FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42732

FusionGeneSummary for ZEB2_AKT3

check button Fusion gene summary
Fusion gene informationFusion gene name: ZEB2_AKT3
Fusion gene ID: 42732
HgeneTgene
Gene symbol

ZEB2

AKT3

Gene ID

9839

10000

Gene namezinc finger E-box binding homeobox 2AKT serine/threonine kinase 3
SynonymsHSPC082|SIP-1|SIP1|SMADIP1|ZFHX1BMPPH|MPPH2|PKB-GAMMA|PKBG|PRKBG|RAC-PK-gamma|RAC-gamma|STK-2
Cytomap

2q22.3

1q43-q44

Type of geneprotein-codingprotein-coding
Descriptionzinc finger E-box-binding homeobox 2SMAD interacting protein 1Smad-interacting protein 1zinc finger homeobox 1bRAC-gamma serine/threonine-protein kinasePKB gammaRAC-gamma serine/threonine protein kinasev-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)
Modification date2018051920180523
UniProtAcc

O60315

Q9Y243

Ensembl transtripts involved in fusion geneENST00000558170, ENST00000409487, 
ENST00000303660, ENST00000539609, 
ENST00000493689, ENST00000470879, 
ENST00000465070, ENST00000462355, 
ENST00000336199, ENST00000366540, 
ENST00000366539, ENST00000263826, 
ENST00000492957, 
Fusion gene scores* DoF score5 X 5 X 2=508 X 7 X 4=224
# samples 59
** MAII scorelog2(5/50*10)=0log2(9/224*10)=-1.31550182572793
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ZEB2 [Title/Abstract] AND AKT3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneZEB2

GO:0000122

negative regulation of transcription by RNA polymerase II

12837246|20516212

TgeneAKT3

GO:0043536

positive regulation of blood vessel endothelial cell migration

28254819

TgeneAKT3

GO:1905564

positive regulation of vascular endothelial cell proliferation

28254819


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-ER-A197-06AZEB2chr2

145182363

-AKT3chr1

243708899

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000558170ENST00000336199ZEB2chr2

145182363

-AKT3chr1

243708899

-
In-frameENST00000558170ENST00000366540ZEB2chr2

145182363

-AKT3chr1

243708899

-
In-frameENST00000558170ENST00000366539ZEB2chr2

145182363

-AKT3chr1

243708899

-
In-frameENST00000558170ENST00000263826ZEB2chr2

145182363

-AKT3chr1

243708899

-
5CDS-intronENST00000558170ENST00000492957ZEB2chr2

145182363

-AKT3chr1

243708899

-
Frame-shiftENST00000409487ENST00000336199ZEB2chr2

145182363

-AKT3chr1

243708899

-
Frame-shiftENST00000409487ENST00000366540ZEB2chr2

145182363

-AKT3chr1

243708899

-
Frame-shiftENST00000409487ENST00000366539ZEB2chr2

145182363

-AKT3chr1

243708899

-
Frame-shiftENST00000409487ENST00000263826ZEB2chr2

145182363

-AKT3chr1

243708899

-
5CDS-intronENST00000409487ENST00000492957ZEB2chr2

145182363

-AKT3chr1

243708899

-
In-frameENST00000303660ENST00000336199ZEB2chr2

145182363

-AKT3chr1

243708899

-
In-frameENST00000303660ENST00000366540ZEB2chr2

145182363

-AKT3chr1

243708899

-
In-frameENST00000303660ENST00000366539ZEB2chr2

145182363

-AKT3chr1

243708899

-
In-frameENST00000303660ENST00000263826ZEB2chr2

145182363

-AKT3chr1

243708899

-
5CDS-intronENST00000303660ENST00000492957ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000539609ENST00000336199ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000539609ENST00000366540ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000539609ENST00000366539ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000539609ENST00000263826ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-intronENST00000539609ENST00000492957ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000493689ENST00000336199ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000493689ENST00000366540ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000493689ENST00000366539ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000493689ENST00000263826ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-intronENST00000493689ENST00000492957ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000470879ENST00000336199ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000470879ENST00000366540ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000470879ENST00000366539ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000470879ENST00000263826ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-intronENST00000470879ENST00000492957ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000465070ENST00000336199ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000465070ENST00000366540ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000465070ENST00000366539ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000465070ENST00000263826ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-intronENST00000465070ENST00000492957ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000462355ENST00000336199ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000462355ENST00000366540ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000462355ENST00000366539ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-3CDSENST00000462355ENST00000263826ZEB2chr2

145182363

-AKT3chr1

243708899

-
intron-intronENST00000462355ENST00000492957ZEB2chr2

145182363

-AKT3chr1

243708899

-

Top

FusionProtFeatures for ZEB2_AKT3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZEB2

O60315

AKT3

Q9Y243

Transcriptional inhibitor that binds to DNA sequence 5'-CACCT-3' in different promoters. Represses transcription of E-cadherin. {ECO:0000269|PubMed:16061479}. AKT3 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, andwhich regulate many processes including metabolism, proliferation,cell survival, growth and angiogenesis. This is mediated throughserine and/or threonine phosphorylation of a range of downstreamsubstrates. Over 100 substrate candidates have been reported sofar, but for most of them, no isoform specificity has beenreported. AKT3 is the least studied AKT isoform. It plays animportant role in brain development and is crucial for theviability of malignant glioma cells. AKT3 isoform may also be thekey molecule in up-regulation and down-regulation of MMP13 viaIL13. Required for the coordination of mitochondrial biogenesiswith growth factor-induced increases in cellular energy demands.Down-regulation by RNA interference reduces the expression of thephosphorylated form of BAD, resulting in the induction of caspase-dependent apoptosis. {ECO:0000269|PubMed:18524868,ECO:0000269|PubMed:21191416}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneAKT3chr2:145182363chr1:243708899ENST00000263826-913406_479387480DomainNote=AGC-kinase C-terminal
TgeneAKT3chr2:145182363chr1:243708899ENST00000336199-914406_479387476DomainNote=AGC-kinase C-terminal
TgeneAKT3chr2:145182363chr1:243708899ENST00000366539-1014406_479387480DomainNote=AGC-kinase C-terminal
TgeneAKT3chr2:145182363chr1:243708899ENST00000366540-1014406_479387466DomainNote=AGC-kinase C-terminal

