FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42838

FusionGeneSummary for ZFPM1_KLF6

check button Fusion gene summary
Fusion gene informationFusion gene name: ZFPM1_KLF6
Fusion gene ID: 42838
HgeneTgene
Gene symbol

ZFPM1

KLF6

Gene ID

161882

1316

Gene namezinc finger protein, FOG family member 1Kruppel like factor 6
SynonymsFOG|FOG1|ZC2HC11A|ZNF408|ZNF89ABCD1|CBA1|COPEB|CPBP|GBF|PAC1|ST12|ZF9
Cytomap

16q24.2

10p15.2

Type of geneprotein-codingprotein-coding
Descriptionzinc finger protein ZFPM1FOG-1friend of GATA 1friend of GATA protein 1zinc finger protein 89Azinc finger protein, multitype 1Krueppel-like factor 6B-cell-derived protein 1GC-rich binding factorGC-rich sites-binding factor GBFKruppel-like zinc finger protein Zf9core promoter element-binding proteinproto-oncogene BCD1protooncogene B-cell derived 1suppression of tumorigeni
Modification date2018052320180523
UniProtAcc

Q8IX07

Q99612

Ensembl transtripts involved in fusion geneENST00000319555, ENST00000569086, 
ENST00000497571, ENST00000542957, 
ENST00000173785, ENST00000469435, 
Fusion gene scores* DoF score1 X 1 X 1=15 X 5 X 1=25
# samples 15
** MAII scorelog2(1/1*10)=3.32192809488736log2(5/25*10)=1
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ZFPM1 [Title/Abstract] AND KLF6 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneZFPM1

GO:0010724

regulation of definitive erythrocyte differentiation

15920471

HgeneZFPM1

GO:0045078

positive regulation of interferon-gamma biosynthetic process

21646796

HgeneZFPM1

GO:0045403

negative regulation of interleukin-4 biosynthetic process

21646796

TgeneKLF6

GO:0045944

positive regulation of transcription by RNA polymerase II

18755691


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1CT004488ZFPM1chr16

88580928

+KLF6chr10

3824407

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000319555ENST00000497571ZFPM1chr16

88580928

+KLF6chr10

3824407

-
In-frameENST00000319555ENST00000542957ZFPM1chr16

88580928

+KLF6chr10

3824407

-
5CDS-intronENST00000319555ENST00000173785ZFPM1chr16

88580928

+KLF6chr10

3824407

-
5CDS-intronENST00000319555ENST00000469435ZFPM1chr16

88580928

+KLF6chr10

3824407

-
3UTR-3CDSENST00000569086ENST00000497571ZFPM1chr16

88580928

+KLF6chr10

3824407

-
3UTR-3CDSENST00000569086ENST00000542957ZFPM1chr16

88580928

+KLF6chr10

3824407

-
3UTR-intronENST00000569086ENST00000173785ZFPM1chr16

88580928

+KLF6chr10

3824407

-
3UTR-intronENST00000569086ENST00000469435ZFPM1chr16

88580928

+KLF6chr10

3824407

-

Top

FusionProtFeatures for ZFPM1_KLF6


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZFPM1

Q8IX07

KLF6

Q99612

Transcription regulator that plays an essential role inerythroid and megakaryocytic cell differentiation. Essentialcofactor that acts via the formation of a heterodimer withtranscription factors of the GATA family GATA1, GATA2 and GATA3.Such heterodimer can both activate or repress transcriptionalactivity, depending on the cell and promoter context. Theheterodimer formed with GATA proteins is essential to activateexpression of genes such as NFE2, ITGA2B, alpha- and beta-globin,while it represses expression of KLF1. May be involved inregulation of some genes in gonads. May also be involved incardiac development, in a non-redundant way with ZFPM2/FOG2 (Bysimilarity). {ECO:0000250}. Transcriptional activator (By similarity). Binds a GCbox motif. Could play a role in B-cell growth and development.{ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneKLF6chr16:88580928chr10:3824407ENST00000469435-02200_22434282Zinc fingerC2H2-type 1
TgeneKLF6chr16:88580928chr10:3824407ENST00000469435-02230_25434282Zinc fingerC2H2-type 2
TgeneKLF6chr16:88580928chr10:3824407ENST00000469435-02260_28234282Zinc fingerC2H2-type 3
TgeneKLF6chr16:88580928chr10:3824407ENST00000497571-04200_22434284Zinc fingerC2H2-type 1
TgeneKLF6chr16:88580928chr10:3824407ENST00000497571-04230_25434284Zinc fingerC2H2-type 2
TgeneKLF6chr16:88580928chr10:3824407ENST00000497571-04260_28234284Zinc fingerC2H2-type 3
TgeneKLF6chr16:88580928chr10:3824407ENST00000542957-03200_22434238Zinc fingerC2H2-type 1
TgeneKLF6chr16:88580928chr10:3824407ENST00000542957-03230_25434238Zinc fingerC2H2-type 2
TgeneKLF6chr16:88580928chr10:3824407ENST00000542957-03260_28234238Zinc fingerC2H2-type 3

