FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42761

FusionGeneSummary for ZFAND3_THEGL

check button Fusion gene summary
Fusion gene informationFusion gene name: ZFAND3_THEGL
Fusion gene ID: 42761
HgeneTgene
Gene symbol

ZFAND3

THEGL

Gene ID

60685

100506564

Gene namezinc finger AN1-type containing 3theg spermatid protein like
SynonymsTEX27-
Cytomap

6p21.2

4q12

Type of geneprotein-codingprotein-coding
DescriptionAN1-type zinc finger protein 3testis expressed sequence 27testis-expressed protein 27zinc finger, AN1-type domain 3testicular haploid expressed gene protein-liketheg spermatid-like protein
Modification date2018051920180519
UniProtAcc

Q9H8U3

P0DJG4

Ensembl transtripts involved in fusion geneENST00000287218, ENST00000373391, 
ENST00000463847, 
ENST00000512175, 
ENST00000510716, 
Fusion gene scores* DoF score16 X 5 X 10=8001 X 1 X 1=1
# samples 161
** MAII scorelog2(16/800*10)=-2.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: ZFAND3 [Title/Abstract] AND THEGL [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A8-A07G-01AZFAND3chr6

37897775

+THEGLchr4

57414956

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000287218ENST00000512175ZFAND3chr6

37897775

+THEGLchr4

57414956

+
5CDS-intronENST00000287218ENST00000510716ZFAND3chr6

37897775

+THEGLchr4

57414956

+
In-frameENST00000373391ENST00000512175ZFAND3chr6

37897775

+THEGLchr4

57414956

+
5CDS-intronENST00000373391ENST00000510716ZFAND3chr6

37897775

+THEGLchr4

57414956

+
intron-3CDSENST00000463847ENST00000512175ZFAND3chr6

37897775

+THEGLchr4

57414956

+
intron-intronENST00000463847ENST00000510716ZFAND3chr6

37897775

+THEGLchr4

57414956

+

Top

FusionProtFeatures for ZFAND3_THEGL


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZFAND3

Q9H8U3

THEGL

P0DJG4


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTHEGLchr6:37897775chr4:57414956ENST00000512175+09174_192164466RepeatNote=THEG 1
TgeneTHEGLchr6:37897775chr4:57414956ENST00000512175+09214_233164466RepeatNote=THEG 2
TgeneTHEGLchr6:37897775chr4:57414956ENST00000512175+09260_279164466RepeatNote=THEG 3
TgeneTHEGLchr6:37897775chr4:57414956ENST00000512175+09297_316164466RepeatNote=THEG 4
TgeneTHEGLchr6:37897775chr4:57414956ENST00000512175+09333_352164466RepeatNote=THEG 5
TgeneTHEGLchr6:37897775chr4:57414956ENST00000512175+09373_392164466RepeatNote=THEG 6
TgeneTHEGLchr6:37897775chr4:57414956ENST00000512175+09409_428164466RepeatNote=THEG 7
TgeneTHEGLchr6:37897775chr4:57414956ENST00000512175+09446_465164466RepeatNote=THEG 8

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZFAND3chr6:37897775chr4:57414956ENST00000287218+2612_4437228Zinc fingerA20-type
HgeneZFAND3chr6:37897775chr4:57414956ENST00000287218+26154_20037228Zinc fingerAN1-type


Top

FusionGeneSequence for ZFAND3_THEGL


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZFAND3_ENST00000287218_chr6_37897775_+_THEGL_ENST00000512175_chr4_57414956_+_339aa
MGDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFAANPVSCDFVRKCFSSRKRTPNLSKPKKQWGTPDRKLFWGNQDPIRPVSQGALK
AQLTKRLENLAQPKEVSCHYVPNRAQYYHSCGRESVIWEITPPALFRQPSKRIQRLSQPNGFKRQCLLNRPFSDNSARDSLRISDPSPRI
LQLSVAKGTDPNYHPSKKMQTKISLSTLSAIATPRIIELAHPRIKLEGLCYERQRSELPIRPVPPAAMIAKPSPRTIALAKSKSVHQDYL

