FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42859

FusionGeneSummary for ZFYVE16_BDP1

check button Fusion gene summary
Fusion gene informationFusion gene name: ZFYVE16_BDP1
Fusion gene ID: 42859
HgeneTgene
Gene symbol

ZFYVE16

BDP1

Gene ID

9765

55814

Gene namezinc finger FYVE-type containing 16B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB
SynonymsPPP1R69HSA238520|TAF3B1|TFC5|TFIIIB''|TFIIIB150|TFIIIB90|TFNR
Cytomap

5q14.1

5q13.2

Type of geneprotein-codingprotein-coding
Descriptionzinc finger FYVE domain-containing protein 16endosome-associated FYVE-domain proteinprotein phosphatase 1, regulatory subunit 69zinc finger, FYVE domain containing 16transcription factor TFIIIB component B'' homologRNA polymerase III transcription initiation factor B''TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3B subunit 1transcription factor IIIB 150transcription factor-like nuclear
Modification date2018052320180523
UniProtAcc

Q7Z3T8

A6H8Y1

Ensembl transtripts involved in fusion geneENST00000338008, ENST00000510158, 
ENST00000505560, ENST00000512442, 
ENST00000358731, ENST00000380675, 
Fusion gene scores* DoF score3 X 3 X 2=183 X 4 X 3=36
# samples 34
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ZFYVE16 [Title/Abstract] AND BDP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-CG-4449-01AZFYVE16chr5

79735851

+BDP1chr5

70848943

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000338008ENST00000358731ZFYVE16chr5

79735851

+BDP1chr5

70848943

+
In-frameENST00000338008ENST00000380675ZFYVE16chr5

79735851

+BDP1chr5

70848943

+
Frame-shitENST00000510158ENST00000358731ZFYVE16chr5

79735851

+BDP1chr5

70848943

+
In-frameENST00000510158ENST00000380675ZFYVE16chr5

79735851

+BDP1chr5

70848943

+
Frame-shitENST00000505560ENST00000358731ZFYVE16chr5

79735851

+BDP1chr5

70848943

+
In-frameENST00000505560ENST00000380675ZFYVE16chr5

79735851

+BDP1chr5

70848943

+
intron-3CDSENST00000512442ENST00000358731ZFYVE16chr5

79735851

+BDP1chr5

70848943

+
intron-3CDSENST00000512442ENST00000380675ZFYVE16chr5

79735851

+BDP1chr5

70848943

+

Top

FusionProtFeatures for ZFYVE16_BDP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZFYVE16

Q7Z3T8

BDP1

A6H8Y1

May be involved in regulating membrane trafficking inthe endosomal pathway. Overexpression induces endosomeaggregation. Required to target TOM1 to endosomes.{ECO:0000269|PubMed:11546807, ECO:0000269|PubMed:14613930}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ZFYVE16_BDP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZFYVE16_ENST00000338008_chr5_79735851_+_BDP1_ENST00000380675_chr5_70848943_+_865aa
MDSTFKAAVSDLDKLLDDFEQNPDEQDTLQDVQNATDSNHCSVSSELASSQRTSLLPKDQECVNSCASSETSTGTNESSLNEKTLKGLTS
IQNEKNVTGLDLLSSVDGGTSDEIQPLTMGRCSKPICDLISDMGNLVHATNSEEDIKKLLPDDFKSNADSLIGLDLSSVSDTPCVSSTDH
DSDTVREQQNDISSELQNREIGGIKELGIKVDTTLSDSTNYSGTENLKDKKIFNQLESIVDFNMSSALTRQSSKMFHAKDKLQHKSQPCG
LLKDVGLVKEEVDVAVITAAECLKEEGKTSALTCSLPKNEDLCLNDSNSRDENFKLPDFSFQEDKTVIKQSAQEDSKSLDLKDNDVIQDS
SSALHVSSKDVPSSLSCLPASGSMCGSLIESKARGDFLPQHEHKDNIQDAVTIHEEIQNSVVLGGEPFKENDLLKQEKCKSILLQSLIEG
MEDRKIDPDQTVIRAESLDGGDTSSTVVESQEGLSGTHVPESSDCCEGFINTFSSNDMDGQDLDYFNIDEGAKSGPLISDAELDAFLTEQ
TLQTTNIKSFEENVNDSKSQMNQIDMKGLDDGNINNITFNAEAGAIGESHGINIICEIVDKQNTIENGLSLGEKSTIPVQQGLPTSKSEI
TNQLSVSDINSQSVGGARPKQLFSLPSRTRSSKDLNKPDVPDTIESEPSTADTVVPITCAIDSTADPQVSFNSNYIDIESNSEGGSSFVT
ANEDSVPENTCKEGLVLGQKQPTWVPDSEAPNCMNCQVKFTFTKRRHHCRACGKVFCGVCCNRKCKLQTLEKEARVCVVCTETISKVFVY

>In-frame_ZFYVE16_ENST00000510158_chr5_79735851_+_BDP1_ENST00000380675_chr5_70848943_+_865aa
MDSTFKAAVSDLDKLLDDFEQNPDEQDTLQDVQNATDSNHCSVSSELASSQRTSLLPKDQECVNSCASSETSTGTNESSLNEKTLKGLTS
IQNEKNVTGLDLLSSVDGGTSDEIQPLTMGRCSKPICDLISDMGNLVHATNSEEDIKKLLPDDFKSNADSLIGLDLSSVSDTPCVSSTDH
DSDTVREQQNDISSELQNREIGGIKELGIKVDTTLSDSTNYSGTENLKDKKIFNQLESIVDFNMSSALTRQSSKMFHAKDKLQHKSQPCG
LLKDVGLVKEEVDVAVITAAECLKEEGKTSALTCSLPKNEDLCLNDSNSRDENFKLPDFSFQEDKTVIKQSAQEDSKSLDLKDNDVIQDS
SSALHVSSKDVPSSLSCLPASGSMCGSLIESKARGDFLPQHEHKDNIQDAVTIHEEIQNSVVLGGEPFKENDLLKQEKCKSILLQSLIEG
MEDRKIDPDQTVIRAESLDGGDTSSTVVESQEGLSGTHVPESSDCCEGFINTFSSNDMDGQDLDYFNIDEGAKSGPLISDAELDAFLTEQ
TLQTTNIKSFEENVNDSKSQMNQIDMKGLDDGNINNITFNAEAGAIGESHGINIICEIVDKQNTIENGLSLGEKSTIPVQQGLPTSKSEI
TNQLSVSDINSQSVGGARPKQLFSLPSRTRSSKDLNKPDVPDTIESEPSTADTVVPITCAIDSTADPQVSFNSNYIDIESNSEGGSSFVT
ANEDSVPENTCKEGLVLGQKQPTWVPDSEAPNCMNCQVKFTFTKRRHHCRACGKVFCGVCCNRKCKLQTLEKEARVCVVCTETISKVFVY

>In-frame_ZFYVE16_ENST00000505560_chr5_79735851_+_BDP1_ENST00000380675_chr5_70848943_+_865aa
MDSTFKAAVSDLDKLLDDFEQNPDEQDTLQDVQNATDSNHCSVSSELASSQRTSLLPKDQECVNSCASSETSTGTNESSLNEKTLKGLTS
IQNEKNVTGLDLLSSVDGGTSDEIQPLTMGRCSKPICDLISDMGNLVHATNSEEDIKKLLPDDFKSNADSLIGLDLSSVSDTPCVSSTDH
DSDTVREQQNDISSELQNREIGGIKELGIKVDTTLSDSTNYSGTENLKDKKIFNQLESIVDFNMSSALTRQSSKMFHAKDKLQHKSQPCG
LLKDVGLVKEEVDVAVITAAECLKEEGKTSALTCSLPKNEDLCLNDSNSRDENFKLPDFSFQEDKTVIKQSAQEDSKSLDLKDNDVIQDS
SSALHVSSKDVPSSLSCLPASGSMCGSLIESKARGDFLPQHEHKDNIQDAVTIHEEIQNSVVLGGEPFKENDLLKQEKCKSILLQSLIEG
MEDRKIDPDQTVIRAESLDGGDTSSTVVESQEGLSGTHVPESSDCCEGFINTFSSNDMDGQDLDYFNIDEGAKSGPLISDAELDAFLTEQ
TLQTTNIKSFEENVNDSKSQMNQIDMKGLDDGNINNITFNAEAGAIGESHGINIICEIVDKQNTIENGLSLGEKSTIPVQQGLPTSKSEI
TNQLSVSDINSQSVGGARPKQLFSLPSRTRSSKDLNKPDVPDTIESEPSTADTVVPITCAIDSTADPQVSFNSNYIDIESNSEGGSSFVT
ANEDSVPENTCKEGLVLGQKQPTWVPDSEAPNCMNCQVKFTFTKRRHHCRACGKVFCGVCCNRKCKLQTLEKEARVCVVCTETISKVFVY