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZFPM1chr16:88580928chr10:3824407ENST00000319555+410235_2681341007Zinc fingerCCHC FOG-type 1
HgeneZFPM1chr16:88580928chr10:3824407ENST00000319555+410290_3141341007Zinc fingerC2H2-type 1
HgeneZFPM1chr16:88580928chr10:3824407ENST00000319555+410320_3421341007Zinc fingerC2H2-type 2
HgeneZFPM1chr16:88580928chr10:3824407ENST00000319555+410348_3711341007Zinc fingerC2H2-type 3
HgeneZFPM1chr16:88580928chr10:3824407ENST00000319555+410571_6041341007Zinc fingerCCHC FOG-type 2
HgeneZFPM1chr16:88580928chr10:3824407ENST00000319555+410677_7101341007Zinc fingerCCHC FOG-type 3
HgeneZFPM1chr16:88580928chr10:3824407ENST00000319555+410811_8441341007Zinc fingerCCHC FOG-type 4
HgeneZFPM1chr16:88580928chr10:3824407ENST00000319555+410854_8771341007Zinc fingerC2H2-type 4
HgeneZFPM1chr16:88580928chr10:3824407ENST00000319555+410968_10011341007Zinc fingerCCHC FOG-type 5


Top

FusionGeneSequence for ZFPM1_KLF6


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZFPM1_ENST00000319555_chr16_88580928_+_KLF6_ENST00000497571_chr10_3824407_-_384aa
MSRRKQSNPRQIKRSLGDMEAREEVQLVGASHMEQKATAPEAPSPPSADVNSPPPLPPPTSPGGPKELEGQEPEPRPTEEEPGSPWSGPD
ELEPVVQDGQRRIRARLSLATGLSWGPFHGSVQTRASSPRQAEPTCLELERYLQSEPCTVSASEIKFDSQEDLWTKIILAREKKEESELK
ISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLSSSVTSTPPSSPELSREPSQLWGCVPGELP
SPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPF

>In-frame_ZFPM1_ENST00000319555_chr16_88580928_+_KLF6_ENST00000542957_chr10_3824407_-_338aa
MSRRKQSNPRQIKRSLGDMEAREEVQLVGASHMEQKATAPEAPSPPSADVNSPPPLPPPTSPGGPKELEGQEPEPRPTEEEPGSPWSGPD
ELEPVVQDGQRRIRARLSLATGLSWGPFHGSVQTRASSPRQAEPTCLELERYLQSEPCTVSASEIKFDSQEDLWTKIILAREKKEESELK
ISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLSSSVTSTPPSSPELSREPSQLWGCVPGELP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZFPM1_ENST00000319555_chr16_88580928_+_KLF6_ENST00000497571_chr10_3824407_-_1152nt
ATGTCCAGGCGGAAACAGAGCAACCCCCGGCAGATCAAGCGTTCCCTCGGAGACATGGAGGCCAGAGAGGAGGTGCAGTTGGTGGGTGCC
AGCCACATGGAGCAAAAGGCCACGGCACCTGAAGCCCCGAGCCCTCCCAGCGCAGATGTTAACTCACCCCCACCGCTGCCGCCCCCCACA
TCCCCAGGAGGCCCCAAGGAGCTGGAAGGACAGGAACCAGAACCCAGGCCCACGGAGGAAGAGCCGGGCAGTCCCTGGAGCGGGCCAGAC
GAGCTGGAGCCGGTGGTGCAGGATGGGCAGAGGCGCATACGGGCCCGACTCAGCCTCGCCACGGGCCTGTCCTGGGGCCCGTTCCATGGG
AGTGTCCAGACCAGAGCCTCATCCCCCAGGCAGGCGGAGCCGACCTGCCTAGAGCTGGAACGTTACCTCCAGAGCGAGCCCTGCTATGTT
TCAGCCTCAGAAATCAAATTTGACAGCCAGGAAGATCTGTGGACCAAAATCATTCTGGCTCGGGAGAAAAAGGAGGAATCCGAACTGAAG
ATATCTTCCAGTCCTCCAGAGGACACTCTCATCAGCCCGAGCTTTTGTTACAACTTAGAGACCAACAGCCTGAACTCAGATGTCAGCAGC
GAATCCTCTGACAGCTCCGAGGAACTTTCTCCCACGGCCAAGTTTACCTCCGACCCCATTGGCGAAGTTTTGGTCAGCTCGGGAAAATTG
AGCTCCTCTGTCACCTCCACGCCTCCATCTTCTCCGGAACTGAGCAGGGAACCTTCTCAACTGTGGGGTTGCGTGCCCGGGGAGCTGCCC
TCGCCAGGGAAGGTGCGCAGCGGGACTTCGGGGAAGCCAGGTGACAAGGGAAATGGCGATGCCTCCCCCGACGGCAGGAGGAGGGTGCAC
CGGTGCCACTTTAACGGCTGCAGGAAAGTTTACACCAAAAGCTCCCACTTGAAAGCACACCAGCGGACGCACACAGGAGAAAAGCCTTAC
AGATGCTCATGGGAAGGGTGTGAGTGGCGTTTTGCAAGAAGTGATGAGTTAACCAGGCACTTCCGAAAGCACACCGGGGCCAAGCCTTTT