>In-frame_ZFAND3_ENST00000373391_chr6_37897775_+_THEGL_ENST00000512175_chr4_57414956_+_339aa
MGDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFAANPVSCDFVRKCFSSRKRTPNLSKPKKQWGTPDRKLFWGNQDPIRPVSQGALK
AQLTKRLENLAQPKEVSCHYVPNRAQYYHSCGRESVIWEITPPALFRQPSKRIQRLSQPNGFKRQCLLNRPFSDNSARDSLRISDPSPRI
LQLSVAKGTDPNYHPSKKMQTKISLSTLSAIATPRIIELAHPRIKLEGLCYERQRSELPIRPVPPAAMIAKPSPRTIALAKSKSVHQDYL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZFAND3_ENST00000287218_chr6_37897775_+_THEGL_ENST00000512175_chr4_57414956_+_1017nt
ATGGGAGACGCTGGGAGCGAGCGCAGCAAAGCGCCCAGCCTGCCGCCTCGCTGTCCCTGCGGCTTCTGGGGGTCCAGCAAGACTATGAAT
CTCTGTTCCAAATGCTTTGCTGCAAATCCTGTTTCCTGTGACTTTGTAAGGAAATGTTTTTCTTCTAGGAAGAGAACCCCAAATCTTTCA
AAGCCTAAAAAGCAATGGGGAACTCCAGACAGAAAACTGTTTTGGGGAAATCAAGATCCTATTCGCCCTGTTTCCCAGGGTGCTTTGAAG
GCTCAGCTGACCAAAAGACTTGAGAACCTTGCCCAGCCCAAGGAAGTTTCCTGCCACTATGTACCTAACAGGGCTCAATACTACCACAGC
TGTGGAAGAGAGTCTGTAATTTGGGAGATCACTCCTCCTGCATTGTTTAGACAACCCTCCAAAAGGATCCAGAGGCTGTCACAGCCCAAT
GGATTCAAAAGACAGTGTCTACTAAATAGACCCTTCAGTGATAACTCAGCAAGAGATTCTCTTCGAATCTCTGATCCTTCTCCCCGGATA
TTACAACTCTCAGTAGCCAAAGGCACAGACCCAAACTATCATCCTTCAAAAAAAATGCAAACCAAGATTTCACTTTCTACCCTGAGTGCG
ATTGCAACTCCAAGAATTATAGAGCTTGCCCACCCAAGGATCAAGTTAGAGGGTCTGTGCTATGAAAGACAAAGAAGTGAACTGCCCATC
CGTCCTGTACCTCCTGCTGCCATGATAGCTAAACCTAGCCCCCGAACAATAGCTCTAGCGAAGTCCAAGTCTGTTCATCAAGATTATCTA
CCTGACCGTGATGCCCATTGGCCAGTATCTTATGCTACTACTCATTCCAAAGCATCACCTAGGATTCAGGAACTAGCTAATCCAAATAAG
AGGGCTCCTGTGCGTATTGTGTATTATGATCCAGATGTCTTTAAAACCAAGCCAGCTGCTTTGAAAGCACAGTGTTCTCAAAGGATCTGG