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZEB2chr2:145182363chr1:243708899ENST00000303660-4101084_12141341215Compositional biasNote=Glu-rich (acidic)
HgeneZEB2chr2:145182363chr1:243708899ENST00000409487-4101084_12141341215Compositional biasNote=Glu-rich (acidic)
HgeneZEB2chr2:145182363chr1:243708899ENST00000539609-191084_1214-841191Compositional biasNote=Glu-rich (acidic)
HgeneZEB2chr2:145182363chr1:243708899ENST00000558170-4101084_12141341215Compositional biasNote=Glu-rich (acidic)
HgeneZEB2chr2:145182363chr1:243708899ENST00000303660-410644_7031341215DNA bindingNote=Homeobox%3B atypical
HgeneZEB2chr2:145182363chr1:243708899ENST00000409487-410644_7031341215DNA bindingNote=Homeobox%3B atypical
HgeneZEB2chr2:145182363chr1:243708899ENST00000539609-19644_703-841191DNA bindingNote=Homeobox%3B atypical
HgeneZEB2chr2:145182363chr1:243708899ENST00000558170-410644_7031341215DNA bindingNote=Homeobox%3B atypical
HgeneZEB2chr2:145182363chr1:243708899ENST00000303660-410437_4871341215RegionSMAD-MH2 binding domain
HgeneZEB2chr2:145182363chr1:243708899ENST00000409487-410437_4871341215RegionSMAD-MH2 binding domain
HgeneZEB2chr2:145182363chr1:243708899ENST00000539609-19437_487-841191RegionSMAD-MH2 binding domain
HgeneZEB2chr2:145182363chr1:243708899ENST00000558170-410437_4871341215RegionSMAD-MH2 binding domain
HgeneZEB2chr2:145182363chr1:243708899ENST00000303660-4101027_10491341215Zinc fingerC2H2-type 7
HgeneZEB2chr2:145182363chr1:243708899ENST00000303660-4101055_10761341215Zinc fingerC2H2-type 8%3B atypical
HgeneZEB2chr2:145182363chr1:243708899ENST00000303660-410211_2341341215Zinc fingerC2H2-type 1
HgeneZEB2chr2:145182363chr1:243708899ENST00000303660-410241_2631341215Zinc fingerC2H2-type 2
HgeneZEB2chr2:145182363chr1:243708899ENST00000303660-410282_3041341215Zinc fingerC2H2-type 3
HgeneZEB2chr2:145182363chr1:243708899ENST00000303660-410310_3341341215Zinc fingerC2H2-type 4%3B atypical
HgeneZEB2chr2:145182363chr1:243708899ENST00000303660-410581_6051341215Zinc fingerC2H2-type 5%3B atypical
HgeneZEB2chr2:145182363chr1:243708899ENST00000303660-410999_10211341215Zinc fingerC2H2-type 6
HgeneZEB2chr2:145182363chr1:243708899ENST00000409487-4101027_10491341215Zinc fingerC2H2-type 7
HgeneZEB2chr2:145182363chr1:243708899ENST00000409487-4101055_10761341215Zinc fingerC2H2-type 8%3B atypical
HgeneZEB2chr2:145182363chr1:243708899ENST00000409487-410211_2341341215Zinc fingerC2H2-type 1
HgeneZEB2chr2:145182363chr1:243708899ENST00000409487-410241_2631341215Zinc fingerC2H2-type 2
HgeneZEB2chr2:145182363chr1:243708899ENST00000409487-410282_3041341215Zinc fingerC2H2-type 3
HgeneZEB2chr2:145182363chr1:243708899ENST00000409487-410310_3341341215Zinc fingerC2H2-type 4%3B atypical
HgeneZEB2chr2:145182363chr1:243708899ENST00000409487-410581_6051341215Zinc fingerC2H2-type 5%3B atypical
HgeneZEB2chr2:145182363chr1:243708899ENST00000409487-410999_10211341215Zinc fingerC2H2-type 6
HgeneZEB2chr2:145182363chr1:243708899ENST00000539609-191027_1049-841191Zinc fingerC2H2-type 7
HgeneZEB2chr2:145182363chr1:243708899ENST00000539609-191055_1076-841191Zinc fingerC2H2-type 8%3B atypical
HgeneZEB2chr2:145182363chr1:243708899ENST00000539609-19211_234-841191Zinc fingerC2H2-type 1
HgeneZEB2chr2:145182363chr1:243708899ENST00000539609-19241_263-841191Zinc fingerC2H2-type 2
HgeneZEB2chr2:145182363chr1:243708899ENST00000539609-19282_304-841191Zinc fingerC2H2-type 3
HgeneZEB2chr2:145182363chr1:243708899ENST00000539609-19310_334-841191Zinc fingerC2H2-type 4%3B atypical
HgeneZEB2chr2:145182363chr1:243708899ENST00000539609-19581_605-841191Zinc fingerC2H2-type 5%3B atypical
HgeneZEB2chr2:145182363chr1:243708899ENST00000539609-19999_1021-841191Zinc fingerC2H2-type 6
HgeneZEB2chr2:145182363chr1:243708899ENST00000558170-4101027_10491341215Zinc fingerC2H2-type 7
HgeneZEB2chr2:145182363chr1:243708899ENST00000558170-4101055_10761341215Zinc fingerC2H2-type 8%3B atypical
HgeneZEB2chr2:145182363chr1:243708899ENST00000558170-410211_2341341215Zinc fingerC2H2-type 1
HgeneZEB2chr2:145182363chr1:243708899ENST00000558170-410241_2631341215Zinc fingerC2H2-type 2
HgeneZEB2chr2:145182363chr1:243708899ENST00000558170-410282_3041341215Zinc fingerC2H2-type 3
HgeneZEB2chr2:145182363chr1:243708899ENST00000558170-410310_3341341215Zinc fingerC2H2-type 4%3B atypical
HgeneZEB2chr2:145182363chr1:243708899ENST00000558170-410581_6051341215Zinc fingerC2H2-type 5%3B atypical
HgeneZEB2chr2:145182363chr1:243708899ENST00000558170-410999_10211341215Zinc fingerC2H2-type 6
TgeneAKT3chr2:145182363chr1:243708899ENST00000263826-913148_405387480DomainProtein kinase
TgeneAKT3chr2:145182363chr1:243708899ENST00000263826-9135_107387480DomainPH
TgeneAKT3chr2:145182363chr1:243708899ENST00000336199-914148_405387476DomainProtein kinase
TgeneAKT3chr2:145182363chr1:243708899ENST00000336199-9145_107387476DomainPH
TgeneAKT3chr2:145182363chr1:243708899ENST00000366539-1014148_405387480DomainProtein kinase
TgeneAKT3chr2:145182363chr1:243708899ENST00000366539-10145_107387480DomainPH
TgeneAKT3chr2:145182363chr1:243708899ENST00000366540-1014148_405387466DomainProtein kinase
TgeneAKT3chr2:145182363chr1:243708899ENST00000366540-10145_107387466DomainPH
TgeneAKT3chr2:145182363chr1:243708899ENST00000263826-913154_162387480Nucleotide bindingATP
TgeneAKT3chr2:145182363chr1:243708899ENST00000336199-914154_162387476Nucleotide bindingATP
TgeneAKT3chr2:145182363chr1:243708899ENST00000366539-1014154_162387480Nucleotide bindingATP
TgeneAKT3chr2:145182363chr1:243708899ENST00000366540-1014154_162387466Nucleotide bindingATP


Top

FusionGeneSequence for ZEB2_AKT3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZEB2_ENST00000558170_chr2_145182363_-_AKT3_ENST00000336199_chr1_243708899_-_212aa
MKQPIMADGPRCKRRKQANPRRKNVVNYDNVVDTGSETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALLPREEEEDEIRE
GGVEHPWHNNEILQASVDGPEEMKEDYDTMGPEATIQTAINNGTALVEDQMMQKKLXDTVSSLEXTGKMYMIKSLYLLLNLKXHLRQILD

>In-frame_ZEB2_ENST00000558170_chr2_145182363_-_AKT3_ENST00000366540_chr1_243708899_-_212aa
MKQPIMADGPRCKRRKQANPRRKNVVNYDNVVDTGSETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALLPREEEEDEIRE
GGVEHPWHNNEILQASVDGPEEMKEDYDTMGPEATIQTAINNGTALVEDQMMQKKLXDTVSSLEXTGKMYMIKSLYLLLNLKXHLRQILD

>In-frame_ZEB2_ENST00000558170_chr2_145182363_-_AKT3_ENST00000366539_chr1_243708899_-_226aa
MKQPIMADGPRCKRRKQANPRRKNVVNYDNVVDTGSETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALLPREEEEDEIRE
GGVEHPWHNNEILQASVDGPEEMKEDYDTMGPEATIQTAINNGTALVEDQMMQKKLXDTVSSLEXTGKMYMIKSLYLLLNLKXHLRQILD

>In-frame_ZEB2_ENST00000558170_chr2_145182363_-_AKT3_ENST00000263826_chr1_243708899_-_226aa
MKQPIMADGPRCKRRKQANPRRKNVVNYDNVVDTGSETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALLPREEEEDEIRE
GGVEHPWHNNEILQASVDGPEEMKEDYDTMGPEATIQTAINNGTALVEDQMMQKKLXDTVSSLEXTGKMYMIKSLYLLLNLKXHLRQILD

>In-frame_ZEB2_ENST00000303660_chr2_145182363_-_AKT3_ENST00000336199_chr1_243708899_-_212aa
MKQPIMADGPRCKRRKQANPRRKNVVNYDNVVDTGSETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALLPREEEEDEIRE
GGVEHPWHNNEILQASVDGPEEMKEDYDTMGPEATIQTAINNGTALVEDQMMQKKLXDTVSSLEXTGKMYMIKSLYLLLNLKXHLRQILD

>In-frame_ZEB2_ENST00000303660_chr2_145182363_-_AKT3_ENST00000366540_chr1_243708899_-_212aa
MKQPIMADGPRCKRRKQANPRRKNVVNYDNVVDTGSETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALLPREEEEDEIRE
GGVEHPWHNNEILQASVDGPEEMKEDYDTMGPEATIQTAINNGTALVEDQMMQKKLXDTVSSLEXTGKMYMIKSLYLLLNLKXHLRQILD

>In-frame_ZEB2_ENST00000303660_chr2_145182363_-_AKT3_ENST00000366539_chr1_243708899_-_226aa
MKQPIMADGPRCKRRKQANPRRKNVVNYDNVVDTGSETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALLPREEEEDEIRE
GGVEHPWHNNEILQASVDGPEEMKEDYDTMGPEATIQTAINNGTALVEDQMMQKKLXDTVSSLEXTGKMYMIKSLYLLLNLKXHLRQILD

>In-frame_ZEB2_ENST00000303660_chr2_145182363_-_AKT3_ENST00000263826_chr1_243708899_-_226aa
MKQPIMADGPRCKRRKQANPRRKNVVNYDNVVDTGSETDEEDKLHIAEDDGIANPLDQETSPASVPNHESSPHVSQALLPREEEEDEIRE
GGVEHPWHNNEILQASVDGPEEMKEDYDTMGPEATIQTAINNGTALVEDQMMQKKLXDTVSSLEXTGKMYMIKSLYLLLNLKXHLRQILD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZEB2_ENST00000558170_chr2_145182363_-_AKT3_ENST00000336199_chr1_243708899_-_638nt
ATGAAGCAGCCGATCATGGCGGATGGCCCCCGGTGCAAGAGGCGCAAACAAGCCAATCCCAGGAGGAAAAACGTGGTGAACTATGACAAT
GTAGTGGACACAGGTTCTGAAACAGATGAGGAAGACAAGCTTCATATTGCTGAGGATGACGGTATTGCCAACCCTCTGGACCAGGAGACG
AGTCCAGCTAGTGTGCCCAACCATGAGTCCTCCCCACACGTGAGCCAAGCTCTGTTGCCAAGAGAGGAAGAGGAAGATGAAATAAGGGAG
GGTGGAGTGGAACACCCCTGGCACAACAACGAGATTCTACAAGCCTCTGTAGATGGTCCAGAAGAAATGAAGGAAGACTATGACACTATG
GGGCCAGAAGCCACGATCCAGACCGCAATTAACAATGGTACAGCCTTGGTGGAGGACCAGATGATGCAAAAGAAATTATGAGACACAGTT
TCTTCTCTGGAGTAAACTGGCAAGATGTATATGATAAAAAGCTTGTACCTCCTTTTAAACCTCAAGTAACATCTGAGACAGATACTAGAT
ATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCTGAAAAATGTCAGCAATCAGATTGTGGCATGCTGGGTAACTGGA

>In-frame_ZEB2_ENST00000558170_chr2_145182363_-_AKT3_ENST00000366540_chr1_243708899_-_638nt
ATGAAGCAGCCGATCATGGCGGATGGCCCCCGGTGCAAGAGGCGCAAACAAGCCAATCCCAGGAGGAAAAACGTGGTGAACTATGACAAT
GTAGTGGACACAGGTTCTGAAACAGATGAGGAAGACAAGCTTCATATTGCTGAGGATGACGGTATTGCCAACCCTCTGGACCAGGAGACG
AGTCCAGCTAGTGTGCCCAACCATGAGTCCTCCCCACACGTGAGCCAAGCTCTGTTGCCAAGAGAGGAAGAGGAAGATGAAATAAGGGAG
GGTGGAGTGGAACACCCCTGGCACAACAACGAGATTCTACAAGCCTCTGTAGATGGTCCAGAAGAAATGAAGGAAGACTATGACACTATG
GGGCCAGAAGCCACGATCCAGACCGCAATTAACAATGGTACAGCCTTGGTGGAGGACCAGATGATGCAAAAGAAATTATGAGACACAGTT
TCTTCTCTGGAGTAAACTGGCAAGATGTATATGATAAAAAGCTTGTACCTCCTTTTAAACCTCAAGTAACATCTGAGACAGATACTAGAT
ATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCTGAAAAATGTCAGCAATCAGATTGTGGCATGCTGGGTAACTGGA