>In-frame_ZFPM1_ENST00000319555_chr16_88580928_+_KLF6_ENST00000542957_chr10_3824407_-_1014nt
ATGTCCAGGCGGAAACAGAGCAACCCCCGGCAGATCAAGCGTTCCCTCGGAGACATGGAGGCCAGAGAGGAGGTGCAGTTGGTGGGTGCC
AGCCACATGGAGCAAAAGGCCACGGCACCTGAAGCCCCGAGCCCTCCCAGCGCAGATGTTAACTCACCCCCACCGCTGCCGCCCCCCACA
TCCCCAGGAGGCCCCAAGGAGCTGGAAGGACAGGAACCAGAACCCAGGCCCACGGAGGAAGAGCCGGGCAGTCCCTGGAGCGGGCCAGAC
GAGCTGGAGCCGGTGGTGCAGGATGGGCAGAGGCGCATACGGGCCCGACTCAGCCTCGCCACGGGCCTGTCCTGGGGCCCGTTCCATGGG
AGTGTCCAGACCAGAGCCTCATCCCCCAGGCAGGCGGAGCCGACCTGCCTAGAGCTGGAACGTTACCTCCAGAGCGAGCCCTGCTATGTT
TCAGCCTCAGAAATCAAATTTGACAGCCAGGAAGATCTGTGGACCAAAATCATTCTGGCTCGGGAGAAAAAGGAGGAATCCGAACTGAAG
ATATCTTCCAGTCCTCCAGAGGACACTCTCATCAGCCCGAGCTTTTGTTACAACTTAGAGACCAACAGCCTGAACTCAGATGTCAGCAGC
GAATCCTCTGACAGCTCCGAGGAACTTTCTCCCACGGCCAAGTTTACCTCCGACCCCATTGGCGAAGTTTTGGTCAGCTCGGGAAAATTG
AGCTCCTCTGTCACCTCCACGCCTCCATCTTCTCCGGAACTGAGCAGGGAACCTTCTCAACTGTGGGGTTGCGTGCCCGGGGAGCTGCCC
TCGCCAGGGAAGGTGCGCAGCGGGACTTCGGGGAAGCCAGGTGACAAGGGAAATGGCGATGCCTCCCCCGACGGCAGGAGGAGGGTGCAC
CGGTGCCACTTTAACGGCTGCAGGAAAGTTTACACCAAAAGCTCCCACTTGAAAGCACACCAGCGGACGCACACAGGTGTTTTTCCAGGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZFPM1_ENST00000319555_chr16_88580928_+_KLF6_ENST00000497571_chr10_3824407_-_5017nt
CGCCGCTCGCCGCCCGCGGGTTCCATTGAGAAAAGCCGAGCGGCCGCGGCGGCGGCGGCGAGTGCGCGGGAGCGGAGGAGCCGGCACCCG
CCCGTCGGGCAGTCCGCGCGCCCGCAACGCAGGACCGTGGCCTCTCGGGCCTCCGCGGCAGCTCCAGCGGCTCCGGGGCTGGGCGCGCGG
GCTGGGGGCGCGGGCCGGGGCGGCCGCGGAGACCGGGGGCCGGGGGCATGAGCGGCCCCGCGGCCCCGCCGCGCCCCCGCCGCCCGCCGC
CGCCCGCCCGGGGCTAGAGGCGGCCGCCGGGAGGGCGCGCGGCGCCGGAGACATGTCCAGGCGGAAACAGAGCAACCCCCGGCAGATCAA
GCGTTCCCTCGGAGACATGGAGGCCAGAGAGGAGGTGCAGTTGGTGGGTGCCAGCCACATGGAGCAAAAGGCCACGGCACCTGAAGCCCC
GAGCCCTCCCAGCGCAGATGTTAACTCACCCCCACCGCTGCCGCCCCCCACATCCCCAGGAGGCCCCAAGGAGCTGGAAGGACAGGAACC
AGAACCCAGGCCCACGGAGGAAGAGCCGGGCAGTCCCTGGAGCGGGCCAGACGAGCTGGAGCCGGTGGTGCAGGATGGGCAGAGGCGCAT
ACGGGCCCGACTCAGCCTCGCCACGGGCCTGTCCTGGGGCCCGTTCCATGGGAGTGTCCAGACCAGAGCCTCATCCCCCAGGCAGGCGGA
GCCGACCTGCCTAGAGCTGGAACGTTACCTCCAGAGCGAGCCCTGCTATGTTTCAGCCTCAGAAATCAAATTTGACAGCCAGGAAGATCT
