAATTGACTTTGAATTCTTACAAGCAAAGGTCATTGTGTTT
TTCTTGAATAGACATCTAATAAATTTTGCTTGGAAGTATACTTCAGTTTTTCTTCTTGACATTTATCTTTATAAAAATTGTGTATTTTAT

>In-frame_ZMYND11_ENST00000535374_chr10_293406_+_SORBS2_ENST00000448662_chr4_186515089_-_3145nt
TGAAAGATGGTCTTATTGTCGAAACTCTAACAGTGGGCTGCAAAGGTTCAAAAGCTGGTATTGAACAAGAAGGATATTGGTTGCCAGGAG
ATGAGATTAGCATTAAGAAGAAGAATACAAACAAACAGGAGATGGGCACATACCTCAGATTCATTGTCTCCCGCATGAAGGAGAGGGCTA
TAGATCTTAATAAAAAGGGGAAGGACAATAAACACCCGATGTACAGGAGGCTGGTGCACTCAGCTGTGGACGTTCCCACCATTCAAGAGC
TGGATGAACTGCAGCTTTGCAAGAATTGCTTTTACTTGTCAAATGCTCGTCCTGACAACTGGTTCTGTTATCCTTGTATACCTAATCATG
AGCTGGTTTGGGCTAAAATGAAAGGTTTTGGGTTTTGGCCAGCCAAAGTCATGCAGAAAGAAGACAATCAAGTCGACGTTCGCTTCTTTG
GCCACCACCACCAGAGGGCCTGGATTCCTTCTGAAAACATTCAAGATATCACAGTCAACATTCATCGGCTGCACGTGAAGCGCAGTATGG
GTTGGAAAAAGGCCTGTGATGAGCTGGAGCTGCATCAGCGTTTCCTACGAGAAGGGAGATTTTGGAAATCTAAGAATGAGGACCGAGGTG
AGGAAGAGGCAGAATCCAGTATCTCCTCCACCAGTAATGAGCAGCTAAAGGTCACTCAAGAACCAAGAGCAAAGAAAGGACGACGTAATC
AAAGTGTGGAGCCCAAAAAGGAACCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATA
ACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGG
GGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAATTGCGCTCCCTCCTTCTGTAGAGGCCG
CCTGCCAGCCATGCACCTGCGTCAACGCGCCTGAAACACCCCGCGGGCCTCCCGTTGTCATGCCTTACGGTTTCCAATGCGCCGTCACCA
TCTCCACCTGCCACCAAACCACCAGCAGAGTAGCCGCCGCTGCTGTGAGCCTGGGGACGACATGGCAGGCTGGTCCCCCTCCGTGAAAGT
GTGGATTCCTACTTCCTGCTCTAAGCTTTGACACGTCAAAATGTGGGATCAGAAAGAAAAAAATCATGATATTTAAAAATGGTCAAATAT
TTGAGGCAAAAAAAAAAAAAAAAAGTGTCTCCAGGAGGCTGTCCAGCCTCGTGGCTCCATTTCAACATCTCCCCCCAGGCGATGTTCTCC
CCCAAGACGACCAGAAAATTGTTTATTGGGGAATGCTGTGGTTTGCATTTTCATATTCTTCGCTTGGCAGTGTGTATTCTTTTCACAAGT
TTGCCTAGTGTCTTGGTTTACACAATATGACAACTGTAACTGTACTTTAGCTATTGTTTGCCTGCACATACATGTTGTAATATGCACAGT
GATTACAACCTTTAAAGCAAGAGGAGGCGAGTTAATTTGGATGAGTGTGATTTTGCTGATTGAATGTGAGTTTTCAAATAGGAGTCTTTT
TCTGCAATTTGTTTGCATTTTTTAGAAGTGCAAACAGTAAGTAAATAAAAGCCTTCGGTAATAATCATGACAATACAAGAGGCTGAGCTA
GGCTACAGGGGAAAACTATTGTGTTGTAAAGTTGCATCGCTATTTTATATTAAAATGTAATGATCAGCATCATGAACAATGAGCTCTTAG
TGTTTTATTTATCTGAAAAAATGTAAGTAAAAGCAGTGTTAGTGAGAGGTGCAAAGAATTATTCTAACAGACACCTGAAAGTATCTGTAA
GCAATACTAGTAGGTAAGATTTCACTGTGTGTACACATACACATTTGAGATTGTATGAGAACATATAATCCATATGATATGTTGTACATT
TTATGGAAATGTAATAGAATCTCACACATTATTTTATAGAAATAGAGTACAGAAGCATCACAAGTATTAAAGTTGGTTTTAGCAAGGATT
AGGATTACTACAATTATTTTTACTATAATAATTATTTTTCTTCTATGGAACTCAGAATCCTGGCTACATTTGAGGACAGGAATATGTTGA
GCCTGATTTTCCTGGTGTGTGTAAAATATTTCCTAGGAATAAATTAGGCACTTTTTAGAAGCAATGTTAAATCATTCAGGTTTTATTTTC
TGCCCTGAAGCAGAAATTTAAAAAATGATATTGGGACCTGGAAGGTTTAATATGGTTCACAGTGCCTGAATTACACCTGCTCCGAAAACT
AGCTTTGTATTTCTTATGACTTTGCATAAGAACTGTTCATCTTTGGATCTTGAGCACCTTACAGATAAAACTTTTTATGGCATCTCTTTC
ATGGACAGTGATATTGATCTTTTCACAATGTACGTAGCCTCTAGAATTTTGTACATATGTTTGCTCTTTTTTTGTACAGACTAGTTGTTG
AGAAAACAGGGGCGTTTCCTAATTTGGTCTTTATCCTGCGACAACACTTTCAGCAGACTAGCCTCTCCTTATCTCACAGATCACAAGCAC
CCCTAGATAGTGTGATTCTGTCAGATAGCATTTATGCAAAAATCTATGAAGTTAAAAGATCGTAGAAGCCAAATGAAATGTACATATCTA
CTGACTGATGACAAGGGAATTTCATTAGGAAGAAGGTAAAGAAACATCGTTGAGTAGCCTACCTTGATTTCTGTCAAGTTCATAACCAGC
TTCATATTTTAAAGGCTTCAGGTTTGAAATTAAGTCAACTGCATGCAGCTTTGCTGATAAATGAATAATTCTCTTTGATGCCATTTATGA
GAAAAGACTTCAATATCTGTTGCCTGTCATATTTAAGAAAAATTACTGTTTCTACTCTCTGTATCTGATTTTAAAAGAAAAAACTATTCA
TACCTGGCTTCCAGGTAATTGACT