>In-frame_ZEB2_ENST00000558170_chr2_145182363_-_AKT3_ENST00000366539_chr1_243708899_-_680nt
ATGAAGCAGCCGATCATGGCGGATGGCCCCCGGTGCAAGAGGCGCAAACAAGCCAATCCCAGGAGGAAAAACGTGGTGAACTATGACAAT
GTAGTGGACACAGGTTCTGAAACAGATGAGGAAGACAAGCTTCATATTGCTGAGGATGACGGTATTGCCAACCCTCTGGACCAGGAGACG
AGTCCAGCTAGTGTGCCCAACCATGAGTCCTCCCCACACGTGAGCCAAGCTCTGTTGCCAAGAGAGGAAGAGGAAGATGAAATAAGGGAG
GGTGGAGTGGAACACCCCTGGCACAACAACGAGATTCTACAAGCCTCTGTAGATGGTCCAGAAGAAATGAAGGAAGACTATGACACTATG
GGGCCAGAAGCCACGATCCAGACCGCAATTAACAATGGTACAGCCTTGGTGGAGGACCAGATGATGCAAAAGAAATTATGAGACACAGTT
TCTTCTCTGGAGTAAACTGGCAAGATGTATATGATAAAAAGCTTGTACCTCCTTTTAAACCTCAAGTAACATCTGAGACAGATACTAGAT
ATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCTGAAAAATATGATGAGGATGGTATGGACTGCATGGACAATGAGA

>In-frame_ZEB2_ENST00000558170_chr2_145182363_-_AKT3_ENST00000263826_chr1_243708899_-_680nt
ATGAAGCAGCCGATCATGGCGGATGGCCCCCGGTGCAAGAGGCGCAAACAAGCCAATCCCAGGAGGAAAAACGTGGTGAACTATGACAAT
GTAGTGGACACAGGTTCTGAAACAGATGAGGAAGACAAGCTTCATATTGCTGAGGATGACGGTATTGCCAACCCTCTGGACCAGGAGACG
AGTCCAGCTAGTGTGCCCAACCATGAGTCCTCCCCACACGTGAGCCAAGCTCTGTTGCCAAGAGAGGAAGAGGAAGATGAAATAAGGGAG
GGTGGAGTGGAACACCCCTGGCACAACAACGAGATTCTACAAGCCTCTGTAGATGGTCCAGAAGAAATGAAGGAAGACTATGACACTATG
GGGCCAGAAGCCACGATCCAGACCGCAATTAACAATGGTACAGCCTTGGTGGAGGACCAGATGATGCAAAAGAAATTATGAGACACAGTT
TCTTCTCTGGAGTAAACTGGCAAGATGTATATGATAAAAAGCTTGTACCTCCTTTTAAACCTCAAGTAACATCTGAGACAGATACTAGAT
ATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCTGAAAAATATGATGAGGATGGTATGGACTGCATGGACAATGAGA

>In-frame_ZEB2_ENST00000303660_chr2_145182363_-_AKT3_ENST00000336199_chr1_243708899_-_638nt
ATGAAGCAGCCGATCATGGCGGATGGCCCCCGGTGCAAGAGGCGCAAACAAGCCAATCCCAGGAGGAAAAACGTGGTGAACTATGACAAT
GTAGTGGACACAGGTTCTGAAACAGATGAGGAAGACAAGCTTCATATTGCTGAGGATGACGGTATTGCCAACCCTCTGGACCAGGAGACG
AGTCCAGCTAGTGTGCCCAACCATGAGTCCTCCCCACACGTGAGCCAAGCTCTGTTGCCAAGAGAGGAAGAGGAAGATGAAATAAGGGAG
GGTGGAGTGGAACACCCCTGGCACAACAACGAGATTCTACAAGCCTCTGTAGATGGTCCAGAAGAAATGAAGGAAGACTATGACACTATG
GGGCCAGAAGCCACGATCCAGACCGCAATTAACAATGGTACAGCCTTGGTGGAGGACCAGATGATGCAAAAGAAATTATGAGACACAGTT
TCTTCTCTGGAGTAAACTGGCAAGATGTATATGATAAAAAGCTTGTACCTCCTTTTAAACCTCAAGTAACATCTGAGACAGATACTAGAT
ATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCTGAAAAATGTCAGCAATCAGATTGTGGCATGCTGGGTAACTGGA

>In-frame_ZEB2_ENST00000303660_chr2_145182363_-_AKT3_ENST00000366540_chr1_243708899_-_638nt
ATGAAGCAGCCGATCATGGCGGATGGCCCCCGGTGCAAGAGGCGCAAACAAGCCAATCCCAGGAGGAAAAACGTGGTGAACTATGACAAT
GTAGTGGACACAGGTTCTGAAACAGATGAGGAAGACAAGCTTCATATTGCTGAGGATGACGGTATTGCCAACCCTCTGGACCAGGAGACG
AGTCCAGCTAGTGTGCCCAACCATGAGTCCTCCCCACACGTGAGCCAAGCTCTGTTGCCAAGAGAGGAAGAGGAAGATGAAATAAGGGAG
GGTGGAGTGGAACACCCCTGGCACAACAACGAGATTCTACAAGCCTCTGTAGATGGTCCAGAAGAAATGAAGGAAGACTATGACACTATG
GGGCCAGAAGCCACGATCCAGACCGCAATTAACAATGGTACAGCCTTGGTGGAGGACCAGATGATGCAAAAGAAATTATGAGACACAGTT
TCTTCTCTGGAGTAAACTGGCAAGATGTATATGATAAAAAGCTTGTACCTCCTTTTAAACCTCAAGTAACATCTGAGACAGATACTAGAT
ATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCTGAAAAATGTCAGCAATCAGATTGTGGCATGCTGGGTAACTGGA

>In-frame_ZEB2_ENST00000303660_chr2_145182363_-_AKT3_ENST00000366539_chr1_243708899_-_680nt
ATGAAGCAGCCGATCATGGCGGATGGCCCCCGGTGCAAGAGGCGCAAACAAGCCAATCCCAGGAGGAAAAACGTGGTGAACTATGACAAT
GTAGTGGACACAGGTTCTGAAACAGATGAGGAAGACAAGCTTCATATTGCTGAGGATGACGGTATTGCCAACCCTCTGGACCAGGAGACG
AGTCCAGCTAGTGTGCCCAACCATGAGTCCTCCCCACACGTGAGCCAAGCTCTGTTGCCAAGAGAGGAAGAGGAAGATGAAATAAGGGAG
GGTGGAGTGGAACACCCCTGGCACAACAACGAGATTCTACAAGCCTCTGTAGATGGTCCAGAAGAAATGAAGGAAGACTATGACACTATG
GGGCCAGAAGCCACGATCCAGACCGCAATTAACAATGGTACAGCCTTGGTGGAGGACCAGATGATGCAAAAGAAATTATGAGACACAGTT
TCTTCTCTGGAGTAAACTGGCAAGATGTATATGATAAAAAGCTTGTACCTCCTTTTAAACCTCAAGTAACATCTGAGACAGATACTAGAT
ATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCTGAAAAATATGATGAGGATGGTATGGACTGCATGGACAATGAGA