GTGGACCAAAATCATTCTGGCTCGGGAGAAAAAGGAGGAATCCGAACTGAAGATATCTTCCAGTCCTCCAGAGGACACTCTCATCAGCCC
GAGCTTTTGTTACAACTTAGAGACCAACAGCCTGAACTCAGATGTCAGCAGCGAATCCTCTGACAGCTCCGAGGAACTTTCTCCCACGGC
CAAGTTTACCTCCGACCCCATTGGCGAAGTTTTGGTCAGCTCGGGAAAATTGAGCTCCTCTGTCACCTCCACGCCTCCATCTTCTCCGGA
ACTGAGCAGGGAACCTTCTCAACTGTGGGGTTGCGTGCCCGGGGAGCTGCCCTCGCCAGGGAAGGTGCGCAGCGGGACTTCGGGGAAGCC
AGGTGACAAGGGAAATGGCGATGCCTCCCCCGACGGCAGGAGGAGGGTGCACCGGTGCCACTTTAACGGCTGCAGGAAAGTTTACACCAA
AAGCTCCCACTTGAAAGCACACCAGCGGACGCACACAGGAGAAAAGCCTTACAGATGCTCATGGGAAGGGTGTGAGTGGCGTTTTGCAAG
AAGTGATGAGTTAACCAGGCACTTCCGAAAGCACACCGGGGCCAAGCCTTTTAAATGCTCCCACTGTGACAGGTGTTTTTCCAGGTCTGA
CCACCTGGCCCTGCACATGAAGAGGCACCTCTGAGGGAGCAGAGAGGTGGATCCTGTAGGCTAAAAGGCTTCCAGGCTGAGAGCCGGCCG
TGGAAGGAGGGATGCGTGTTCCAGCCAAAGCATGCCGTTCTGCACCCTACCCAGTTGCCTCCAGGGCCTCTCCTTGGAAGGTCTTTTGAG
GGCTAAAAAGGTCCTGTAAGAAGCGGCATAGCACCCGTGGTGCATGGTATGTGGGTGACCCTGGACTCGCCACTGGTACCCGCCCTTCCG
AGCGGCGCCTAAGCCTTTGCCGTGAGCATGCACACTGAGAATGCTAATGGTTGGGTTGATTGTATGTTGAGGATCTATTACTGACCGTAT
GATGAGGCCAACTTTTTTTCCTTGTGGTTAGCAAGACTGCAAGAGATGGAAAAAAAGTAGTTTGAATGTTTTGTGTGTAAGGAGTATACC
ATGAGATGAGATGACCACCAATCATTTCCTTGGGGGGAGGGGGTGTCTGCACCTTAGAAAAAAAAAGAAAAATCAAAAAAACAAAAAAAC
AAAAACAAAAAAAGAAGGAAAATCTTGGAGGGTGGGCGTGGGAACTCAGGACCCCAGAGTGGCGAGTGGTGTGGGGAGGGAGAGCCTCTC
TCCCCCTTTTCTGTGTGAGAGGAACTCTTAGTGTCTGGTGCAGCTATTAAATGTGCAATGTGTCAAGTAGCTTGTTTTACACGCTACAAC
ATAGCTCATTTGTAACCCATTGTATAAGCTGTGTATTTACAAATATAACACAACAATTTAACTTTTCCTTAGAATACAAAAAGTCATGCA
TGGTCTGGGGAACTATATGCTTTTCCATTTTTAAGTCAGGACTGCAATACTGATTCCAGTTAATGAGCAGCTAAGATCCAATCTGTCTAA
TACAGTGACCCCCTAGCCATCCGGGCCTGGCAATATACAATTTTTTTTCCCCTCCAAGTTTGTAACACTCCCCTTCCAGAAAGGCATTGT
GCAACACAGGATTATTTTTAAATGATTCTGAATTTGAATTAACTTTTTGGAGAATTCTGTGATGCCCTTAGAAGAAATTGGACACGTATT
GAGTGTCACAAAGCTGGGGCTGGGAATTGCTGGTCTAATGTTTCATTAGACTTAAGAACCTAAAATTTTTCTCAGTTGGGTGGATAAAAC
CACTAACGCTTAGAAACTGTTTTCTCATGCAGCTATGTTTCTCTTATTTATGCCTTGAGGACTAATTTCTGGTTTTCTAGCTGTTAATGC
ACTGTTGACCTTCATAATGGTGCCTTACGCAAGCGATCCCTTCTGTGGGGGTCTCATACAGGGGTGTGGGCGATGCATGCTTTATTAAGG
CTCTTGTTTCACCTGGCAGTGTACTGTATCAACGTATAATACAGAAAAAAAATCTCTTTAAGGTCCTCCTTCACAAAGACATAGAGTGAA