>In-frame_ZFAND3_ENST00000373391_chr6_37897775_+_THEGL_ENST00000512175_chr4_57414956_+_1017nt
ATGGGAGACGCTGGGAGCGAGCGCAGCAAAGCGCCCAGCCTGCCGCCTCGCTGTCCCTGCGGCTTCTGGGGGTCCAGCAAGACTATGAAT
CTCTGTTCCAAATGCTTTGCTGCAAATCCTGTTTCCTGTGACTTTGTAAGGAAATGTTTTTCTTCTAGGAAGAGAACCCCAAATCTTTCA
AAGCCTAAAAAGCAATGGGGAACTCCAGACAGAAAACTGTTTTGGGGAAATCAAGATCCTATTCGCCCTGTTTCCCAGGGTGCTTTGAAG
GCTCAGCTGACCAAAAGACTTGAGAACCTTGCCCAGCCCAAGGAAGTTTCCTGCCACTATGTACCTAACAGGGCTCAATACTACCACAGC
TGTGGAAGAGAGTCTGTAATTTGGGAGATCACTCCTCCTGCATTGTTTAGACAACCCTCCAAAAGGATCCAGAGGCTGTCACAGCCCAAT
GGATTCAAAAGACAGTGTCTACTAAATAGACCCTTCAGTGATAACTCAGCAAGAGATTCTCTTCGAATCTCTGATCCTTCTCCCCGGATA
TTACAACTCTCAGTAGCCAAAGGCACAGACCCAAACTATCATCCTTCAAAAAAAATGCAAACCAAGATTTCACTTTCTACCCTGAGTGCG
ATTGCAACTCCAAGAATTATAGAGCTTGCCCACCCAAGGATCAAGTTAGAGGGTCTGTGCTATGAAAGACAAAGAAGTGAACTGCCCATC
CGTCCTGTACCTCCTGCTGCCATGATAGCTAAACCTAGCCCCCGAACAATAGCTCTAGCGAAGTCCAAGTCTGTTCATCAAGATTATCTA
CCTGACCGTGATGCCCATTGGCCAGTATCTTATGCTACTACTCATTCCAAAGCATCACCTAGGATTCAGGAACTAGCTAATCCAAATAAG
AGGGCTCCTGTGCGTATTGTGTATTATGATCCAGATGTCTTTAAAACCAAGCCAGCTGCTTTGAAAGCACAGTGTTCTCAAAGGATCTGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZFAND3_ENST00000287218_chr6_37897775_+_THEGL_ENST00000512175_chr4_57414956_+_1648nt
GTTACGGAGACAGCAGGGCCCGGGGCTTCAGAGCGGCCGCTGCGACTCCGGAGCCGGCGGGGGGCTCCGGTCCTTCCCTGCGCCACCGCA
CAGGACATCTCTCTGGCTGGGGAGCGGCGGTGAGACCCGCCGAGGGCGTCTGTGTCCCTCCTCCCCCGCGGTCCTCGGTGCGTCCGCACG
CCCCTCCTCCTCGGCTCCCTCCTTCTTCTCTCCGCGCCTCTCCGCCCCCTCCCCGTCTCCGCAGGCCGAGTGGTGCGGCCCGCCTCCAGC
TGACCGGCCTGGAATCCCGGCTCCGAGCCCCGGACTCGCGCCCGCCCGCGCGCCCGCTCCTTCCCCCTCCCCCCGCCCCGAGCCCCCCGA
CGCCGCCGCCACCGCCTCCTCAGAGCGGGGCCCGGGCCCAGCCGCCGCCACCGCTGCCGCCGCCGAGCTCCGCCGCCGCCGAGCACCATG
GGAGACGCTGGGAGCGAGCGCAGCAAAGCGCCCAGCCTGCCGCCTCGCTGTCCCTGCGGCTTCTGGGGGTCCAGCAAGACTATGAATCTC
TGTTCCAAATGCTTTGCTGCAAATCCTGTTTCCTGTGACTTTGTAAGGAAATGTTTTTCTTCTAGGAAGAGAACCCCAAATCTTTCAAAG
CCTAAAAAGCAATGGGGAACTCCAGACAGAAAACTGTTTTGGGGAAATCAAGATCCTATTCGCCCTGTTTCCCAGGGTGCTTTGAAGGCT
CAGCTGACCAAAAGACTTGAGAACCTTGCCCAGCCCAAGGAAGTTTCCTGCCACTATGTACCTAACAGGGCTCAATACTACCACAGCTGT
GGAAGAGAGTCTGTAATTTGGGAGATCACTCCTCCTGCATTGTTTAGACAACCCTCCAAAAGGATCCAGAGGCTGTCACAGCCCAATGGA
TTCAAAAGACAGTGTCTACTAAATAGACCCTTCAGTGATAACTCAGCAAGAGATTCTCTTCGAATCTCTGATCCTTCTCCCCGGATATTA
CAACTCTCAGTAGCCAAAGGCACAGACCCAAACTATCATCCTTCAAAAAAAATGCAAACCAAGATTTCACTTTCTACCCTGAGTGCGATT
GCAACTCCAAGAATTATAGAGCTTGCCCACCCAAGGATCAAGTTAGAGGGTCTGTGCTATGAAAGACAAAGAAGTGAACTGCCCATCCGT
CCTGTACCTCCTGCTGCCATGATAGCTAAACCTAGCCCCCGAACAATAGCTCTAGCGAAGTCCAAGTCTGTTCATCAAGATTATCTACCT
GACCGTGATGCCCATTGGCCAGTATCTTATGCTACTACTCATTCCAAAGCATCACCTAGGATTCAGGAACTAGCTAATCCAAATAAGAGG
GCTCCTGTGCGTATTGTGTATTATGATCCAGATGTCTTTAAAACCAAGCCAGCTGCTTTGAAAGCACAGTGTTCTCAAAGGATCTGGGAG
TTGTCACAACCTCTTACACGTTAAATACAGAAAGCCACAACAGTCAGACCCTGGTTATGTATCTAGAACACATATTAGATGACTTAGTTC
CCTGTTGCGGTACTGTCAGTTTACATTCACCCCTTGCTTCCCCTCCCACAAAATGAGACCTTTAGGGAAAACCACCATGATCATTAAATA