>In-frame_ZEB2_ENST00000303660_chr2_145182363_-_AKT3_ENST00000263826_chr1_243708899_-_680nt
ATGAAGCAGCCGATCATGGCGGATGGCCCCCGGTGCAAGAGGCGCAAACAAGCCAATCCCAGGAGGAAAAACGTGGTGAACTATGACAAT
GTAGTGGACACAGGTTCTGAAACAGATGAGGAAGACAAGCTTCATATTGCTGAGGATGACGGTATTGCCAACCCTCTGGACCAGGAGACG
AGTCCAGCTAGTGTGCCCAACCATGAGTCCTCCCCACACGTGAGCCAAGCTCTGTTGCCAAGAGAGGAAGAGGAAGATGAAATAAGGGAG
GGTGGAGTGGAACACCCCTGGCACAACAACGAGATTCTACAAGCCTCTGTAGATGGTCCAGAAGAAATGAAGGAAGACTATGACACTATG
GGGCCAGAAGCCACGATCCAGACCGCAATTAACAATGGTACAGCCTTGGTGGAGGACCAGATGATGCAAAAGAAATTATGAGACACAGTT
TCTTCTCTGGAGTAAACTGGCAAGATGTATATGATAAAAAGCTTGTACCTCCTTTTAAACCTCAAGTAACATCTGAGACAGATACTAGAT
ATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCTGAAAAATATGATGAGGATGGTATGGACTGCATGGACAATGAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZEB2_ENST00000558170_chr2_145182363_-_AKT3_ENST00000336199_chr1_243708899_-_2047nt
CATGCCGTTTAATATCATGCTCTCCCTTCCCTGCTAAGTTTCTCTATGGCCTTTCTCGTTTCTCCTCCTGCCTCCCTACACACTCTCCCT
TACTTTGTAGTGAGGTCTCCCCGAGGTGTAGAGAGATTCAGAGATCGGCCAACCGAGTGTTCTATTTTAATTTACTTAGAGACCCTTTAT
TAAAATGCCAAACTACTTTTTAATATTGGGATCCAGTCCAGAAATTCATCATGCACACACCCTAATACACATGCCCTAAGATGCAGCTCC
CATGCAGCATTTTTTTTTCTGGCTCTGGTACCTAAAAAGAAAAAAATAACAATAAGAGAAAGGGCAGAGAACTTTGTTCCAGAAGCTGTA
CTGAGATACCTACACAATTTGATGTGCATCTCAAATCTGGTCATTAGAGATATCTGTATAAGAAGAGACTATCTGGATTGAGGACCCGGG
ATCTTTCCCTTTAACTTTCGCCCCTTGGAGTTCTCCAGTTCTGTGAATGGTGTGCACCGTTTTCCGCCCTGTACTCTGTAGGATTTAGTG
ATGAGGATAATGATGCCAAAGGCTTGACGGGCGGGGAGGGGGGGGTGGAGGGGGGGAGAAGGGAGGGAGGGGGGAGGGAGGCGAAGGCGA
AAGGGAGGGAGAGGAGGAAGGGAGGGAGGTGGAATTTCATTTCTTCCACTAAAGCGTTTGCGGAGACTTCAAGGTATAATCTATCCCAGA
TCCTTTCCCAGAGAGAAACTTGGCGATCACGTTTTCACATGATGCTCACGCTCAGGGCGCTTCAATTATCCCTCCCCACAAAGATAGGTG
GCGCGTGTTTCAGGGTCTCTCGTCTCTCTCCTACAGAAAAGAAAAAGAAAAAAATGTCATTAGAAGAGGCGTAACACGTCAGTCCGTCCC
CAGGTTTGTGTTTCCTGGAGTGGCCGAAAGAGATCAGTTCTAACCTGCTCTGCAGGAATAACGGTCCTGCCTCCCGACACTCTTGGCGAG
GTTTTTGTACAGTTTGCTCCGGGAGCTGTTTCTTCGCTTCCACCTTTTTCTCCCCCACACTTCGCGGCTTCTTCATGCTTTTTCTTCTCA
CCATTTCTGGCCAAAACTACAAACAAGACTTCGCAGATCGAGCCTGCGTGCTGCCGAAGCAGGGCGCCGAGTCCATGCGAACTGCCATCT
GATCCGCTCTTATCAATGAAGCAGCCGATCATGGCGGATGGCCCCCGGTGCAAGAGGCGCAAACAAGCCAATCCCAGGAGGAAAAACGTG
GTGAACTATGACAATGTAGTGGACACAGGTTCTGAAACAGATGAGGAAGACAAGCTTCATATTGCTGAGGATGACGGTATTGCCAACCCT
CTGGACCAGGAGACGAGTCCAGCTAGTGTGCCCAACCATGAGTCCTCCCCACACGTGAGCCAAGCTCTGTTGCCAAGAGAGGAAGAGGAA
GATGAAATAAGGGAGGGTGGAGTGGAACACCCCTGGCACAACAACGAGATTCTACAAGCCTCTGTAGATGGTCCAGAAGAAATGAAGGAA
GACTATGACACTATGGGGCCAGAAGCCACGATCCAGACCGCAATTAACAATGGTACAGCCTTGGTGGAGGACCAGATGATGCAAAAGAAA
TTATGAGACACAGTTTCTTCTCTGGAGTAAACTGGCAAGATGTATATGATAAAAAGCTTGTACCTCCTTTTAAACCTCAAGTAACATCTG
AGACAGATACTAGATATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCTGAAAAATGTCAGCAATCAGATTGTGGCA
TGCTGGGTAACTGGAAAAAATAATAAAAATCGGCTTCCTACAGCCAGCAGCACAGTCACCCATGGAACTGTTGGCTTTGGATTAAATGTG
GAATTGAACGACTACCCAGAAGTGTTCTGGAAAGAAGCGAGATGTGTGGCCTGCCTCACCGTCCTCACCCATCAAAAGCACCAGCAGGCA

>In-frame_ZEB2_ENST00000558170_chr2_145182363_-_AKT3_ENST00000366540_chr1_243708899_-_1847nt
CATGCCGTTTAATATCATGCTCTCCCTTCCCTGCTAAGTTTCTCTATGGCCTTTCTCGTTTCTCCTCCTGCCTCCCTACACACTCTCCCT
TACTTTGTAGTGAGGTCTCCCCGAGGTGTAGAGAGATTCAGAGATCGGCCAACCGAGTGTTCTATTTTAATTTACTTAGAGACCCTTTAT
TAAAATGCCAAACTACTTTTTAATATTGGGATCCAGTCCAGAAATTCATCATGCACACACCCTAATACACATGCCCTAAGATGCAGCTCC
CATGCAGCATTTTTTTTTCTGGCTCTGGTACCTAAAAAGAAAAAAATAACAATAAGAGAAAGGGCAGAGAACTTTGTTCCAGAAGCTGTA
CTGAGATACCTACACAATTTGATGTGCATCTCAAATCTGGTCATTAGAGATATCTGTATAAGAAGAGACTATCTGGATTGAGGACCCGGG
ATCTTTCCCTTTAACTTTCGCCCCTTGGAGTTCTCCAGTTCTGTGAATGGTGTGCACCGTTTTCCGCCCTGTACTCTGTAGGATTTAGTG
ATGAGGATAATGATGCCAAAGGCTTGACGGGCGGGGAGGGGGGGGTGGAGGGGGGGAGAAGGGAGGGAGGGGGGAGGGAGGCGAAGGCGA
AAGGGAGGGAGAGGAGGAAGGGAGGGAGGTGGAATTTCATTTCTTCCACTAAAGCGTTTGCGGAGACTTCAAGGTATAATCTATCCCAGA
TCCTTTCCCAGAGAGAAACTTGGCGATCACGTTTTCACATGATGCTCACGCTCAGGGCGCTTCAATTATCCCTCCCCACAAAGATAGGTG
GCGCGTGTTTCAGGGTCTCTCGTCTCTCTCCTACAGAAAAGAAAAAGAAAAAAATGTCATTAGAAGAGGCGTAACACGTCAGTCCGTCCC
CAGGTTTGTGTTTCCTGGAGTGGCCGAAAGAGATCAGTTCTAACCTGCTCTGCAGGAATAACGGTCCTGCCTCCCGACACTCTTGGCGAG
GTTTTTGTACAGTTTGCTCCGGGAGCTGTTTCTTCGCTTCCACCTTTTTCTCCCCCACACTTCGCGGCTTCTTCATGCTTTTTCTTCTCA
CCATTTCTGGCCAAAACTACAAACAAGACTTCGCAGATCGAGCCTGCGTGCTGCCGAAGCAGGGCGCCGAGTCCATGCGAACTGCCATCT
GATCCGCTCTTATCAATGAAGCAGCCGATCATGGCGGATGGCCCCCGGTGCAAGAGGCGCAAACAAGCCAATCCCAGGAGGAAAAACGTG
GTGAACTATGACAATGTAGTGGACACAGGTTCTGAAACAGATGAGGAAGACAAGCTTCATATTGCTGAGGATGACGGTATTGCCAACCCT
CTGGACCAGGAGACGAGTCCAGCTAGTGTGCCCAACCATGAGTCCTCCCCACACGTGAGCCAAGCTCTGTTGCCAAGAGAGGAAGAGGAA
GATGAAATAAGGGAGGGTGGAGTGGAACACCCCTGGCACAACAACGAGATTCTACAAGCCTCTGTAGATGGTCCAGAAGAAATGAAGGAA
GACTATGACACTATGGGGCCAGAAGCCACGATCCAGACCGCAATTAACAATGGTACAGCCTTGGTGGAGGACCAGATGATGCAAAAGAAA
TTATGAGACACAGTTTCTTCTCTGGAGTAAACTGGCAAGATGTATATGATAAAAAGCTTGTACCTCCTTTTAAACCTCAAGTAACATCTG
AGACAGATACTAGATATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCTGAAAAATGTCAGCAATCAGATTGTGGCA