ACTCCCTTTACATGTCAGTATTTGTTCAACACTTTAGGCAACTTGACTGTCAGTGTTAAAATGGAAAACAGGAAAATGGAAAAATCTGAC
CAATTCTGCCACCTTGAGACTTTCATATAGACCTTGCACAACAATTGTATAGATCACACACCGGCTGTATTTAATATGTAACATTTTCAC
ACATATTAAAGATACAGAAGTATTAAAAAACCCCCAATGTTAATGTATTTGCTTAAAAGGCACAAGTTTCACATATCTGTCTAGCTATCT
GTTGGTAATACAGAAAGTATACTACTTTTTTAAAAAAGTGGGCAGAATTCTTGTGTATGTATATTTGTGTGTACAGTATGTGTATGTGTG
TATATATATATATTATATATATAGATAATATATAAATATTTTTTTTAAGGAGAAACTAGAATGTTTAGCTAGAAAATTCCACAGCCTGTG
AAGAAATATTTCAAAATGGCCATAAAGGAGGTAAAAATGAAAACCATAACCTAACTTTTATAGAGGCTTTATCTTTAATTTAACGATGTG
CGGAGGACTTTCTTGCTTGAATCTGTTCCGGGCTGTCTGCTCTGTCCATCAAATGGGCAGGTCTGGAATGGGGCACCTTCGGCCGTTCAG
AAGTGGCCTGAACAGAATGCTGGAACCCAGGCTGGACTCGGACACACTAAGGTTTTGATTTTGAATTTCAGCCTTATTAGAAGATCTAAC
CTAAGAGTAAGCTAACCACAGGGATTCTTTTGTAGAACACTTTTTATGCAGATGAAGCTATTTTTTCCAGCAAGTAGATTCTTCCAGTTT
TTCCAAGGAGTAATTTCCCCGAATTGGCATACCACGGCGTGGACAGCTGATATTTCACCCAGCTGCTGGCTTGTGGGTGTGGCTCTTTGC
TTTATATATATATACACACATGTGAGTCTGGCTGGGCTGGTATTTTGTTTGATCTTCCTGGAAATGAGCAGTGACTAACGCTCACATAAC
TGGTTTTTTTTTTATCTGGGCTGATGAATACATTTACCTAAGAAACTCATTTCGTTTTACTTAAGAGGGGAAGTGCAGTTTTCTTTTGGC
AGTTCAGAATCCAAGCACTTGATTTGCTGGGTTTGGAAAACTCCTTTTTTGGCCTTCTATGTGCTTAGCCATAACAATTCCATTAAGCAA
GAAGGTAAGCAAAAGACAAAAAAAAAAAAAGGAAAAAAAAAAACTTGCACTGGCTTGTCTCACTTACGAAACATGTCGGAGCTGTTTGCC
TGGGTGGGGCTGGGTACCGTACCTGTCAATGCCTGTGATTTTCATAATTAGCACGTACATAAAGAAGTACATTCTGTTCAGGTGATAACT
GAGCCTCAATCAAGCAGAAACTTTTTGCTTGAAATTAAAAAAAAATTTCTATTAGTGAAATTTCTTTTTTTTTTTTTTTTGGAAGCACCC
TGTTATCTAAAGAATCTTTGTAAGATTTTTGTAAAATTTTGTTTTACAAGATTTTATTTGAAATTGTTTTTTGCAAGATTGTTATATTTC
TGTATGAATGTATTTTTTATTGGAATAACATAAAAGAATTCTTATCAGCATCTTGAGTCTGGTTGTTTTTTTTGGGGGAAGGGGGTTGTT
GGAACAGATTCCTCCTGCATTCATCACCCTGGCTTCCTCCTGGGGGCAAATCTTCATTGAGCAACCCTGAGAACAACTCACCGACCTCAG
CCCCTTCCTCTTTCCACAGCCTGTCCTGGGAGCTGGAGAGGATGTCAGCGAGCCTGACATTGCCCTCCCTGAATGCATCAAATACTCTTC
TCCAAGGACTGACAAAAACAACCCCCCGGCTGTGGGCACAGTAGGGAACCATGCCGGTTTGATCTTCCATTGCTCAAGCCAGGGAATGCA
TTGCAGAGGCACCTGCACAACGACAAACTTGAGTGTTTCCCTGCCACTTCTGTGCCTCCACAGCCTGCTCCAGTTCCGCAGCTAGAGCTG
GGCCTACCTTCCCCAGCCAGCCCTGCCACACACCTGGCTGAGGCATGTCTGGGAGGGGTGGAGGAGGCAGAGGGACTCCAGGCCAGAGGG