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZFYVE16_ENST00000338008_chr5_79735851_+_BDP1_ENST00000380675_chr5_70848943_+_2595nt
ATGGACAGTTATTTTAAAGCAGCTGTCAGTGACTTGGACAAACTCCTTGATGATTTTGAACAGAACCCAGATGAACAAGATTATCTCCAA
GATGTACAAAATGCATATGATTCTAACCACTGCTCAGTTTCTTCAGAGTTGGCTTCCTCACAGCGAACTTCATTGCTCCCAAAAGACCAA
GAGTGCGTTAATAGTTGTGCCTCATCAGAAACAAGCTATGGAACAAATGAGAGTTCCCTGAATGAAAAAACACTCAAGGGACTTACTTCT
ATACAAAATGAAAAAAATGTAACAGGACTTGATCTTCTTTCTTCTGTGGATGGTGGTACTTCAGATGAAATCCAGCCGTTATATATGGGA
CGATGTAGTAAACCTATCTGTGATCTGATAAGTGACATGGGTAACTTAGTTCATGCAACCAATAGTGAAGAAGATATTAAAAAATTATTG
CCAGATGATTTTAAGTCTAATGCAGATTCCTTGATTGGATTGGATTTATCTTCAGTGTCAGATACTCCCTGTGTTTCTTCAACAGACCAT
GATAGTGATACTGTCAGAGAACAACAGAATGATATCAGTTCTGAATTACAAAATAGAGAAATCGGAGGAATCAAAGAATTGGGTATAAAA
GTAGATACAACACTTTCAGATTCCTATAATTACAGTGGAACAGAAAATTTAAAAGATAAAAAGATCTTTAATCAGTTAGAATCAATTGTT
GATTTTAACATGTCATCTGCTTTGACTCGACAAAGTTCCAAAATGTTTCATGCCAAAGACAAGCTACAACACAAGAGCCAGCCATGTGGA
TTACTAAAAGATGTTGGCTTAGTAAAAGAGGAAGTAGATGTGGCAGTCATAACTGCCGCAGAATGTTTAAAAGAAGAGGGCAAGACAAGT
GCTTTGACCTGCAGCCTTCCGAAAAATGAAGATTTATGCTTAAATGATTCAAATTCAAGAGATGAAAATTTCAAATTACCTGACTTTTCC
TTTCAGGAAGATAAGACTGTTATAAAACAATCTGCACAAGAAGACTCAAAAAGTTTAGACCTTAAGGATAATGATGTAATCCAAGATTCC
TCTTCAGCTTTACATGTTTCCAGTAAAGATGTGCCGTCCTCATTGTCCTGTCTTCCTGCGTCTGGGTCTATGTGTGGATCATTAATTGAA
AGTAAAGCACGGGGTGATTTTTTACCTCAGCATGAACATAAAGATAATATACAAGATGCAGTGACTATACATGAAGAAATACAGAACAGT
GTTGTTCTAGGTGGGGAACCATTCAAAGAGAATGATCTTTTGAAACAGGAAAAATGTAAAAGCATACTCCTTCAGTCATTAATTGAAGGG
ATGGAAGACAGAAAGATAGATCCTGACCAGACAGTAATCAGAGCTGAGTCTTTGGATGGTGGTGACACCAGTTCTACAGTTGTAGAATCT
CAAGAGGGGCTTTCTGGCACTCATGTCCCAGAGTCTTCTGATTGTTGTGAAGGTTTTATTAATACTTTTTCAAGCAATGATATGGATGGG
CAAGACTTAGATTACTTTAATATTGATGAAGGCGCAAAAAGTGGCCCACTAATTAGTGATGCTGAACTTGATGCCTTTCTGACAGAACAG
TATCTTCAGACCACTAACATAAAGTCTTTTGAAGAAAATGTAAATGACTCTAAATCGCAAATGAATCAGATAGATATGAAAGGCTTAGAT
GATGGAAACATCAATAATATATATTTCAATGCAGAAGCAGGAGCTATTGGGGAAAGTCATGGTATTAATATAATTTGTGAAATAGTTGAT
AAACAAAATACAATAGAAAATGGCCTTTCTTTAGGAGAAAAAAGCACTATTCCAGTTCAACAAGGGTTACCTACCAGTAAGTCTGAGATT
ACAAATCAATTATCGGTCTCTGATATTAACAGTCAATCTGTTGGAGGGGCCAGACCTAAGCAATTGTTTAGCCTTCCATCAAGAACAAGG
AGTTCAAAGGACCTGAATAAGCCAGATGTTCCAGATACAATAGAAAGTGAACCCAGCACAGCAGATACCGTTGTTCCAATCACTTGTGCT
ATAGATTCTACAGCTGATCCACAGGTTAGCTTCAACTCTAATTACATTGATATAGAAAGTAATTCTGAAGGTGGATCTAGTTTCGTAACT
GCAAATGAAGATTCTGTACCTGAAAACACTTGCAAAGAAGGCTTGGTTTTGGGCCAGAAACAGCCTACTTGGGTTCCTGATTCAGAAGCT
CCAAACTGTATGAACTGCCAAGTCAAATTTACTTTTACCAAACGGCGACACCATTGCCGAGCATGTGGGAAAGTATTTTGTGGTGTCTGT
TGTAATAGGAAGTGTAAACTGCAATATCTAGAAAAGGAAGCAAGAGTATGTGTAGTCTGCTATGAAACTATTAGTAAAGTATTTGTTTAC
CAGCAACTTCAGTTGGTCAAGATGCCATGGGTTTATCTATTTCTGGAAGAGATAATTCTAAAAAGCCGCCTGATAATTTGGATCTTGTAT