>In-frame_ZFAND3_ENST00000373391_chr6_37897775_+_THEGL_ENST00000512175_chr4_57414956_+_1349nt
CCGGACTCGCGCCCGCCCGCGCGCCCGCTCCTTCCCCCTCCCCCCGCCCCGAGCCCCCCGACGCCGCCGCCACCGCCTCCTCAGAGCGGG
GCCCGGGCCCAGCCGCCGCCACCGCTGCCGCCGCCGAGCTCCGCCGCCGCCGAGCACCATGGGAGACGCTGGGAGCGAGCGCAGCAAAGC
GCCCAGCCTGCCGCCTCGCTGTCCCTGCGGCTTCTGGGGGTCCAGCAAGACTATGAATCTCTGTTCCAAATGCTTTGCTGCAAATCCTGT
TTCCTGTGACTTTGTAAGGAAATGTTTTTCTTCTAGGAAGAGAACCCCAAATCTTTCAAAGCCTAAAAAGCAATGGGGAACTCCAGACAG
AAAACTGTTTTGGGGAAATCAAGATCCTATTCGCCCTGTTTCCCAGGGTGCTTTGAAGGCTCAGCTGACCAAAAGACTTGAGAACCTTGC
CCAGCCCAAGGAAGTTTCCTGCCACTATGTACCTAACAGGGCTCAATACTACCACAGCTGTGGAAGAGAGTCTGTAATTTGGGAGATCAC
TCCTCCTGCATTGTTTAGACAACCCTCCAAAAGGATCCAGAGGCTGTCACAGCCCAATGGATTCAAAAGACAGTGTCTACTAAATAGACC
CTTCAGTGATAACTCAGCAAGAGATTCTCTTCGAATCTCTGATCCTTCTCCCCGGATATTACAACTCTCAGTAGCCAAAGGCACAGACCC
AAACTATCATCCTTCAAAAAAAATGCAAACCAAGATTTCACTTTCTACCCTGAGTGCGATTGCAACTCCAAGAATTATAGAGCTTGCCCA
CCCAAGGATCAAGTTAGAGGGTCTGTGCTATGAAAGACAAAGAAGTGAACTGCCCATCCGTCCTGTACCTCCTGCTGCCATGATAGCTAA
ACCTAGCCCCCGAACAATAGCTCTAGCGAAGTCCAAGTCTGTTCATCAAGATTATCTACCTGACCGTGATGCCCATTGGCCAGTATCTTA
TGCTACTACTCATTCCAAAGCATCACCTAGGATTCAGGAACTAGCTAATCCAAATAAGAGGGCTCCTGTGCGTATTGTGTATTATGATCC
AGATGTCTTTAAAACCAAGCCAGCTGCTTTGAAAGCACAGTGTTCTCAAAGGATCTGGGAGTTGTCACAACCTCTTACACGTTAAATACA
GAAAGCCACAACAGTCAGACCCTGGTTATGTATCTAGAACACATATTAGATGACTTAGTTCCCTGTTGCGGTACTGTCAGTTTACATTCA


Top

FusionGenePPI for ZFAND3_THEGL


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZFAND3UBC, TUBG1, MAP3K1, TRIM25THEGLBRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZFAND3_THEGL


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ZFAND3_THEGL


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneZFAND3C0011860Diabetes Mellitus, Non-Insulin-Dependent1CTD_human
HgeneZFAND3C3495559Juvenile arthritis1CTD_human