>In-frame_ZFPM1_ENST00000319555_chr16_88580928_+_KLF6_ENST00000542957_chr10_3824407_-_4892nt
CGCCGCTCGCCGCCCGCGGGTTCCATTGAGAAAAGCCGAGCGGCCGCGGCGGCGGCGGCGAGTGCGCGGGAGCGGAGGAGCCGGCACCCG
CCCGTCGGGCAGTCCGCGCGCCCGCAACGCAGGACCGTGGCCTCTCGGGCCTCCGCGGCAGCTCCAGCGGCTCCGGGGCTGGGCGCGCGG
GCTGGGGGCGCGGGCCGGGGCGGCCGCGGAGACCGGGGGCCGGGGGCATGAGCGGCCCCGCGGCCCCGCCGCGCCCCCGCCGCCCGCCGC
CGCCCGCCCGGGGCTAGAGGCGGCCGCCGGGAGGGCGCGCGGCGCCGGAGACATGTCCAGGCGGAAACAGAGCAACCCCCGGCAGATCAA
GCGTTCCCTCGGAGACATGGAGGCCAGAGAGGAGGTGCAGTTGGTGGGTGCCAGCCACATGGAGCAAAAGGCCACGGCACCTGAAGCCCC
GAGCCCTCCCAGCGCAGATGTTAACTCACCCCCACCGCTGCCGCCCCCCACATCCCCAGGAGGCCCCAAGGAGCTGGAAGGACAGGAACC
AGAACCCAGGCCCACGGAGGAAGAGCCGGGCAGTCCCTGGAGCGGGCCAGACGAGCTGGAGCCGGTGGTGCAGGATGGGCAGAGGCGCAT
ACGGGCCCGACTCAGCCTCGCCACGGGCCTGTCCTGGGGCCCGTTCCATGGGAGTGTCCAGACCAGAGCCTCATCCCCCAGGCAGGCGGA
GCCGACCTGCCTAGAGCTGGAACGTTACCTCCAGAGCGAGCCCTGCTATGTTTCAGCCTCAGAAATCAAATTTGACAGCCAGGAAGATCT
GTGGACCAAAATCATTCTGGCTCGGGAGAAAAAGGAGGAATCCGAACTGAAGATATCTTCCAGTCCTCCAGAGGACACTCTCATCAGCCC
GAGCTTTTGTTACAACTTAGAGACCAACAGCCTGAACTCAGATGTCAGCAGCGAATCCTCTGACAGCTCCGAGGAACTTTCTCCCACGGC
CAAGTTTACCTCCGACCCCATTGGCGAAGTTTTGGTCAGCTCGGGAAAATTGAGCTCCTCTGTCACCTCCACGCCTCCATCTTCTCCGGA
ACTGAGCAGGGAACCTTCTCAACTGTGGGGTTGCGTGCCCGGGGAGCTGCCCTCGCCAGGGAAGGTGCGCAGCGGGACTTCGGGGAAGCC
AGGTGACAAGGGAAATGGCGATGCCTCCCCCGACGGCAGGAGGAGGGTGCACCGGTGCCACTTTAACGGCTGCAGGAAAGTTTACACCAA
AAGCTCCCACTTGAAAGCACACCAGCGGACGCACACAGGTGTTTTTCCAGGTCTGACCACCTGGCCCTGCACATGAAGAGGCACCTCTGA
GGGAGCAGAGAGGTGGATCCTGTAGGCTAAAAGGCTTCCAGGCTGAGAGCCGGCCGTGGAAGGAGGGATGCGTGTTCCAGCCAAAGCATG
CCGTTCTGCACCCTACCCAGTTGCCTCCAGGGCCTCTCCTTGGAAGGTCTTTTGAGGGCTAAAAAGGTCCTGTAAGAAGCGGCATAGCAC
CCGTGGTGCATGGTATGTGGGTGACCCTGGACTCGCCACTGGTACCCGCCCTTCCGAGCGGCGCCTAAGCCTTTGCCGTGAGCATGCACA
CTGAGAATGCTAATGGTTGGGTTGATTGTATGTTGAGGATCTATTACTGACCGTATGATGAGGCCAACTTTTTTTCCTTGTGGTTAGCAA
GACTGCAAGAGATGGAAAAAAAGTAGTTTGAATGTTTTGTGTGTAAGGAGTATACCATGAGATGAGATGACCACCAATCATTTCCTTGGG