>In-frame_ZFYVE16_ENST00000510158_chr5_79735851_+_BDP1_ENST00000380675_chr5_70848943_+_2595nt
ATGGACAGTTATTTTAAAGCAGCTGTCAGTGACTTGGACAAACTCCTTGATGATTTTGAACAGAACCCAGATGAACAAGATTATCTCCAA
GATGTACAAAATGCATATGATTCTAACCACTGCTCAGTTTCTTCAGAGTTGGCTTCCTCACAGCGAACTTCATTGCTCCCAAAAGACCAA
GAGTGCGTTAATAGTTGTGCCTCATCAGAAACAAGCTATGGAACAAATGAGAGTTCCCTGAATGAAAAAACACTCAAGGGACTTACTTCT
ATACAAAATGAAAAAAATGTAACAGGACTTGATCTTCTTTCTTCTGTGGATGGTGGTACTTCAGATGAAATCCAGCCGTTATATATGGGA
CGATGTAGTAAACCTATCTGTGATCTGATAAGTGACATGGGTAACTTAGTTCATGCAACCAATAGTGAAGAAGATATTAAAAAATTATTG
CCAGATGATTTTAAGTCTAATGCAGATTCCTTGATTGGATTGGATTTATCTTCAGTGTCAGATACTCCCTGTGTTTCTTCAACAGACCAT
GATAGTGATACTGTCAGAGAACAACAGAATGATATCAGTTCTGAATTACAAAATAGAGAAATCGGAGGAATCAAAGAATTGGGTATAAAA
GTAGATACAACACTTTCAGATTCCTATAATTACAGTGGAACAGAAAATTTAAAAGATAAAAAGATCTTTAATCAGTTAGAATCAATTGTT
GATTTTAACATGTCATCTGCTTTGACTCGACAAAGTTCCAAAATGTTTCATGCCAAAGACAAGCTACAACACAAGAGCCAGCCATGTGGA
TTACTAAAAGATGTTGGCTTAGTAAAAGAGGAAGTAGATGTGGCAGTCATAACTGCCGCAGAATGTTTAAAAGAAGAGGGCAAGACAAGT
GCTTTGACCTGCAGCCTTCCGAAAAATGAAGATTTATGCTTAAATGATTCAAATTCAAGAGATGAAAATTTCAAATTACCTGACTTTTCC
TTTCAGGAAGATAAGACTGTTATAAAACAATCTGCACAAGAAGACTCAAAAAGTTTAGACCTTAAGGATAATGATGTAATCCAAGATTCC
TCTTCAGCTTTACATGTTTCCAGTAAAGATGTGCCGTCCTCATTGTCCTGTCTTCCTGCGTCTGGGTCTATGTGTGGATCATTAATTGAA
AGTAAAGCACGGGGTGATTTTTTACCTCAGCATGAACATAAAGATAATATACAAGATGCAGTGACTATACATGAAGAAATACAGAACAGT
GTTGTTCTAGGTGGGGAACCATTCAAAGAGAATGATCTTTTGAAACAGGAAAAATGTAAAAGCATACTCCTTCAGTCATTAATTGAAGGG
ATGGAAGACAGAAAGATAGATCCTGACCAGACAGTAATCAGAGCTGAGTCTTTGGATGGTGGTGACACCAGTTCTACAGTTGTAGAATCT
CAAGAGGGGCTTTCTGGCACTCATGTCCCAGAGTCTTCTGATTGTTGTGAAGGTTTTATTAATACTTTTTCAAGCAATGATATGGATGGG
CAAGACTTAGATTACTTTAATATTGATGAAGGCGCAAAAAGTGGCCCACTAATTAGTGATGCTGAACTTGATGCCTTTCTGACAGAACAG
TATCTTCAGACCACTAACATAAAGTCTTTTGAAGAAAATGTAAATGACTCTAAATCGCAAATGAATCAGATAGATATGAAAGGCTTAGAT
GATGGAAACATCAATAATATATATTTCAATGCAGAAGCAGGAGCTATTGGGGAAAGTCATGGTATTAATATAATTTGTGAAATAGTTGAT
AAACAAAATACAATAGAAAATGGCCTTTCTTTAGGAGAAAAAAGCACTATTCCAGTTCAACAAGGGTTACCTACCAGTAAGTCTGAGATT
ACAAATCAATTATCGGTCTCTGATATTAACAGTCAATCTGTTGGAGGGGCCAGACCTAAGCAATTGTTTAGCCTTCCATCAAGAACAAGG
AGTTCAAAGGACCTGAATAAGCCAGATGTTCCAGATACAATAGAAAGTGAACCCAGCACAGCAGATACCGTTGTTCCAATCACTTGTGCT
ATAGATTCTACAGCTGATCCACAGGTTAGCTTCAACTCTAATTACATTGATATAGAAAGTAATTCTGAAGGTGGATCTAGTTTCGTAACT
GCAAATGAAGATTCTGTACCTGAAAACACTTGCAAAGAAGGCTTGGTTTTGGGCCAGAAACAGCCTACTTGGGTTCCTGATTCAGAAGCT
CCAAACTGTATGAACTGCCAAGTCAAATTTACTTTTACCAAACGGCGACACCATTGCCGAGCATGTGGGAAAGTATTTTGTGGTGTCTGT
TGTAATAGGAAGTGTAAACTGCAATATCTAGAAAAGGAAGCAAGAGTATGTGTAGTCTGCTATGAAACTATTAGTAAAGTATTTGTTTAC
CAGCAACTTCAGTTGGTCAAGATGCCATGGGTTTATCTATTTCTGGAAGAGATAATTCTAAAAAGCCGCCTGATAATTTGGATCTTGTAT