>In-frame_ZEB2_ENST00000558170_chr2_145182363_-_AKT3_ENST00000366539_chr1_243708899_-_5351nt
CATGCCGTTTAATATCATGCTCTCCCTTCCCTGCTAAGTTTCTCTATGGCCTTTCTCGTTTCTCCTCCTGCCTCCCTACACACTCTCCCT
TACTTTGTAGTGAGGTCTCCCCGAGGTGTAGAGAGATTCAGAGATCGGCCAACCGAGTGTTCTATTTTAATTTACTTAGAGACCCTTTAT
TAAAATGCCAAACTACTTTTTAATATTGGGATCCAGTCCAGAAATTCATCATGCACACACCCTAATACACATGCCCTAAGATGCAGCTCC
CATGCAGCATTTTTTTTTCTGGCTCTGGTACCTAAAAAGAAAAAAATAACAATAAGAGAAAGGGCAGAGAACTTTGTTCCAGAAGCTGTA
CTGAGATACCTACACAATTTGATGTGCATCTCAAATCTGGTCATTAGAGATATCTGTATAAGAAGAGACTATCTGGATTGAGGACCCGGG
ATCTTTCCCTTTAACTTTCGCCCCTTGGAGTTCTCCAGTTCTGTGAATGGTGTGCACCGTTTTCCGCCCTGTACTCTGTAGGATTTAGTG
ATGAGGATAATGATGCCAAAGGCTTGACGGGCGGGGAGGGGGGGGTGGAGGGGGGGAGAAGGGAGGGAGGGGGGAGGGAGGCGAAGGCGA
AAGGGAGGGAGAGGAGGAAGGGAGGGAGGTGGAATTTCATTTCTTCCACTAAAGCGTTTGCGGAGACTTCAAGGTATAATCTATCCCAGA
TCCTTTCCCAGAGAGAAACTTGGCGATCACGTTTTCACATGATGCTCACGCTCAGGGCGCTTCAATTATCCCTCCCCACAAAGATAGGTG
GCGCGTGTTTCAGGGTCTCTCGTCTCTCTCCTACAGAAAAGAAAAAGAAAAAAATGTCATTAGAAGAGGCGTAACACGTCAGTCCGTCCC
CAGGTTTGTGTTTCCTGGAGTGGCCGAAAGAGATCAGTTCTAACCTGCTCTGCAGGAATAACGGTCCTGCCTCCCGACACTCTTGGCGAG
GTTTTTGTACAGTTTGCTCCGGGAGCTGTTTCTTCGCTTCCACCTTTTTCTCCCCCACACTTCGCGGCTTCTTCATGCTTTTTCTTCTCA
CCATTTCTGGCCAAAACTACAAACAAGACTTCGCAGATCGAGCCTGCGTGCTGCCGAAGCAGGGCGCCGAGTCCATGCGAACTGCCATCT
GATCCGCTCTTATCAATGAAGCAGCCGATCATGGCGGATGGCCCCCGGTGCAAGAGGCGCAAACAAGCCAATCCCAGGAGGAAAAACGTG
GTGAACTATGACAATGTAGTGGACACAGGTTCTGAAACAGATGAGGAAGACAAGCTTCATATTGCTGAGGATGACGGTATTGCCAACCCT
CTGGACCAGGAGACGAGTCCAGCTAGTGTGCCCAACCATGAGTCCTCCCCACACGTGAGCCAAGCTCTGTTGCCAAGAGAGGAAGAGGAA
GATGAAATAAGGGAGGGTGGAGTGGAACACCCCTGGCACAACAACGAGATTCTACAAGCCTCTGTAGATGGTCCAGAAGAAATGAAGGAA
GACTATGACACTATGGGGCCAGAAGCCACGATCCAGACCGCAATTAACAATGGTACAGCCTTGGTGGAGGACCAGATGATGCAAAAGAAA
TTATGAGACACAGTTTCTTCTCTGGAGTAAACTGGCAAGATGTATATGATAAAAAGCTTGTACCTCCTTTTAAACCTCAAGTAACATCTG
AGACAGATACTAGATATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCTGAAAAATATGATGAGGATGGTATGGACT
GCATGGACAATGAGAGGCGGCCGCATTTCCCTCAATTTTCCTACTCTGCAAGTGGACGAGAATAAGTCTCTTTCATTCTGCTACTTCACT
GTCATCTTCAATTTATTACTGAAAATGATTCCTGGACATCACCAGTCCTAGCTCTTACACATAGCAGGGGCACCTTCCGACATCCCAGAC
CAGCCAAGGGTCCTCACCCCTCGCCACCTTTCACCCTCATGAAAACACACATACACGCAAATACACTCCAGTTTTTGTTTTTGCATGAAA
TTGTATCTCAGTCTAAGGTCTCATGCTGTTGCTGCTACTGTCTTACTATTATAGCAACTTTAAGAAGTAATTTTCCAACCTTTGGAAGTC
ATGAGCCCACCATTGTTCATTTGTGCACCAATTATCATCTTTTGATCTTTTAGTTTTTCCCTCAGTGAAGGCTAAATGAGATACACTGAT
TCTAGGTACATTTTTTAACTTTCTAGAAGAGAAAAACTAACTAGACTAAGAAGATTTAGTTTATAAATTCAGAACAAGCAATTGTGGAAG
GGTGGTGGCGTGCATATGTAAAGCACATCAGATCCGTGCGTGAAGTAGGCATATATCACTAAGCTGTGGCTGGAATTGATTAGGAAGCAT
TTGGTAGAAGGACTGAACAACTGTTGGGATATATATATATATATATAATTTTTTTTTTTTAAATTCCTGGTGGATACTGTAGAAGAAGCC
CATATCACATGTGGATGTCGAGACTTCACGGGCAATCATGAGCAAGTGAACACTGTTCTACCAAGAACTGAAGGCATATGCACAGTCAAG
GTCACTTAAAGGGTCTTATGAAACAATTTGAGCCAGAGAGCATCTTTCCCCTGTGCTTGGAAACCTTTTTTCCTTCTTGACATTTATCAC
CTCTGATGGCTGAAGAATGTAGACAGGTATAATGATACTGCTTTTCACCAAAATTTCTACACCAAGGTAAACAGGTGTTTGCCTTATTTA
ATTTTTTACTTTCAGTTCTACGTGAATTAGCTTTTTCTCAGATGTTGAAACTTTGAATGTCCTTTTATGATTTTGTTTATATTGCAGTAG
TATTTATTTTTTAGTGATGAGAATTGTATGTCATGTTAGCAAACGCAGCTCCAACTTATATAAAATAGACTTACTGCAGTTACTTTTGAC
CCATGTGCAAGGATTGTACACGCTGATGAGAATCATGCACTTTTTCTCCTCTGTTAAAAAAAATGATAAGGCTCTGAAATGGAATATATT
GGTTAGAATTTGGCTTTGGGAGAAGAGATGCTGCCATTTAACCCCTTGGTACTGAAAATGAGAAAATCCCCAACTATGCATGCCAAGGGG
TTAATGAAACAAATAGCTGTTGACGTTTGCTCATTTAAGAATTTGAAACGTTATGATGACCTGGCAACAAAAAGTAATGAAGAAAATTGA
GACCTGAGTGAAGATAAGAAATGATCTTTACGTGGCAAAATGAACACATCTTGAGTATTTAGGAAATGGGCAGTGAAGGCTAAGAACCTG
GTGTGTTTCTTGGGATCATGGTACATTTATCACTGAATTAAGCCATCAGGGAAAAAACAACAAAAAAAGAGAACACCTCCAGCTTTTCTT
TTTCTGTATATACTCATGTCCCCCAGATTCCAACATTTCTCACTGAAAGGGGGCATGTATGCAAACCTCATCTTTCTCCTTCATTAATGA
TGATCTTCAGATTAAACCCTTTGGTGCTAGGAGCTGACAATTTCCAAAGCAGCCTGTGAAGTCCTAGGGGCTGGGGGCCACTCTTGCGGC
AAGCAGAAGGCCATCCTACTCCGCGGAGTGATCATGGAAATGTATTTTAGTTAAACTCTGACAGCTCCCAAACGGAAGACTACAGCATGA
CGTAGTATTATGATTGCATTGTATGAAAGAGCAAGTGACTTTCTAAGTAGGATGAATCATATTCATATGCAGATGTCTTAGCCTCTTGAC
GCTGGAAGTGTGGATTTATAGCTATGAAACCACTGCTGGCAGTGGGTGGGCCACTGGGACTGACGGGGGTTAAAGGGCATTTTACTAAGG
CAGCTAAGACATATTCAGACATCAACGTTATCCTTCTTTTTCATATTTCTACCTGAGTGAAGTTCATCCTTAGTATTGAGTAGGAAGTTA
CAGTAAATGGTAGTTCATTCTTACTTACACACATAGCTAATCTTTTTTTTTTCACTTGGAATTATGTTGAATGTTTCATTTTGACAAAAA
AGTAGACTAGAAGGTATGTTCTTTAAGTTGTCTTGCATCCATTATATAAGAAAGAAACAGGTGAGAGGAAGAGCAGAAAGCTGAGACTGG
CTGATGTTCAGAGCACTTACTCCTCTAGAGGGAAAGCATGACACCGAACACTAAGCACACAGCTTTTTGTTGTTTTGGTTTTTTCTCCCG
CAAATCTTAAAGTGATTCCCATGACCTTGGCCAAGGACACTTCTTAAAGATTAATGACTGGCACTGACATTGCCCCAGGCGGGCCACTCC
TCACACTGGCTCTCAGTTCCCAGCCATGCCTGGGGCTCAGTCACTTCTATTCCACCCTCTGAGACTCCATTGGTGTCACACAAGGTGTCT
TCTTGGCTTTGATTTTGAGAATCCCCTATTTTCACTTCCAGATCTGTCAGCTGCCATGGAGGAATAATAGAAAACCAGAAATGCGTGTAG
AGGGAGATTTCTAAAACTTCCCTTGTGTCGCCCATAGTTGTAGTTTTGGGTTCTGGCAGGTGGAACACCCTGAAACCTGGAATCATTCTA
TGAGAATACAGTTCAGACTTTGCAGACTCCAGCCCATACTAACTGTCATGAAGCTTGACTTCTTGTCATAATGCAGCCATCTTGGAGGAA
ATTGGCCATTTCTGCTTAGATGGTTGGCAGGGTCGCGCTCAGCTTTGCTTTCTACACTAATTACATAGCATTATTCAAGTATTGTTTTCC
ATTTCCCATCCCTGATTTCCAGCTTCTTAAAGCTGACTGTTCTTGCAGGGGCCACTTGCTTCTCCTAGAGTACAAAAGTAAGGGCCTTCC
TTACTAACTGCAGGGTCTCTCTATTACACCTCAACATACACACTTTGCTGCTACTGTTTGTACTGTCTACAGTAGAATTTCCTTATCTTG
CTCCTGGTAGTGCATTACAGGCAAGCATGAAATGTAAAGTATTTATTTAAATAAAAAGAAAACCTCTAAATTGGTAATTGAATTACCTCC
CTGTAGCTTTATAGTTTGTGACATTTCTTGACCTTGCTAGTTCTTTCATTAGATCTGCGCAAGATCTAGTCATCTGGTTAAGGATTTTAA
GCAGATGCAACTATAAACCCAAGAAACTGTATTACTATTACTGTTGGTCATACTAAACCTGTCTATTTCCTGAAGTATATGACCCACAAG
GATGTGGAATAACTAGGAGAAACTGTTTTTGTACACTGTACATCCTTAGTATTTTTACACGTATATGATAGGGATGAACATGATTTTCCT