GGGAGGGGGTGTCTGCACCTTAGAAAAAAAAAGAAAAATCAAAAAAACAAAAAAACAAAAACAAAAAAAGAAGGAAAATCTTGGAGGGTG
GGCGTGGGAACTCAGGACCCCAGAGTGGCGAGTGGTGTGGGGAGGGAGAGCCTCTCTCCCCCTTTTCTGTGTGAGAGGAACTCTTAGTGT
CTGGTGCAGCTATTAAATGTGCAATGTGTCAAGTAGCTTGTTTTACACGCTACAACATAGCTCATTTGTAACCCATTGTATAAGCTGTGT
ATTTACAAATATAACACAACAATTTAACTTTTCCTTAGAATACAAAAAGTCATGCATGGTCTGGGGAACTATATGCTTTTCCATTTTTAA
GTCAGGACTGCAATACTGATTCCAGTTAATGAGCAGCTAAGATCCAATCTGTCTAATACAGTGACCCCCTAGCCATCCGGGCCTGGCAAT
ATACAATTTTTTTTCCCCTCCAAGTTTGTAACACTCCCCTTCCAGAAAGGCATTGTGCAACACAGGATTATTTTTAAATGATTCTGAATT
TGAATTAACTTTTTGGAGAATTCTGTGATGCCCTTAGAAGAAATTGGACACGTATTGAGTGTCACAAAGCTGGGGCTGGGAATTGCTGGT
CTAATGTTTCATTAGACTTAAGAACCTAAAATTTTTCTCAGTTGGGTGGATAAAACCACTAACGCTTAGAAACTGTTTTCTCATGCAGCT
ATGTTTCTCTTATTTATGCCTTGAGGACTAATTTCTGGTTTTCTAGCTGTTAATGCACTGTTGACCTTCATAATGGTGCCTTACGCAAGC
GATCCCTTCTGTGGGGGTCTCATACAGGGGTGTGGGCGATGCATGCTTTATTAAGGCTCTTGTTTCACCTGGCAGTGTACTGTATCAACG
TATAATACAGAAAAAAAATCTCTTTAAGGTCCTCCTTCACAAAGACATAGAGTGAAACTCCCTTTACATGTCAGTATTTGTTCAACACTT
TAGGCAACTTGACTGTCAGTGTTAAAATGGAAAACAGGAAAATGGAAAAATCTGACCAATTCTGCCACCTTGAGACTTTCATATAGACCT
TGCACAACAATTGTATAGATCACACACCGGCTGTATTTAATATGTAACATTTTCACACATATTAAAGATACAGAAGTATTAAAAAACCCC
CAATGTTAATGTATTTGCTTAAAAGGCACAAGTTTCACATATCTGTCTAGCTATCTGTTGGTAATACAGAAAGTATACTACTTTTTTAAA
AAAGTGGGCAGAATTCTTGTGTATGTATATTTGTGTGTACAGTATGTGTATGTGTGTATATATATATATTATATATATAGATAATATATA
AATATTTTTTTTAAGGAGAAACTAGAATGTTTAGCTAGAAAATTCCACAGCCTGTGAAGAAATATTTCAAAATGGCCATAAAGGAGGTAA
AAATGAAAACCATAACCTAACTTTTATAGAGGCTTTATCTTTAATTTAACGATGTGCGGAGGACTTTCTTGCTTGAATCTGTTCCGGGCT
GTCTGCTCTGTCCATCAAATGGGCAGGTCTGGAATGGGGCACCTTCGGCCGTTCAGAAGTGGCCTGAACAGAATGCTGGAACCCAGGCTG
GACTCGGACACACTAAGGTTTTGATTTTGAATTTCAGCCTTATTAGAAGATCTAACCTAAGAGTAAGCTAACCACAGGGATTCTTTTGTA
GAACACTTTTTATGCAGATGAAGCTATTTTTTCCAGCAAGTAGATTCTTCCAGTTTTTCCAAGGAGTAATTTCCCCGAATTGGCATACCA
CGGCGTGGACAGCTGATATTTCACCCAGCTGCTGGCTTGTGGGTGTGGCTCTTTGCTTTATATATATATACACACATGTGAGTCTGGCTG