>In-frame_ZFYVE16_ENST00000505560_chr5_79735851_+_BDP1_ENST00000380675_chr5_70848943_+_2595nt
ATGGACAGTTATTTTAAAGCAGCTGTCAGTGACTTGGACAAACTCCTTGATGATTTTGAACAGAACCCAGATGAACAAGATTATCTCCAA
GATGTACAAAATGCATATGATTCTAACCACTGCTCAGTTTCTTCAGAGTTGGCTTCCTCACAGCGAACTTCATTGCTCCCAAAAGACCAA
GAGTGCGTTAATAGTTGTGCCTCATCAGAAACAAGCTATGGAACAAATGAGAGTTCCCTGAATGAAAAAACACTCAAGGGACTTACTTCT
ATACAAAATGAAAAAAATGTAACAGGACTTGATCTTCTTTCTTCTGTGGATGGTGGTACTTCAGATGAAATCCAGCCGTTATATATGGGA
CGATGTAGTAAACCTATCTGTGATCTGATAAGTGACATGGGTAACTTAGTTCATGCAACCAATAGTGAAGAAGATATTAAAAAATTATTG
CCAGATGATTTTAAGTCTAATGCAGATTCCTTGATTGGATTGGATTTATCTTCAGTGTCAGATACTCCCTGTGTTTCTTCAACAGACCAT
GATAGTGATACTGTCAGAGAACAACAGAATGATATCAGTTCTGAATTACAAAATAGAGAAATCGGAGGAATCAAAGAATTGGGTATAAAA
GTAGATACAACACTTTCAGATTCCTATAATTACAGTGGAACAGAAAATTTAAAAGATAAAAAGATCTTTAATCAGTTAGAATCAATTGTT
GATTTTAACATGTCATCTGCTTTGACTCGACAAAGTTCCAAAATGTTTCATGCCAAAGACAAGCTACAACACAAGAGCCAGCCATGTGGA
TTACTAAAAGATGTTGGCTTAGTAAAAGAGGAAGTAGATGTGGCAGTCATAACTGCCGCAGAATGTTTAAAAGAAGAGGGCAAGACAAGT
GCTTTGACCTGCAGCCTTCCGAAAAATGAAGATTTATGCTTAAATGATTCAAATTCAAGAGATGAAAATTTCAAATTACCTGACTTTTCC
TTTCAGGAAGATAAGACTGTTATAAAACAATCTGCACAAGAAGACTCAAAAAGTTTAGACCTTAAGGATAATGATGTAATCCAAGATTCC
TCTTCAGCTTTACATGTTTCCAGTAAAGATGTGCCGTCCTCATTGTCCTGTCTTCCTGCGTCTGGGTCTATGTGTGGATCATTAATTGAA
AGTAAAGCACGGGGTGATTTTTTACCTCAGCATGAACATAAAGATAATATACAAGATGCAGTGACTATACATGAAGAAATACAGAACAGT
GTTGTTCTAGGTGGGGAACCATTCAAAGAGAATGATCTTTTGAAACAGGAAAAATGTAAAAGCATACTCCTTCAGTCATTAATTGAAGGG
ATGGAAGACAGAAAGATAGATCCTGACCAGACAGTAATCAGAGCTGAGTCTTTGGATGGTGGTGACACCAGTTCTACAGTTGTAGAATCT
CAAGAGGGGCTTTCTGGCACTCATGTCCCAGAGTCTTCTGATTGTTGTGAAGGTTTTATTAATACTTTTTCAAGCAATGATATGGATGGG
CAAGACTTAGATTACTTTAATATTGATGAAGGCGCAAAAAGTGGCCCACTAATTAGTGATGCTGAACTTGATGCCTTTCTGACAGAACAG
TATCTTCAGACCACTAACATAAAGTCTTTTGAAGAAAATGTAAATGACTCTAAATCGCAAATGAATCAGATAGATATGAAAGGCTTAGAT
GATGGAAACATCAATAATATATATTTCAATGCAGAAGCAGGAGCTATTGGGGAAAGTCATGGTATTAATATAATTTGTGAAATAGTTGAT
AAACAAAATACAATAGAAAATGGCCTTTCTTTAGGAGAAAAAAGCACTATTCCAGTTCAACAAGGGTTACCTACCAGTAAGTCTGAGATT
ACAAATCAATTATCGGTCTCTGATATTAACAGTCAATCTGTTGGAGGGGCCAGACCTAAGCAATTGTTTAGCCTTCCATCAAGAACAAGG
AGTTCAAAGGACCTGAATAAGCCAGATGTTCCAGATACAATAGAAAGTGAACCCAGCACAGCAGATACCGTTGTTCCAATCACTTGTGCT
ATAGATTCTACAGCTGATCCACAGGTTAGCTTCAACTCTAATTACATTGATATAGAAAGTAATTCTGAAGGTGGATCTAGTTTCGTAACT
GCAAATGAAGATTCTGTACCTGAAAACACTTGCAAAGAAGGCTTGGTTTTGGGCCAGAAACAGCCTACTTGGGTTCCTGATTCAGAAGCT
CCAAACTGTATGAACTGCCAAGTCAAATTTACTTTTACCAAACGGCGACACCATTGCCGAGCATGTGGGAAAGTATTTTGTGGTGTCTGT
TGTAATAGGAAGTGTAAACTGCAATATCTAGAAAAGGAAGCAAGAGTATGTGTAGTCTGCTATGAAACTATTAGTAAAGTATTTGTTTAC
CAGCAACTTCAGTTGGTCAAGATGCCATGGGTTTATCTATTTCTGGAAGAGATAATTCTAAAAAGCCGCCTGATAATTTGGATCTTGTAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZFYVE16_ENST00000338008_chr5_79735851_+_BDP1_ENST00000380675_chr5_70848943_+_6416nt
CTCTGCGCTGCCCGGTGGGGCGGGGAAAGAAGCCCTGAGCCGGGATCTGGCACTCCCAGGACTCCCGGCCGGGGTAGCTCTTCACTCCTC
AGCGCGACGTCGTGTCGAGTTCCCAAAAAGCTCCGCAGGGGCTGTAGGGAGGCATACAAGAATTAAATTCTGAATAAGTCTGCAGGTAGG
ATGGACAGTTATTTTAAAGCAGCTGTCAGTGACTTGGACAAACTCCTTGATGATTTTGAACAGAACCCAGATGAACAAGATTATCTCCAA
GATGTACAAAATGCATATGATTCTAACCACTGCTCAGTTTCTTCAGAGTTGGCTTCCTCACAGCGAACTTCATTGCTCCCAAAAGACCAA
GAGTGCGTTAATAGTTGTGCCTCATCAGAAACAAGCTATGGAACAAATGAGAGTTCCCTGAATGAAAAAACACTCAAGGGACTTACTTCT
ATACAAAATGAAAAAAATGTAACAGGACTTGATCTTCTTTCTTCTGTGGATGGTGGTACTTCAGATGAAATCCAGCCGTTATATATGGGA
CGATGTAGTAAACCTATCTGTGATCTGATAAGTGACATGGGTAACTTAGTTCATGCAACCAATAGTGAAGAAGATATTAAAAAATTATTG
CCAGATGATTTTAAGTCTAATGCAGATTCCTTGATTGGATTGGATTTATCTTCAGTGTCAGATACTCCCTGTGTTTCTTCAACAGACCAT
GATAGTGATACTGTCAGAGAACAACAGAATGATATCAGTTCTGAATTACAAAATAGAGAAATCGGAGGAATCAAAGAATTGGGTATAAAA
GTAGATACAACACTTTCAGATTCCTATAATTACAGTGGAACAGAAAATTTAAAAGATAAAAAGATCTTTAATCAGTTAGAATCAATTGTT
GATTTTAACATGTCATCTGCTTTGACTCGACAAAGTTCCAAAATGTTTCATGCCAAAGACAAGCTACAACACAAGAGCCAGCCATGTGGA
TTACTAAAAGATGTTGGCTTAGTAAAAGAGGAAGTAGATGTGGCAGTCATAACTGCCGCAGAATGTTTAAAAGAAGAGGGCAAGACAAGT
GCTTTGACCTGCAGCCTTCCGAAAAATGAAGATTTATGCTTAAATGATTCAAATTCAAGAGATGAAAATTTCAAATTACCTGACTTTTCC
TTTCAGGAAGATAAGACTGTTATAAAACAATCTGCACAAGAAGACTCAAAAAGTTTAGACCTTAAGGATAATGATGTAATCCAAGATTCC
TCTTCAGCTTTACATGTTTCCAGTAAAGATGTGCCGTCCTCATTGTCCTGTCTTCCTGCGTCTGGGTCTATGTGTGGATCATTAATTGAA
AGTAAAGCACGGGGTGATTTTTTACCTCAGCATGAACATAAAGATAATATACAAGATGCAGTGACTATACATGAAGAAATACAGAACAGT
GTTGTTCTAGGTGGGGAACCATTCAAAGAGAATGATCTTTTGAAACAGGAAAAATGTAAAAGCATACTCCTTCAGTCATTAATTGAAGGG
ATGGAAGACAGAAAGATAGATCCTGACCAGACAGTAATCAGAGCTGAGTCTTTGGATGGTGGTGACACCAGTTCTACAGTTGTAGAATCT
CAAGAGGGGCTTTCTGGCACTCATGTCCCAGAGTCTTCTGATTGTTGTGAAGGTTTTATTAATACTTTTTCAAGCAATGATATGGATGGG
CAAGACTTAGATTACTTTAATATTGATGAAGGCGCAAAAAGTGGCCCACTAATTAGTGATGCTGAACTTGATGCCTTTCTGACAGAACAG