>In-frame_ZEB2_ENST00000558170_chr2_145182363_-_AKT3_ENST00000263826_chr1_243708899_-_3932nt
CATGCCGTTTAATATCATGCTCTCCCTTCCCTGCTAAGTTTCTCTATGGCCTTTCTCGTTTCTCCTCCTGCCTCCCTACACACTCTCCCT
TACTTTGTAGTGAGGTCTCCCCGAGGTGTAGAGAGATTCAGAGATCGGCCAACCGAGTGTTCTATTTTAATTTACTTAGAGACCCTTTAT
TAAAATGCCAAACTACTTTTTAATATTGGGATCCAGTCCAGAAATTCATCATGCACACACCCTAATACACATGCCCTAAGATGCAGCTCC
CATGCAGCATTTTTTTTTCTGGCTCTGGTACCTAAAAAGAAAAAAATAACAATAAGAGAAAGGGCAGAGAACTTTGTTCCAGAAGCTGTA
CTGAGATACCTACACAATTTGATGTGCATCTCAAATCTGGTCATTAGAGATATCTGTATAAGAAGAGACTATCTGGATTGAGGACCCGGG
ATCTTTCCCTTTAACTTTCGCCCCTTGGAGTTCTCCAGTTCTGTGAATGGTGTGCACCGTTTTCCGCCCTGTACTCTGTAGGATTTAGTG
ATGAGGATAATGATGCCAAAGGCTTGACGGGCGGGGAGGGGGGGGTGGAGGGGGGGAGAAGGGAGGGAGGGGGGAGGGAGGCGAAGGCGA
AAGGGAGGGAGAGGAGGAAGGGAGGGAGGTGGAATTTCATTTCTTCCACTAAAGCGTTTGCGGAGACTTCAAGGTATAATCTATCCCAGA
TCCTTTCCCAGAGAGAAACTTGGCGATCACGTTTTCACATGATGCTCACGCTCAGGGCGCTTCAATTATCCCTCCCCACAAAGATAGGTG
GCGCGTGTTTCAGGGTCTCTCGTCTCTCTCCTACAGAAAAGAAAAAGAAAAAAATGTCATTAGAAGAGGCGTAACACGTCAGTCCGTCCC
CAGGTTTGTGTTTCCTGGAGTGGCCGAAAGAGATCAGTTCTAACCTGCTCTGCAGGAATAACGGTCCTGCCTCCCGACACTCTTGGCGAG
GTTTTTGTACAGTTTGCTCCGGGAGCTGTTTCTTCGCTTCCACCTTTTTCTCCCCCACACTTCGCGGCTTCTTCATGCTTTTTCTTCTCA
CCATTTCTGGCCAAAACTACAAACAAGACTTCGCAGATCGAGCCTGCGTGCTGCCGAAGCAGGGCGCCGAGTCCATGCGAACTGCCATCT
GATCCGCTCTTATCAATGAAGCAGCCGATCATGGCGGATGGCCCCCGGTGCAAGAGGCGCAAACAAGCCAATCCCAGGAGGAAAAACGTG
GTGAACTATGACAATGTAGTGGACACAGGTTCTGAAACAGATGAGGAAGACAAGCTTCATATTGCTGAGGATGACGGTATTGCCAACCCT
CTGGACCAGGAGACGAGTCCAGCTAGTGTGCCCAACCATGAGTCCTCCCCACACGTGAGCCAAGCTCTGTTGCCAAGAGAGGAAGAGGAA
GATGAAATAAGGGAGGGTGGAGTGGAACACCCCTGGCACAACAACGAGATTCTACAAGCCTCTGTAGATGGTCCAGAAGAAATGAAGGAA
GACTATGACACTATGGGGCCAGAAGCCACGATCCAGACCGCAATTAACAATGGTACAGCCTTGGTGGAGGACCAGATGATGCAAAAGAAA
TTATGAGACACAGTTTCTTCTCTGGAGTAAACTGGCAAGATGTATATGATAAAAAGCTTGTACCTCCTTTTAAACCTCAAGTAACATCTG
AGACAGATACTAGATATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCTGAAAAATATGATGAGGATGGTATGGACT
GCATGGACAATGAGAGGCGGCCGCATTTCCCTCAATTTTCCTACTCTGCAAGTGGACGAGAATAAGTCTCTTTCATTCTGCTACTTCACT
GTCATCTTCAATTTATTACTGAAAATGATTCCTGGACATCACCAGTCCTAGCTCTTACACATAGCAGGGGCACCTTCCGACATCCCAGAC
CAGCCAAGGGTCCTCACCCCTCGCCACCTTTCACCCTCATGAAAACACACATACACGCAAATACACTCCAGTTTTTGTTTTTGCATGAAA
TTGTATCTCAGTCTAAGGTCTCATGCTGTTGCTGCTACTGTCTTACTATTATAGCAACTTTAAGAAGTAATTTTCCAACCTTTGGAAGTC
ATGAGCCCACCATTGTTCATTTGTGCACCAATTATCATCTTTTGATCTTTTAGTTTTTCCCTCAGTGAAGGCTAAATGAGATACACTGAT
TCTAGGTACATTTTTTAACTTTCTAGAAGAGAAAAACTAACTAGACTAAGAAGATTTAGTTTATAAATTCAGAACAAGCAATTGTGGAAG
GGTGGTGGCGTGCATATGTAAAGCACATCAGATCCGTGCGTGAAGTAGGCATATATCACTAAGCTGTGGCTGGAATTGATTAGGAAGCAT
TTGGTAGAAGGACTGAACAACTGTTGGGATATATATATATATATATAATTTTTTTTTTTTAAATTCCTGGTGGATACTGTAGAAGAAGCC
CATATCACATGTGGATGTCGAGACTTCACGGGCAATCATGAGCAAGTGAACACTGTTCTACCAAGAACTGAAGGCATATGCACAGTCAAG
GTCACTTAAAGGGTCTTATGAAACAATTTGAGCCAGAGAGCATCTTTCCCCTGTGCTTGGAAACCTTTTTTCCTTCTTGACATTTATCAC
CTCTGATGGCTGAAGAATGTAGACAGGTATAATGATACTGCTTTTCACCAAAATTTCTACACCAAGGTAAACAGGTGTTTGCCTTATTTA
ATTTTTTACTTTCAGTTCTACGTGAATTAGCTTTTTCTCAGATGTTGAAACTTTGAATGTCCTTTTATGATTTTGTTTATATTGCAGTAG
TATTTATTTTTTAGTGATGAGAATTGTATGTCATGTTAGCAAACGCAGCTCCAACTTATATAAAATAGACTTACTGCAGTTACTTTTGAC
CCATGTGCAAGGATTGTACACGCTGATGAGAATCATGCACTTTTTCTCCTCTGTTAAAAAAAATGATAAGGCTCTGAAATGGAATATATT
GGTTAGAATTTGGCTTTGGGAGAAGAGATGCTGCCATTTAACCCCTTGGTACTGAAAATGAGAAAATCCCCAACTATGCATGCCAAGGGG
TTAATGAAACAAATAGCTGTTGACGTTTGCTCATTTAAGAATTTGAAACGTTATGATGACCTGGCAACAAAAAGTAATGAAGAAAATTGA
GACCTGAGTGAAGATAAGAAATGATCTTTACGTGGCAAAATGAACACATCTTGAGTATTTAGGAAATGGGCAGTGAAGGCTAAGAACCTG
GTGTGTTTCTTGGGATCATGGTACATTTATCACTGAATTAAGCCATCAGGGAAAAAACAACAAAAAAAGAGAACACCTCCAGCTTTTCTT
TTTCTGTATATACTCATGTCCCCCAGATTCCAACATTTCTCACTGAAAGGGGGCATGTATGCAAACCTCATCTTTCTCCTTCATTAATGA
TGATCTTCAGATTAAACCCTTTGGTGCTAGGAGCTGACAATTTCCAAAGCAGCCTGTGAAGTCCTAGGGGCTGGGGGCCACTCTTGCGGC
AAGCAGAAGGCCATCCTACTCCGCGGAGTGATCATGGAAATGTATTTTAGTTAAACTCTGACAGCTCCCAAACGGAAGACTACAGCATGA
CGTAGTATTATGATTGCATTGTATGAAAGAGCAAGTGACTTTCTAAGTAGGATGAATCATATTCATATGCAGATGTCTTAGCCTCTTGAC
GCTGGAAGTGTGGATTTATAGCTATGAAACCACTGCTGGCAGTGGGTGGGCCACTGGGACTGACGGGGGTTAAAGGGCATTTTACTAAGG

>In-frame_ZEB2_ENST00000303660_chr2_145182363_-_AKT3_ENST00000336199_chr1_243708899_-_995nt
CGCGGCTTCTTCATGCTTTTTCTTCTCACCATTTCTGGCCAAAACTACAAACAAGACTTCGCAGATCGAGCCTGCGTGCTGCCGAAGCAG
GGCGCCGAGTCCATGCGAACTGCCATCTGATCCGCTCTTATCAATGAAGCAGCCGATCATGGCGGATGGCCCCCGGTGCAAGAGGCGCAA
ACAAGCCAATCCCAGGAGGAAAAACGTGGTGAACTATGACAATGTAGTGGACACAGGTTCTGAAACAGATGAGGAAGACAAGCTTCATAT
TGCTGAGGATGACGGTATTGCCAACCCTCTGGACCAGGAGACGAGTCCAGCTAGTGTGCCCAACCATGAGTCCTCCCCACACGTGAGCCA
AGCTCTGTTGCCAAGAGAGGAAGAGGAAGATGAAATAAGGGAGGGTGGAGTGGAACACCCCTGGCACAACAACGAGATTCTACAAGCCTC
TGTAGATGGTCCAGAAGAAATGAAGGAAGACTATGACACTATGGGGCCAGAAGCCACGATCCAGACCGCAATTAACAATGGTACAGCCTT
GGTGGAGGACCAGATGATGCAAAAGAAATTATGAGACACAGTTTCTTCTCTGGAGTAAACTGGCAAGATGTATATGATAAAAAGCTTGTA
CCTCCTTTTAAACCTCAAGTAACATCTGAGACAGATACTAGATATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCT
GAAAAATGTCAGCAATCAGATTGTGGCATGCTGGGTAACTGGAAAAAATAATAAAAATCGGCTTCCTACAGCCAGCAGCACAGTCACCCA
TGGAACTGTTGGCTTTGGATTAAATGTGGAATTGAACGACTACCCAGAAGTGTTCTGGAAAGAAGCGAGATGTGTGGCCTGCCTCACCGT
CCTCACCCATCAAAAGCACCAGCAGGCACGTTAACTCGAATTCTCACAAGGAAAAGGCCATTAAAGCTCAAGGTGCATTTCAAACTCCAG