GGCTGGTATTTTGTTTGATCTTCCTGGAAATGAGCAGTGACTAACGCTCACATAACTGGTTTTTTTTTTATCTGGGCTGATGAATACATT
TACCTAAGAAACTCATTTCGTTTTACTTAAGAGGGGAAGTGCAGTTTTCTTTTGGCAGTTCAGAATCCAAGCACTTGATTTGCTGGGTTT
GGAAAACTCCTTTTTTGGCCTTCTATGTGCTTAGCCATAACAATTCCATTAAGCAAGAAGGTAAGCAAAAGACAAAAAAAAAAAAAGGAA
AAAAAAAAACTTGCACTGGCTTGTCTCACTTACGAAACATGTCGGAGCTGTTTGCCTGGGTGGGGCTGGGTACCGTACCTGTCAATGCCT
GTGATTTTCATAATTAGCACGTACATAAAGAAGTACATTCTGTTCAGGTGATAACTGAGCCTCAATCAAGCAGAAACTTTTTGCTTGAAA
TTAAAAAAAAATTTCTATTAGTGAAATTTCTTTTTTTTTTTTTTTTGGAAGCACCCTGTTATCTAAAGAATCTTTGTAAGATTTTTGTAA
AATTTTGTTTTACAAGATTTTATTTGAAATTGTTTTTTGCAAGATTGTTATATTTCTGTATGAATGTATTTTTTATTGGAATAACATAAA
AGAATTCTTATCAGCATCTTGAGTCTGGTTGTTTTTTTTGGGGGAAGGGGGTTGTTGGAACAGATTCCTCCTGCATTCATCACCCTGGCT
TCCTCCTGGGGGCAAATCTTCATTGAGCAACCCTGAGAACAACTCACCGACCTCAGCCCCTTCCTCTTTCCACAGCCTGTCCTGGGAGCT
GGAGAGGATGTCAGCGAGCCTGACATTGCCCTCCCTGAATGCATCAAATACTCTTCTCCAAGGACTGACAAAAACAACCCCCCGGCTGTG
GGCACAGTAGGGAACCATGCCGGTTTGATCTTCCATTGCTCAAGCCAGGGAATGCATTGCAGAGGCACCTGCACAACGACAAACTTGAGT
GTTTCCCTGCCACTTCTGTGCCTCCACAGCCTGCTCCAGTTCCGCAGCTAGAGCTGGGCCTACCTTCCCCAGCCAGCCCTGCCACACACC
TGGCTGAGGCATGTCTGGGAGGGGTGGAGGAGGCAGAGGGACTCCAGGCCAGAGGGCTGTTCTCACAACCTCAGCCCACTCTCAGTCAAG


Top

FusionGenePPI for ZFPM1_KLF6


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZFPM1GATA2, GATA1, RBBP4, MTA1, TRIM21, GSK3B, CTBP2, ERP44, DEFA6KLF6EHMT2, APOM, GTF3C1, PNO1, POLA2, KLF4, SP1, NR0B2, E2F1, HDAC3, NUFIP1, TAF9, FBL, NOP56, LCOR, APP, RUNX1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneZFPM1chr16:88580928chr10:3824407ENST00000319555+410794_8001341007CTBP2
HgeneZFPM1chr16:88580928chr10:3824407ENST00000319555+410330_3411341007TACC3


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZFPM1_KLF6


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ZFPM1_KLF6


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneKLF6C0023893Liver Cirrhosis, Experimental1CTD_human