TATCTTCAGACCACTAACATAAAGTCTTTTGAAGAAAATGTAAATGACTCTAAATCGCAAATGAATCAGATAGATATGAAAGGCTTAGAT
GATGGAAACATCAATAATATATATTTCAATGCAGAAGCAGGAGCTATTGGGGAAAGTCATGGTATTAATATAATTTGTGAAATAGTTGAT
AAACAAAATACAATAGAAAATGGCCTTTCTTTAGGAGAAAAAAGCACTATTCCAGTTCAACAAGGGTTACCTACCAGTAAGTCTGAGATT
ACAAATCAATTATCGGTCTCTGATATTAACAGTCAATCTGTTGGAGGGGCCAGACCTAAGCAATTGTTTAGCCTTCCATCAAGAACAAGG
AGTTCAAAGGACCTGAATAAGCCAGATGTTCCAGATACAATAGAAAGTGAACCCAGCACAGCAGATACCGTTGTTCCAATCACTTGTGCT
ATAGATTCTACAGCTGATCCACAGGTTAGCTTCAACTCTAATTACATTGATATAGAAAGTAATTCTGAAGGTGGATCTAGTTTCGTAACT
GCAAATGAAGATTCTGTACCTGAAAACACTTGCAAAGAAGGCTTGGTTTTGGGCCAGAAACAGCCTACTTGGGTTCCTGATTCAGAAGCT
CCAAACTGTATGAACTGCCAAGTCAAATTTACTTTTACCAAACGGCGACACCATTGCCGAGCATGTGGGAAAGTATTTTGTGGTGTCTGT
TGTAATAGGAAGTGTAAACTGCAATATCTAGAAAAGGAAGCAAGAGTATGTGTAGTCTGCTATGAAACTATTAGTAAAGTATTTGTTTAC
CAGCAACTTCAGTTGGTCAAGATGCCATGGGTTTATCTATTTCTGGAAGAGATAATTCTAAAAAGCCGCCTGATAATTTGGATCTTGTAT
CTAGGAAGAGATTTCAATGCAGGCTTGATAAAAATGACCACATTCCTCCTGCCAAAAAACGTTCACTCACTTTAAGAGATGACTGTCAAG
AATATACCACTGAGGTGCACTCAAAGGAATTAACAAATGTTTTTGAGGAAACAGGGGAGTCTCACAAGGGACAAGATATTTTTCTTACCT
CAGGAAGCACACTGACAACTCCAGAACCTCAAAGACAGCAAGTTGAAGCAGCTTTTCAGAGTAGAGGATCTAGATCTCCTGATGCATGCA
TGGACAAGAATGTGCCTCAGTTACCTCAGGATGAAATGATTGTGTCTGATAAGGAAGAAAGAACTGATGCTGCTCCTAAGTCTCAGCAAA
TGGATAGCAGAACATCGTCTTCTAAAGCCTCACTATCCAGACCTGGCAGAAGACCCCTGGGATTTTTATCTTTAATATGCTCAAAGAATA
GTTTGGAGTCTGATGAACCTATGCAAGTCCATAGTAAGAAACGCCTAAAACCTCTTATACCTGGATTAAGAAAGAAATTGAAAAGATCTA
ATCCATTCAATGAAAGCCAGGAAAAAAATCGAGAGTCCTCTGATCTGCTTCCATCTCCAAGTGTTATTACTACTCAATCTGAGAATATTA
GCAGCTCAGCAACTCAGGTTTCTTGTGATCAGCCCTTACTGAAAGAAGGATATAAAAGTGCCCAAAAGCGGGCCCCTCAAGGGGAGGCAA
CCACAGTCTCTGAATATTTCTTCAATGATATCTTCATTGAAGTGGATGAAACAGAATAAAACAATCTTTTCTCTTTTTCTTTTTTAAATT
AGGTCTAGGATTTCCAGAGTCAATTACATCAACAAAACAGTATTTAGAGCAAAATATCACTGTCTTATTTTTCTTTAGGTTGATTTTGAA
TACTTAATGAGCTTGATTTGAAGCTTTTATAATCAGTGGAAAACATTTCTGAGGTTCCTTTCATTCTGACTGATTCAGCATTTTGCAAAT
AGCAAGCAATTAAGACTGCTTTCTCAGACAGAAATAACAACTCTTGTTTACATTTTGACTCTTCCTGTGCTAAGCACACATGGACATTTG
GGAATGTTGTGGATATATGTCTCTGTATGAATTGCAGTGCAGACAGATTTGGGGGTTAATTGTATCATATTTAACATTTAGCAACTTCTT
TTGTGAAGATTTTTTATTTTTAGGGGGAGATGATGAAGGATGAAGGCTTTTTCATTTGCTTCTAAGTACAGTCATGTATCACATAATGAA
GTTTAAGTCAATGATGGACCACATATATTACAGTGGTCCCATGCAATTAAAATGGAGATAAATTCCTATCAACTAGTGACATTATAGCCA
TCATAACACAGTGCATTGCTTTTTTATGTTTAGATATGTTTAGATACACAAATACTTACTATTGTGTTACAACTGCCTACAGTATTCAGC
ATAGTAACACATTGTAGAGGTTTGTAGCCGAGGAGCAATAGGCTATACCACATAGCCTCAGTCTGTACGGTGTGTAGCAGCCTGTACCAT
CTCAGTGTTTGTAAGTACACTCTGCGTTGTTTCACACAAGATCACCTAACAAGGCAATTCTTAGAACATGTAGTTAAGGGACACGTGACT
ATATGTGAAAACAAATTGTCAAACTTCACTTTAGTATGGCAAATGTTAAAGAACTTTTCTATTATCAGCTGTTTGTCTGACTGAAAAATA
CATATTTTTCTAATTCATGGTGATGTAACATTAGTCCTAATTGAAAAACTAGTATTTAAACATAATTATTTATAAAGATGACACATCAAA
GGGCTTATTTATTTTTAAATTTTTTATTTAAAAGGATATTCAGTTTTAGCTATTTTTACCCCTCAGATTGTAGATAAAGAAGGCATTAAA
TTTATGTTTGTCTCCTTTTTCTGTTTAATTTTAAAGATATTTAAAATGATATAACTAAAAATGTTTAGCTGGTGTATATGTTTTGAATAC
CTTTTTCCCCTCAGTTTAGTATATTGACTTTGTACTGTAAATTTTTCTGCTTTTCTTGGATAATCTCAGGATTTTCATGAGGATAGGGGG
AACTCAACTTTATTTATGAGACAAAATTTCCATACAAAGCTCAATCTCCTTTATACACCCACAGACATAATATTAGTTTTTAAAAAGCCA
ATTTCTTCATAGTTTTTTCCCATTAAATTCTCAAGGAACACTTGGATCTTTAAGCACGGAACATAATCATGATGTTAAAAACAGAGAAAA
TAAGGCTTTATAAAGTTAATGATTATCATCAGTATGAATTTAAGGTTTGTTTTAATTTCAAGATTTGATTTTTTATACGTGTAATTCTAT
TATCTACCCAAGCAGATCTGTAGTGGTTCCAATTAGACTTCTCAAACAGCAAATTTATCCTGATTTTATTTGAAAAGCCTCTTGGATTGA
TAGTATAGTAGCTCAGGCATTGGAAACTTTCTGCAAACTGTTTTGGGTTTGCAGGCCAGATGGTCTCTGTGGCAGCTACTCAGCTCTGCA
ATTTCAGTGTGAAAGAAGCCATAGACAGTACTTGAATGAAGGACTGTGGCTGGATTGGCCTTTTAGTTTGACCCCCTACATTAGGCCCCA
AATTTTCTTACCCTGAGGTGCTGATATCTGTATGGATGAGTTATTTGTCACTAAAGTTATGAGTTGTGCCTAAAAGTTAAAACTGTTGAC
TGTATTATGTAATGATCAGTATTTCAGTTGGGAAGATATTTTAGAGTCTAGATAATTATGTTTGTATATTGAAAAAATGGTGGCCAGTTT
TTAAGTTCCTTAATAGAAGAGAATTATGTCTCAGCACATATAACAGTAATGCTAATTTATTGAAACTACTGCTGTTAGAGCACTTCTTAT
TCATTGTCTTTTAGTGAAATTTATGGCGTAACACTTTGTCAGAGAGGAGGCTATATAATTCGGAGCGGAAATTGTCTATAAGTAGGCATT
TATTTCATGATTGATATGTCACAGAAATCATGGTAGTAAATCACATTGCTATTTGAATACCCTGTTTTTGTAAGTTTTTAAAACTCATAT
TCTGAAAAGATTTCATTCTCTTAGTGTTAGCTTGGGAGTTAGATTGCCATGATTAAACTATTATTTATCCTTGTGTAATATTAGTTTTTA
ACTTTAACATCTGTTTCTTTTTAATCTATAATGAGCTAGTTTTATGGAAAATGGAATTTCTTACTATATAAAGAATACAGAGACTCATTG
TATTAGAGAATCAAGTCAGCCAGCTAAAGTATCCTACTGTTAAATCCTTAAACCTAATTTTGGAAAAGAGAAAGTTAATCAATGTATTTA
CCTTACATGTTGGAAAGAACTATGTTAGGTCTGATTCATGTGAAGAAGATGTTGCAAAGGATTTATTTCACAAATTTTAAAGGAGATATG
AGTAAAAGTTTTTATCTTTTCTTGACTTTTTCTCCTGAACACTTATGTCTTAGCAAGTGGTCAACATGAGGATTTGAACGCCTAATTGTT
GGTAAATGGTTGAGGCATGACAAAAATATTAATATCCACTGTTTACCATCATGTTATTTGAAACAAAAGTGACCATGTATACTATCTTGC
TTGAAGAAGTCTTTGACAGAAAAAGCAATATCATGTCATTTATAAATTTTCTTGTTCTAAAGAAAGCAGTTATATATATATATAAATTAT