>In-frame_ZEB2_ENST00000303660_chr2_145182363_-_AKT3_ENST00000366540_chr1_243708899_-_795nt
CGCGGCTTCTTCATGCTTTTTCTTCTCACCATTTCTGGCCAAAACTACAAACAAGACTTCGCAGATCGAGCCTGCGTGCTGCCGAAGCAG
GGCGCCGAGTCCATGCGAACTGCCATCTGATCCGCTCTTATCAATGAAGCAGCCGATCATGGCGGATGGCCCCCGGTGCAAGAGGCGCAA
ACAAGCCAATCCCAGGAGGAAAAACGTGGTGAACTATGACAATGTAGTGGACACAGGTTCTGAAACAGATGAGGAAGACAAGCTTCATAT
TGCTGAGGATGACGGTATTGCCAACCCTCTGGACCAGGAGACGAGTCCAGCTAGTGTGCCCAACCATGAGTCCTCCCCACACGTGAGCCA
AGCTCTGTTGCCAAGAGAGGAAGAGGAAGATGAAATAAGGGAGGGTGGAGTGGAACACCCCTGGCACAACAACGAGATTCTACAAGCCTC
TGTAGATGGTCCAGAAGAAATGAAGGAAGACTATGACACTATGGGGCCAGAAGCCACGATCCAGACCGCAATTAACAATGGTACAGCCTT
GGTGGAGGACCAGATGATGCAAAAGAAATTATGAGACACAGTTTCTTCTCTGGAGTAAACTGGCAAGATGTATATGATAAAAAGCTTGTA
CCTCCTTTTAAACCTCAAGTAACATCTGAGACAGATACTAGATATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCT

>In-frame_ZEB2_ENST00000303660_chr2_145182363_-_AKT3_ENST00000366539_chr1_243708899_-_4299nt
CGCGGCTTCTTCATGCTTTTTCTTCTCACCATTTCTGGCCAAAACTACAAACAAGACTTCGCAGATCGAGCCTGCGTGCTGCCGAAGCAG
GGCGCCGAGTCCATGCGAACTGCCATCTGATCCGCTCTTATCAATGAAGCAGCCGATCATGGCGGATGGCCCCCGGTGCAAGAGGCGCAA
ACAAGCCAATCCCAGGAGGAAAAACGTGGTGAACTATGACAATGTAGTGGACACAGGTTCTGAAACAGATGAGGAAGACAAGCTTCATAT
TGCTGAGGATGACGGTATTGCCAACCCTCTGGACCAGGAGACGAGTCCAGCTAGTGTGCCCAACCATGAGTCCTCCCCACACGTGAGCCA
AGCTCTGTTGCCAAGAGAGGAAGAGGAAGATGAAATAAGGGAGGGTGGAGTGGAACACCCCTGGCACAACAACGAGATTCTACAAGCCTC
TGTAGATGGTCCAGAAGAAATGAAGGAAGACTATGACACTATGGGGCCAGAAGCCACGATCCAGACCGCAATTAACAATGGTACAGCCTT
GGTGGAGGACCAGATGATGCAAAAGAAATTATGAGACACAGTTTCTTCTCTGGAGTAAACTGGCAAGATGTATATGATAAAAAGCTTGTA
CCTCCTTTTAAACCTCAAGTAACATCTGAGACAGATACTAGATATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCT
GAAAAATATGATGAGGATGGTATGGACTGCATGGACAATGAGAGGCGGCCGCATTTCCCTCAATTTTCCTACTCTGCAAGTGGACGAGAA
TAAGTCTCTTTCATTCTGCTACTTCACTGTCATCTTCAATTTATTACTGAAAATGATTCCTGGACATCACCAGTCCTAGCTCTTACACAT
AGCAGGGGCACCTTCCGACATCCCAGACCAGCCAAGGGTCCTCACCCCTCGCCACCTTTCACCCTCATGAAAACACACATACACGCAAAT
ACACTCCAGTTTTTGTTTTTGCATGAAATTGTATCTCAGTCTAAGGTCTCATGCTGTTGCTGCTACTGTCTTACTATTATAGCAACTTTA
AGAAGTAATTTTCCAACCTTTGGAAGTCATGAGCCCACCATTGTTCATTTGTGCACCAATTATCATCTTTTGATCTTTTAGTTTTTCCCT
CAGTGAAGGCTAAATGAGATACACTGATTCTAGGTACATTTTTTAACTTTCTAGAAGAGAAAAACTAACTAGACTAAGAAGATTTAGTTT
ATAAATTCAGAACAAGCAATTGTGGAAGGGTGGTGGCGTGCATATGTAAAGCACATCAGATCCGTGCGTGAAGTAGGCATATATCACTAA
GCTGTGGCTGGAATTGATTAGGAAGCATTTGGTAGAAGGACTGAACAACTGTTGGGATATATATATATATATATAATTTTTTTTTTTTAA
ATTCCTGGTGGATACTGTAGAAGAAGCCCATATCACATGTGGATGTCGAGACTTCACGGGCAATCATGAGCAAGTGAACACTGTTCTACC
AAGAACTGAAGGCATATGCACAGTCAAGGTCACTTAAAGGGTCTTATGAAACAATTTGAGCCAGAGAGCATCTTTCCCCTGTGCTTGGAA
ACCTTTTTTCCTTCTTGACATTTATCACCTCTGATGGCTGAAGAATGTAGACAGGTATAATGATACTGCTTTTCACCAAAATTTCTACAC
CAAGGTAAACAGGTGTTTGCCTTATTTAATTTTTTACTTTCAGTTCTACGTGAATTAGCTTTTTCTCAGATGTTGAAACTTTGAATGTCC
TTTTATGATTTTGTTTATATTGCAGTAGTATTTATTTTTTAGTGATGAGAATTGTATGTCATGTTAGCAAACGCAGCTCCAACTTATATA
AAATAGACTTACTGCAGTTACTTTTGACCCATGTGCAAGGATTGTACACGCTGATGAGAATCATGCACTTTTTCTCCTCTGTTAAAAAAA
ATGATAAGGCTCTGAAATGGAATATATTGGTTAGAATTTGGCTTTGGGAGAAGAGATGCTGCCATTTAACCCCTTGGTACTGAAAATGAG
AAAATCCCCAACTATGCATGCCAAGGGGTTAATGAAACAAATAGCTGTTGACGTTTGCTCATTTAAGAATTTGAAACGTTATGATGACCT
GGCAACAAAAAGTAATGAAGAAAATTGAGACCTGAGTGAAGATAAGAAATGATCTTTACGTGGCAAAATGAACACATCTTGAGTATTTAG
GAAATGGGCAGTGAAGGCTAAGAACCTGGTGTGTTTCTTGGGATCATGGTACATTTATCACTGAATTAAGCCATCAGGGAAAAAACAACA
AAAAAAGAGAACACCTCCAGCTTTTCTTTTTCTGTATATACTCATGTCCCCCAGATTCCAACATTTCTCACTGAAAGGGGGCATGTATGC
AAACCTCATCTTTCTCCTTCATTAATGATGATCTTCAGATTAAACCCTTTGGTGCTAGGAGCTGACAATTTCCAAAGCAGCCTGTGAAGT
CCTAGGGGCTGGGGGCCACTCTTGCGGCAAGCAGAAGGCCATCCTACTCCGCGGAGTGATCATGGAAATGTATTTTAGTTAAACTCTGAC
AGCTCCCAAACGGAAGACTACAGCATGACGTAGTATTATGATTGCATTGTATGAAAGAGCAAGTGACTTTCTAAGTAGGATGAATCATAT
TCATATGCAGATGTCTTAGCCTCTTGACGCTGGAAGTGTGGATTTATAGCTATGAAACCACTGCTGGCAGTGGGTGGGCCACTGGGACTG
ACGGGGGTTAAAGGGCATTTTACTAAGGCAGCTAAGACATATTCAGACATCAACGTTATCCTTCTTTTTCATATTTCTACCTGAGTGAAG
TTCATCCTTAGTATTGAGTAGGAAGTTACAGTAAATGGTAGTTCATTCTTACTTACACACATAGCTAATCTTTTTTTTTTCACTTGGAAT
TATGTTGAATGTTTCATTTTGACAAAAAAGTAGACTAGAAGGTATGTTCTTTAAGTTGTCTTGCATCCATTATATAAGAAAGAAACAGGT
GAGAGGAAGAGCAGAAAGCTGAGACTGGCTGATGTTCAGAGCACTTACTCCTCTAGAGGGAAAGCATGACACCGAACACTAAGCACACAG
CTTTTTGTTGTTTTGGTTTTTTCTCCCGCAAATCTTAAAGTGATTCCCATGACCTTGGCCAAGGACACTTCTTAAAGATTAATGACTGGC
ACTGACATTGCCCCAGGCGGGCCACTCCTCACACTGGCTCTCAGTTCCCAGCCATGCCTGGGGCTCAGTCACTTCTATTCCACCCTCTGA
GACTCCATTGGTGTCACACAAGGTGTCTTCTTGGCTTTGATTTTGAGAATCCCCTATTTTCACTTCCAGATCTGTCAGCTGCCATGGAGG
AATAATAGAAAACCAGAAATGCGTGTAGAGGGAGATTTCTAAAACTTCCCTTGTGTCGCCCATAGTTGTAGTTTTGGGTTCTGGCAGGTG
GAACACCCTGAAACCTGGAATCATTCTATGAGAATACAGTTCAGACTTTGCAGACTCCAGCCCATACTAACTGTCATGAAGCTTGACTTC
TTGTCATAATGCAGCCATCTTGGAGGAAATTGGCCATTTCTGCTTAGATGGTTGGCAGGGTCGCGCTCAGCTTTGCTTTCTACACTAATT
ACATAGCATTATTCAAGTATTGTTTTCCATTTCCCATCCCTGATTTCCAGCTTCTTAAAGCTGACTGTTCTTGCAGGGGCCACTTGCTTC
TCCTAGAGTACAAAAGTAAGGGCCTTCCTTACTAACTGCAGGGTCTCTCTATTACACCTCAACATACACACTTTGCTGCTACTGTTTGTA
CTGTCTACAGTAGAATTTCCTTATCTTGCTCCTGGTAGTGCATTACAGGCAAGCATGAAATGTAAAGTATTTATTTAAATAAAAAGAAAA
CCTCTAAATTGGTAATTGAATTACCTCCCTGTAGCTTTATAGTTTGTGACATTTCTTGACCTTGCTAGTTCTTTCATTAGATCTGCGCAA
GATCTAGTCATCTGGTTAAGGATTTTAAGCAGATGCAACTATAAACCCAAGAAACTGTATTACTATTACTGTTGGTCATACTAAACCTGT
CTATTTCCTGAAGTATATGACCCACAAGGATGTGGAATAACTAGGAGAAACTGTTTTTGTACACTGTACATCCTTAGTATTTTTACACGT

>In-frame_ZEB2_ENST00000303660_chr2_145182363_-_AKT3_ENST00000263826_chr1_243708899_-_2880nt
CGCGGCTTCTTCATGCTTTTTCTTCTCACCATTTCTGGCCAAAACTACAAACAAGACTTCGCAGATCGAGCCTGCGTGCTGCCGAAGCAG
GGCGCCGAGTCCATGCGAACTGCCATCTGATCCGCTCTTATCAATGAAGCAGCCGATCATGGCGGATGGCCCCCGGTGCAAGAGGCGCAA
ACAAGCCAATCCCAGGAGGAAAAACGTGGTGAACTATGACAATGTAGTGGACACAGGTTCTGAAACAGATGAGGAAGACAAGCTTCATAT
TGCTGAGGATGACGGTATTGCCAACCCTCTGGACCAGGAGACGAGTCCAGCTAGTGTGCCCAACCATGAGTCCTCCCCACACGTGAGCCA
AGCTCTGTTGCCAAGAGAGGAAGAGGAAGATGAAATAAGGGAGGGTGGAGTGGAACACCCCTGGCACAACAACGAGATTCTACAAGCCTC
TGTAGATGGTCCAGAAGAAATGAAGGAAGACTATGACACTATGGGGCCAGAAGCCACGATCCAGACCGCAATTAACAATGGTACAGCCTT
GGTGGAGGACCAGATGATGCAAAAGAAATTATGAGACACAGTTTCTTCTCTGGAGTAAACTGGCAAGATGTATATGATAAAAAGCTTGTA
CCTCCTTTTAAACCTCAAGTAACATCTGAGACAGATACTAGATATTTTGATGAAGAATTTACAGCTCAGACTATTACAATAACACCACCT
GAAAAATATGATGAGGATGGTATGGACTGCATGGACAATGAGAGGCGGCCGCATTTCCCTCAATTTTCCTACTCTGCAAGTGGACGAGAA
TAAGTCTCTTTCATTCTGCTACTTCACTGTCATCTTCAATTTATTACTGAAAATGATTCCTGGACATCACCAGTCCTAGCTCTTACACAT
AGCAGGGGCACCTTCCGACATCCCAGACCAGCCAAGGGTCCTCACCCCTCGCCACCTTTCACCCTCATGAAAACACACATACACGCAAAT
ACACTCCAGTTTTTGTTTTTGCATGAAATTGTATCTCAGTCTAAGGTCTCATGCTGTTGCTGCTACTGTCTTACTATTATAGCAACTTTA
AGAAGTAATTTTCCAACCTTTGGAAGTCATGAGCCCACCATTGTTCATTTGTGCACCAATTATCATCTTTTGATCTTTTAGTTTTTCCCT
CAGTGAAGGCTAAATGAGATACACTGATTCTAGGTACATTTTTTAACTTTCTAGAAGAGAAAAACTAACTAGACTAAGAAGATTTAGTTT
ATAAATTCAGAACAAGCAATTGTGGAAGGGTGGTGGCGTGCATATGTAAAGCACATCAGATCCGTGCGTGAAGTAGGCATATATCACTAA
GCTGTGGCTGGAATTGATTAGGAAGCATTTGGTAGAAGGACTGAACAACTGTTGGGATATATATATATATATATAATTTTTTTTTTTTAA
ATTCCTGGTGGATACTGTAGAAGAAGCCCATATCACATGTGGATGTCGAGACTTCACGGGCAATCATGAGCAAGTGAACACTGTTCTACC
AAGAACTGAAGGCATATGCACAGTCAAGGTCACTTAAAGGGTCTTATGAAACAATTTGAGCCAGAGAGCATCTTTCCCCTGTGCTTGGAA
ACCTTTTTTCCTTCTTGACATTTATCACCTCTGATGGCTGAAGAATGTAGACAGGTATAATGATACTGCTTTTCACCAAAATTTCTACAC
CAAGGTAAACAGGTGTTTGCCTTATTTAATTTTTTACTTTCAGTTCTACGTGAATTAGCTTTTTCTCAGATGTTGAAACTTTGAATGTCC
TTTTATGATTTTGTTTATATTGCAGTAGTATTTATTTTTTAGTGATGAGAATTGTATGTCATGTTAGCAAACGCAGCTCCAACTTATATA
AAATAGACTTACTGCAGTTACTTTTGACCCATGTGCAAGGATTGTACACGCTGATGAGAATCATGCACTTTTTCTCCTCTGTTAAAAAAA
ATGATAAGGCTCTGAAATGGAATATATTGGTTAGAATTTGGCTTTGGGAGAAGAGATGCTGCCATTTAACCCCTTGGTACTGAAAATGAG
AAAATCCCCAACTATGCATGCCAAGGGGTTAATGAAACAAATAGCTGTTGACGTTTGCTCATTTAAGAATTTGAAACGTTATGATGACCT
GGCAACAAAAAGTAATGAAGAAAATTGAGACCTGAGTGAAGATAAGAAATGATCTTTACGTGGCAAAATGAACACATCTTGAGTATTTAG
GAAATGGGCAGTGAAGGCTAAGAACCTGGTGTGTTTCTTGGGATCATGGTACATTTATCACTGAATTAAGCCATCAGGGAAAAAACAACA
AAAAAAGAGAACACCTCCAGCTTTTCTTTTTCTGTATATACTCATGTCCCCCAGATTCCAACATTTCTCACTGAAAGGGGGCATGTATGC
AAACCTCATCTTTCTCCTTCATTAATGATGATCTTCAGATTAAACCCTTTGGTGCTAGGAGCTGACAATTTCCAAAGCAGCCTGTGAAGT
CCTAGGGGCTGGGGGCCACTCTTGCGGCAAGCAGAAGGCCATCCTACTCCGCGGAGTGATCATGGAAATGTATTTTAGTTAAACTCTGAC
AGCTCCCAAACGGAAGACTACAGCATGACGTAGTATTATGATTGCATTGTATGAAAGAGCAAGTGACTTTCTAAGTAGGATGAATCATAT
TCATATGCAGATGTCTTAGCCTCTTGACGCTGGAAGTGTGGATTTATAGCTATGAAACCACTGCTGGCAGTGGGTGGGCCACTGGGACTG
ACGGGGGTTAAAGGGCATTTTACTAAGGCAGCTAAGACATATTCAGACATCAACGTTATCCTTCTTTTTCATATTTCTACCTGAGTGAAG


Top

FusionGenePPI for ZEB2_AKT3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZEB2COPS6, CEBPA, MTA1, MTA2, HDAC1, HDAC2, RBBP4, RBBP7, ELAVL1, CTBP1, HDAC4, CBX4, UBE2I, SMAD3, APP, SMAD9, SMAD2, SMAD1, SOX2, ZFP36, TEAD2, EP300AKT3TCL1A, PRKCZ, NEDD4, TTC3, NEDD4L, GSK3B, PLEKHO1, EIF4EBP1, RPE, CASP3, AKT1, HSP90AB4P, HSP90AB3P, HSP90AA4P, HSP90AA5P, PIANP, HSP90AB1, FKBP5, HSP90AA1, CDC37, SNX8, TOX2, PRMT6, PPP2CA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZEB2_AKT3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ZEB2_AKT3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneZEB2C1856113Mowat-Wilson syndrome5CTD_human;UNIPROT
HgeneZEB2C0007621Neoplastic Cell Transformation1CTD_human
HgeneZEB2C0018798Congenital Heart Defects1CTD_human
HgeneZEB2C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneZEB2C0027626Neoplasm Invasiveness1CTD_human
HgeneZEB2C1458155Mammary Neoplasms1CTD_human
TgeneAKT3C4014738MEGALENCEPHALY-POLYMICROGYRIA-POLYDACTYLY-HYDROCEPHALUS SYNDROME 23UNIPROT
TgeneAKT3C1863924Megalanecephaly Polymicrogyria-Polydactyly Hydrocephalus Syndrome1CTD_human
TgeneAKT3C1955869Malformations of Cortical Development1CTD_human