>In-frame_ZFYVE16_ENST00000510158_chr5_79735851_+_BDP1_ENST00000380675_chr5_70848943_+_6533nt
CCGGTGGGGCGGGGAAAGAAGCCCTGAGCCGGGATCTGGCACTCCCAGGACTCCCGGCCGGGGTAGCTCTTCACTCCTCAGCGCGACGTC
GTGTCGAGTTCCCAAAAAGCTCCGCAGGGGCTGTAGGGAGGTGATCTCATCCATTAACAGCTGTGTGTTGCCAGTTCCCAAATCTTTATC
TATCTCAGACTTCTCTCCTGCATTCCAGATTCTTATATTCAGCTGCCTTTTGGATATCTCTCCCAGGATGTTCTCAAGGCATACAAGAAT
TAAATTCTGAATAAGTCTGCAGGTAGGATGGACAGTTATTTTAAAGCAGCTGTCAGTGACTTGGACAAACTCCTTGATGATTTTGAACAG
AACCCAGATGAACAAGATTATCTCCAAGATGTACAAAATGCATATGATTCTAACCACTGCTCAGTTTCTTCAGAGTTGGCTTCCTCACAG
CGAACTTCATTGCTCCCAAAAGACCAAGAGTGCGTTAATAGTTGTGCCTCATCAGAAACAAGCTATGGAACAAATGAGAGTTCCCTGAAT
GAAAAAACACTCAAGGGACTTACTTCTATACAAAATGAAAAAAATGTAACAGGACTTGATCTTCTTTCTTCTGTGGATGGTGGTACTTCA
GATGAAATCCAGCCGTTATATATGGGACGATGTAGTAAACCTATCTGTGATCTGATAAGTGACATGGGTAACTTAGTTCATGCAACCAAT
AGTGAAGAAGATATTAAAAAATTATTGCCAGATGATTTTAAGTCTAATGCAGATTCCTTGATTGGATTGGATTTATCTTCAGTGTCAGAT
ACTCCCTGTGTTTCTTCAACAGACCATGATAGTGATACTGTCAGAGAACAACAGAATGATATCAGTTCTGAATTACAAAATAGAGAAATC
GGAGGAATCAAAGAATTGGGTATAAAAGTAGATACAACACTTTCAGATTCCTATAATTACAGTGGAACAGAAAATTTAAAAGATAAAAAG
ATCTTTAATCAGTTAGAATCAATTGTTGATTTTAACATGTCATCTGCTTTGACTCGACAAAGTTCCAAAATGTTTCATGCCAAAGACAAG
CTACAACACAAGAGCCAGCCATGTGGATTACTAAAAGATGTTGGCTTAGTAAAAGAGGAAGTAGATGTGGCAGTCATAACTGCCGCAGAA
TGTTTAAAAGAAGAGGGCAAGACAAGTGCTTTGACCTGCAGCCTTCCGAAAAATGAAGATTTATGCTTAAATGATTCAAATTCAAGAGAT
GAAAATTTCAAATTACCTGACTTTTCCTTTCAGGAAGATAAGACTGTTATAAAACAATCTGCACAAGAAGACTCAAAAAGTTTAGACCTT
AAGGATAATGATGTAATCCAAGATTCCTCTTCAGCTTTACATGTTTCCAGTAAAGATGTGCCGTCCTCATTGTCCTGTCTTCCTGCGTCT
GGGTCTATGTGTGGATCATTAATTGAAAGTAAAGCACGGGGTGATTTTTTACCTCAGCATGAACATAAAGATAATATACAAGATGCAGTG
ACTATACATGAAGAAATACAGAACAGTGTTGTTCTAGGTGGGGAACCATTCAAAGAGAATGATCTTTTGAAACAGGAAAAATGTAAAAGC
ATACTCCTTCAGTCATTAATTGAAGGGATGGAAGACAGAAAGATAGATCCTGACCAGACAGTAATCAGAGCTGAGTCTTTGGATGGTGGT
GACACCAGTTCTACAGTTGTAGAATCTCAAGAGGGGCTTTCTGGCACTCATGTCCCAGAGTCTTCTGATTGTTGTGAAGGTTTTATTAAT
ACTTTTTCAAGCAATGATATGGATGGGCAAGACTTAGATTACTTTAATATTGATGAAGGCGCAAAAAGTGGCCCACTAATTAGTGATGCT
GAACTTGATGCCTTTCTGACAGAACAGTATCTTCAGACCACTAACATAAAGTCTTTTGAAGAAAATGTAAATGACTCTAAATCGCAAATG
AATCAGATAGATATGAAAGGCTTAGATGATGGAAACATCAATAATATATATTTCAATGCAGAAGCAGGAGCTATTGGGGAAAGTCATGGT
ATTAATATAATTTGTGAAATAGTTGATAAACAAAATACAATAGAAAATGGCCTTTCTTTAGGAGAAAAAAGCACTATTCCAGTTCAACAA
GGGTTACCTACCAGTAAGTCTGAGATTACAAATCAATTATCGGTCTCTGATATTAACAGTCAATCTGTTGGAGGGGCCAGACCTAAGCAA
TTGTTTAGCCTTCCATCAAGAACAAGGAGTTCAAAGGACCTGAATAAGCCAGATGTTCCAGATACAATAGAAAGTGAACCCAGCACAGCA
GATACCGTTGTTCCAATCACTTGTGCTATAGATTCTACAGCTGATCCACAGGTTAGCTTCAACTCTAATTACATTGATATAGAAAGTAAT
TCTGAAGGTGGATCTAGTTTCGTAACTGCAAATGAAGATTCTGTACCTGAAAACACTTGCAAAGAAGGCTTGGTTTTGGGCCAGAAACAG
CCTACTTGGGTTCCTGATTCAGAAGCTCCAAACTGTATGAACTGCCAAGTCAAATTTACTTTTACCAAACGGCGACACCATTGCCGAGCA
TGTGGGAAAGTATTTTGTGGTGTCTGTTGTAATAGGAAGTGTAAACTGCAATATCTAGAAAAGGAAGCAAGAGTATGTGTAGTCTGCTAT
GAAACTATTAGTAAAGTATTTGTTTACCAGCAACTTCAGTTGGTCAAGATGCCATGGGTTTATCTATTTCTGGAAGAGATAATTCTAAAA
AGCCGCCTGATAATTTGGATCTTGTATCTAGGAAGAGATTTCAATGCAGGCTTGATAAAAATGACCACATTCCTCCTGCCAAAAAACGTT
CACTCACTTTAAGAGATGACTGTCAAGAATATACCACTGAGGTGCACTCAAAGGAATTAACAAATGTTTTTGAGGAAACAGGGGAGTCTC
ACAAGGGACAAGATATTTTTCTTACCTCAGGAAGCACACTGACAACTCCAGAACCTCAAAGACAGCAAGTTGAAGCAGCTTTTCAGAGTA
GAGGATCTAGATCTCCTGATGCATGCATGGACAAGAATGTGCCTCAGTTACCTCAGGATGAAATGATTGTGTCTGATAAGGAAGAAAGAA
CTGATGCTGCTCCTAAGTCTCAGCAAATGGATAGCAGAACATCGTCTTCTAAAGCCTCACTATCCAGACCTGGCAGAAGACCCCTGGGAT
TTTTATCTTTAATATGCTCAAAGAATAGTTTGGAGTCTGATGAACCTATGCAAGTCCATAGTAAGAAACGCCTAAAACCTCTTATACCTG
GATTAAGAAAGAAATTGAAAAGATCTAATCCATTCAATGAAAGCCAGGAAAAAAATCGAGAGTCCTCTGATCTGCTTCCATCTCCAAGTG
TTATTACTACTCAATCTGAGAATATTAGCAGCTCAGCAACTCAGGTTTCTTGTGATCAGCCCTTACTGAAAGAAGGATATAAAAGTGCCC
AAAAGCGGGCCCCTCAAGGGGAGGCAACCACAGTCTCTGAATATTTCTTCAATGATATCTTCATTGAAGTGGATGAAACAGAATAAAACA
ATCTTTTCTCTTTTTCTTTTTTAAATTAGGTCTAGGATTTCCAGAGTCAATTACATCAACAAAACAGTATTTAGAGCAAAATATCACTGT
CTTATTTTTCTTTAGGTTGATTTTGAATACTTAATGAGCTTGATTTGAAGCTTTTATAATCAGTGGAAAACATTTCTGAGGTTCCTTTCA
TTCTGACTGATTCAGCATTTTGCAAATAGCAAGCAATTAAGACTGCTTTCTCAGACAGAAATAACAACTCTTGTTTACATTTTGACTCTT
CCTGTGCTAAGCACACATGGACATTTGGGAATGTTGTGGATATATGTCTCTGTATGAATTGCAGTGCAGACAGATTTGGGGGTTAATTGT
ATCATATTTAACATTTAGCAACTTCTTTTGTGAAGATTTTTTATTTTTAGGGGGAGATGATGAAGGATGAAGGCTTTTTCATTTGCTTCT
AAGTACAGTCATGTATCACATAATGAAGTTTAAGTCAATGATGGACCACATATATTACAGTGGTCCCATGCAATTAAAATGGAGATAAAT
TCCTATCAACTAGTGACATTATAGCCATCATAACACAGTGCATTGCTTTTTTATGTTTAGATATGTTTAGATACACAAATACTTACTATT
GTGTTACAACTGCCTACAGTATTCAGCATAGTAACACATTGTAGAGGTTTGTAGCCGAGGAGCAATAGGCTATACCACATAGCCTCAGTC
TGTACGGTGTGTAGCAGCCTGTACCATCTCAGTGTTTGTAAGTACACTCTGCGTTGTTTCACACAAGATCACCTAACAAGGCAATTCTTA
GAACATGTAGTTAAGGGACACGTGACTATATGTGAAAACAAATTGTCAAACTTCACTTTAGTATGGCAAATGTTAAAGAACTTTTCTATT
ATCAGCTGTTTGTCTGACTGAAAAATACATATTTTTCTAATTCATGGTGATGTAACATTAGTCCTAATTGAAAAACTAGTATTTAAACAT
AATTATTTATAAAGATGACACATCAAAGGGCTTATTTATTTTTAAATTTTTTATTTAAAAGGATATTCAGTTTTAGCTATTTTTACCCCT
CAGATTGTAGATAAAGAAGGCATTAAATTTATGTTTGTCTCCTTTTTCTGTTTAATTTTAAAGATATTTAAAATGATATAACTAAAAATG
TTTAGCTGGTGTATATGTTTTGAATACCTTTTTCCCCTCAGTTTAGTATATTGACTTTGTACTGTAAATTTTTCTGCTTTTCTTGGATAA
TCTCAGGATTTTCATGAGGATAGGGGGAACTCAACTTTATTTATGAGACAAAATTTCCATACAAAGCTCAATCTCCTTTATACACCCACA
GACATAATATTAGTTTTTAAAAAGCCAATTTCTTCATAGTTTTTTCCCATTAAATTCTCAAGGAACACTTGGATCTTTAAGCACGGAACA
TAATCATGATGTTAAAAACAGAGAAAATAAGGCTTTATAAAGTTAATGATTATCATCAGTATGAATTTAAGGTTTGTTTTAATTTCAAGA
TTTGATTTTTTATACGTGTAATTCTATTATCTACCCAAGCAGATCTGTAGTGGTTCCAATTAGACTTCTCAAACAGCAAATTTATCCTGA
TTTTATTTGAAAAGCCTCTTGGATTGATAGTATAGTAGCTCAGGCATTGGAAACTTTCTGCAAACTGTTTTGGGTTTGCAGGCCAGATGG
TCTCTGTGGCAGCTACTCAGCTCTGCAATTTCAGTGTGAAAGAAGCCATAGACAGTACTTGAATGAAGGACTGTGGCTGGATTGGCCTTT
TAGTTTGACCCCCTACATTAGGCCCCAAATTTTCTTACCCTGAGGTGCTGATATCTGTATGGATGAGTTATTTGTCACTAAAGTTATGAG
TTGTGCCTAAAAGTTAAAACTGTTGACTGTATTATGTAATGATCAGTATTTCAGTTGGGAAGATATTTTAGAGTCTAGATAATTATGTTT
GTATATTGAAAAAATGGTGGCCAGTTTTTAAGTTCCTTAATAGAAGAGAATTATGTCTCAGCACATATAACAGTAATGCTAATTTATTGA
AACTACTGCTGTTAGAGCACTTCTTATTCATTGTCTTTTAGTGAAATTTATGGCGTAACACTTTGTCAGAGAGGAGGCTATATAATTCGG
AGCGGAAATTGTCTATAAGTAGGCATTTATTTCATGATTGATATGTCACAGAAATCATGGTAGTAAATCACATTGCTATTTGAATACCCT
GTTTTTGTAAGTTTTTAAAACTCATATTCTGAAAAGATTTCATTCTCTTAGTGTTAGCTTGGGAGTTAGATTGCCATGATTAAACTATTA
TTTATCCTTGTGTAATATTAGTTTTTAACTTTAACATCTGTTTCTTTTTAATCTATAATGAGCTAGTTTTATGGAAAATGGAATTTCTTA
CTATATAAAGAATACAGAGACTCATTGTATTAGAGAATCAAGTCAGCCAGCTAAAGTATCCTACTGTTAAATCCTTAAACCTAATTTTGG
AAAAGAGAAAGTTAATCAATGTATTTACCTTACATGTTGGAAAGAACTATGTTAGGTCTGATTCATGTGAAGAAGATGTTGCAAAGGATT
TATTTCACAAATTTTAAAGGAGATATGAGTAAAAGTTTTTATCTTTTCTTGACTTTTTCTCCTGAACACTTATGTCTTAGCAAGTGGTCA
ACATGAGGATTTGAACGCCTAATTGTTGGTAAATGGTTGAGGCATGACAAAAATATTAATATCCACTGTTTACCATCATGTTATTTGAAA
CAAAAGTGACCATGTATACTATCTTGCTTGAAGAAGTCTTTGACAGAAAAAGCAATATCATGTCATTTATAAATTTTCTTGTTCTAAAGA

>In-frame_ZFYVE16_ENST00000505560_chr5_79735851_+_BDP1_ENST00000380675_chr5_70848943_+_6457nt
GGTGGGGCGGGGAAAGAAGCCCTGAGCCGGGATCTGGCACTCCCAGGACTCCCGGCCGGGGTAGCTCTTCACTCCTCAGCGCGACGTCGT
GTCGAGTTCCCAAAAAGCTCCGCAGGGGCTGTAGGGAGATTCCTGTGAGGTTTCTCGGGCTTATTTGGTGGAGTTTCTGTTCCAGACCAG
AGGCATACAAGAATTAAATTCTGAATAAGTCTGCAGGTAGGATGGACAGTTATTTTAAAGCAGCTGTCAGTGACTTGGACAAACTCCTTG
ATGATTTTGAACAGAACCCAGATGAACAAGATTATCTCCAAGATGTACAAAATGCATATGATTCTAACCACTGCTCAGTTTCTTCAGAGT
TGGCTTCCTCACAGCGAACTTCATTGCTCCCAAAAGACCAAGAGTGCGTTAATAGTTGTGCCTCATCAGAAACAAGCTATGGAACAAATG
AGAGTTCCCTGAATGAAAAAACACTCAAGGGACTTACTTCTATACAAAATGAAAAAAATGTAACAGGACTTGATCTTCTTTCTTCTGTGG
ATGGTGGTACTTCAGATGAAATCCAGCCGTTATATATGGGACGATGTAGTAAACCTATCTGTGATCTGATAAGTGACATGGGTAACTTAG
TTCATGCAACCAATAGTGAAGAAGATATTAAAAAATTATTGCCAGATGATTTTAAGTCTAATGCAGATTCCTTGATTGGATTGGATTTAT
CTTCAGTGTCAGATACTCCCTGTGTTTCTTCAACAGACCATGATAGTGATACTGTCAGAGAACAACAGAATGATATCAGTTCTGAATTAC
AAAATAGAGAAATCGGAGGAATCAAAGAATTGGGTATAAAAGTAGATACAACACTTTCAGATTCCTATAATTACAGTGGAACAGAAAATT
TAAAAGATAAAAAGATCTTTAATCAGTTAGAATCAATTGTTGATTTTAACATGTCATCTGCTTTGACTCGACAAAGTTCCAAAATGTTTC
ATGCCAAAGACAAGCTACAACACAAGAGCCAGCCATGTGGATTACTAAAAGATGTTGGCTTAGTAAAAGAGGAAGTAGATGTGGCAGTCA
TAACTGCCGCAGAATGTTTAAAAGAAGAGGGCAAGACAAGTGCTTTGACCTGCAGCCTTCCGAAAAATGAAGATTTATGCTTAAATGATT
CAAATTCAAGAGATGAAAATTTCAAATTACCTGACTTTTCCTTTCAGGAAGATAAGACTGTTATAAAACAATCTGCACAAGAAGACTCAA
AAAGTTTAGACCTTAAGGATAATGATGTAATCCAAGATTCCTCTTCAGCTTTACATGTTTCCAGTAAAGATGTGCCGTCCTCATTGTCCT
GTCTTCCTGCGTCTGGGTCTATGTGTGGATCATTAATTGAAAGTAAAGCACGGGGTGATTTTTTACCTCAGCATGAACATAAAGATAATA
TACAAGATGCAGTGACTATACATGAAGAAATACAGAACAGTGTTGTTCTAGGTGGGGAACCATTCAAAGAGAATGATCTTTTGAAACAGG
AAAAATGTAAAAGCATACTCCTTCAGTCATTAATTGAAGGGATGGAAGACAGAAAGATAGATCCTGACCAGACAGTAATCAGAGCTGAGT
CTTTGGATGGTGGTGACACCAGTTCTACAGTTGTAGAATCTCAAGAGGGGCTTTCTGGCACTCATGTCCCAGAGTCTTCTGATTGTTGTG
AAGGTTTTATTAATACTTTTTCAAGCAATGATATGGATGGGCAAGACTTAGATTACTTTAATATTGATGAAGGCGCAAAAAGTGGCCCAC
TAATTAGTGATGCTGAACTTGATGCCTTTCTGACAGAACAGTATCTTCAGACCACTAACATAAAGTCTTTTGAAGAAAATGTAAATGACT
CTAAATCGCAAATGAATCAGATAGATATGAAAGGCTTAGATGATGGAAACATCAATAATATATATTTCAATGCAGAAGCAGGAGCTATTG
GGGAAAGTCATGGTATTAATATAATTTGTGAAATAGTTGATAAACAAAATACAATAGAAAATGGCCTTTCTTTAGGAGAAAAAAGCACTA
TTCCAGTTCAACAAGGGTTACCTACCAGTAAGTCTGAGATTACAAATCAATTATCGGTCTCTGATATTAACAGTCAATCTGTTGGAGGGG
CCAGACCTAAGCAATTGTTTAGCCTTCCATCAAGAACAAGGAGTTCAAAGGACCTGAATAAGCCAGATGTTCCAGATACAATAGAAAGTG
AACCCAGCACAGCAGATACCGTTGTTCCAATCACTTGTGCTATAGATTCTACAGCTGATCCACAGGTTAGCTTCAACTCTAATTACATTG
ATATAGAAAGTAATTCTGAAGGTGGATCTAGTTTCGTAACTGCAAATGAAGATTCTGTACCTGAAAACACTTGCAAAGAAGGCTTGGTTT
TGGGCCAGAAACAGCCTACTTGGGTTCCTGATTCAGAAGCTCCAAACTGTATGAACTGCCAAGTCAAATTTACTTTTACCAAACGGCGAC
ACCATTGCCGAGCATGTGGGAAAGTATTTTGTGGTGTCTGTTGTAATAGGAAGTGTAAACTGCAATATCTAGAAAAGGAAGCAAGAGTAT
GTGTAGTCTGCTATGAAACTATTAGTAAAGTATTTGTTTACCAGCAACTTCAGTTGGTCAAGATGCCATGGGTTTATCTATTTCTGGAAG
AGATAATTCTAAAAAGCCGCCTGATAATTTGGATCTTGTATCTAGGAAGAGATTTCAATGCAGGCTTGATAAAAATGACCACATTCCTCC
TGCCAAAAAACGTTCACTCACTTTAAGAGATGACTGTCAAGAATATACCACTGAGGTGCACTCAAAGGAATTAACAAATGTTTTTGAGGA
AACAGGGGAGTCTCACAAGGGACAAGATATTTTTCTTACCTCAGGAAGCACACTGACAACTCCAGAACCTCAAAGACAGCAAGTTGAAGC
AGCTTTTCAGAGTAGAGGATCTAGATCTCCTGATGCATGCATGGACAAGAATGTGCCTCAGTTACCTCAGGATGAAATGATTGTGTCTGA
TAAGGAAGAAAGAACTGATGCTGCTCCTAAGTCTCAGCAAATGGATAGCAGAACATCGTCTTCTAAAGCCTCACTATCCAGACCTGGCAG
AAGACCCCTGGGATTTTTATCTTTAATATGCTCAAAGAATAGTTTGGAGTCTGATGAACCTATGCAAGTCCATAGTAAGAAACGCCTAAA
ACCTCTTATACCTGGATTAAGAAAGAAATTGAAAAGATCTAATCCATTCAATGAAAGCCAGGAAAAAAATCGAGAGTCCTCTGATCTGCT
TCCATCTCCAAGTGTTATTACTACTCAATCTGAGAATATTAGCAGCTCAGCAACTCAGGTTTCTTGTGATCAGCCCTTACTGAAAGAAGG
ATATAAAAGTGCCCAAAAGCGGGCCCCTCAAGGGGAGGCAACCACAGTCTCTGAATATTTCTTCAATGATATCTTCATTGAAGTGGATGA
AACAGAATAAAACAATCTTTTCTCTTTTTCTTTTTTAAATTAGGTCTAGGATTTCCAGAGTCAATTACATCAACAAAACAGTATTTAGAG
CAAAATATCACTGTCTTATTTTTCTTTAGGTTGATTTTGAATACTTAATGAGCTTGATTTGAAGCTTTTATAATCAGTGGAAAACATTTC
TGAGGTTCCTTTCATTCTGACTGATTCAGCATTTTGCAAATAGCAAGCAATTAAGACTGCTTTCTCAGACAGAAATAACAACTCTTGTTT
ACATTTTGACTCTTCCTGTGCTAAGCACACATGGACATTTGGGAATGTTGTGGATATATGTCTCTGTATGAATTGCAGTGCAGACAGATT
TGGGGGTTAATTGTATCATATTTAACATTTAGCAACTTCTTTTGTGAAGATTTTTTATTTTTAGGGGGAGATGATGAAGGATGAAGGCTT
TTTCATTTGCTTCTAAGTACAGTCATGTATCACATAATGAAGTTTAAGTCAATGATGGACCACATATATTACAGTGGTCCCATGCAATTA
AAATGGAGATAAATTCCTATCAACTAGTGACATTATAGCCATCATAACACAGTGCATTGCTTTTTTATGTTTAGATATGTTTAGATACAC
AAATACTTACTATTGTGTTACAACTGCCTACAGTATTCAGCATAGTAACACATTGTAGAGGTTTGTAGCCGAGGAGCAATAGGCTATACC
ACATAGCCTCAGTCTGTACGGTGTGTAGCAGCCTGTACCATCTCAGTGTTTGTAAGTACACTCTGCGTTGTTTCACACAAGATCACCTAA
CAAGGCAATTCTTAGAACATGTAGTTAAGGGACACGTGACTATATGTGAAAACAAATTGTCAAACTTCACTTTAGTATGGCAAATGTTAA
AGAACTTTTCTATTATCAGCTGTTTGTCTGACTGAAAAATACATATTTTTCTAATTCATGGTGATGTAACATTAGTCCTAATTGAAAAAC
TAGTATTTAAACATAATTATTTATAAAGATGACACATCAAAGGGCTTATTTATTTTTAAATTTTTTATTTAAAAGGATATTCAGTTTTAG
CTATTTTTACCCCTCAGATTGTAGATAAAGAAGGCATTAAATTTATGTTTGTCTCCTTTTTCTGTTTAATTTTAAAGATATTTAAAATGA
TATAACTAAAAATGTTTAGCTGGTGTATATGTTTTGAATACCTTTTTCCCCTCAGTTTAGTATATTGACTTTGTACTGTAAATTTTTCTG
CTTTTCTTGGATAATCTCAGGATTTTCATGAGGATAGGGGGAACTCAACTTTATTTATGAGACAAAATTTCCATACAAAGCTCAATCTCC
TTTATACACCCACAGACATAATATTAGTTTTTAAAAAGCCAATTTCTTCATAGTTTTTTCCCATTAAATTCTCAAGGAACACTTGGATCT
TTAAGCACGGAACATAATCATGATGTTAAAAACAGAGAAAATAAGGCTTTATAAAGTTAATGATTATCATCAGTATGAATTTAAGGTTTG
TTTTAATTTCAAGATTTGATTTTTTATACGTGTAATTCTATTATCTACCCAAGCAGATCTGTAGTGGTTCCAATTAGACTTCTCAAACAG
CAAATTTATCCTGATTTTATTTGAAAAGCCTCTTGGATTGATAGTATAGTAGCTCAGGCATTGGAAACTTTCTGCAAACTGTTTTGGGTT
TGCAGGCCAGATGGTCTCTGTGGCAGCTACTCAGCTCTGCAATTTCAGTGTGAAAGAAGCCATAGACAGTACTTGAATGAAGGACTGTGG
CTGGATTGGCCTTTTAGTTTGACCCCCTACATTAGGCCCCAAATTTTCTTACCCTGAGGTGCTGATATCTGTATGGATGAGTTATTTGTC
ACTAAAGTTATGAGTTGTGCCTAAAAGTTAAAACTGTTGACTGTATTATGTAATGATCAGTATTTCAGTTGGGAAGATATTTTAGAGTCT
AGATAATTATGTTTGTATATTGAAAAAATGGTGGCCAGTTTTTAAGTTCCTTAATAGAAGAGAATTATGTCTCAGCACATATAACAGTAA
TGCTAATTTATTGAAACTACTGCTGTTAGAGCACTTCTTATTCATTGTCTTTTAGTGAAATTTATGGCGTAACACTTTGTCAGAGAGGAG
GCTATATAATTCGGAGCGGAAATTGTCTATAAGTAGGCATTTATTTCATGATTGATATGTCACAGAAATCATGGTAGTAAATCACATTGC
TATTTGAATACCCTGTTTTTGTAAGTTTTTAAAACTCATATTCTGAAAAGATTTCATTCTCTTAGTGTTAGCTTGGGAGTTAGATTGCCA
TGATTAAACTATTATTTATCCTTGTGTAATATTAGTTTTTAACTTTAACATCTGTTTCTTTTTAATCTATAATGAGCTAGTTTTATGGAA
AATGGAATTTCTTACTATATAAAGAATACAGAGACTCATTGTATTAGAGAATCAAGTCAGCCAGCTAAAGTATCCTACTGTTAAATCCTT
AAACCTAATTTTGGAAAAGAGAAAGTTAATCAATGTATTTACCTTACATGTTGGAAAGAACTATGTTAGGTCTGATTCATGTGAAGAAGA
TGTTGCAAAGGATTTATTTCACAAATTTTAAAGGAGATATGAGTAAAAGTTTTTATCTTTTCTTGACTTTTTCTCCTGAACACTTATGTC
TTAGCAAGTGGTCAACATGAGGATTTGAACGCCTAATTGTTGGTAAATGGTTGAGGCATGACAAAAATATTAATATCCACTGTTTACCAT
CATGTTATTTGAAACAAAAGTGACCATGTATACTATCTTGCTTGAAGAAGTCTTTGACAGAAAAAGCAATATCATGTCATTTATAAATTT


Top

FusionGenePPI for ZFYVE16_BDP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZFYVE16TOM1, APP, PSMC3, PPP1CA, RNF11, PPP1CC, MED4, CDH1, PTPN23BDP1ZBTB43, BAX, MYH6, POLR2F, YWHAZ, RAPGEF2, POLR3E, RGMA, CDCA5


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZFYVE16_BDP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ZFYVE16_BDP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneZFYVE16C0023893Liver Cirrhosis, Experimental1CTD_human