FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42610

FusionGeneSummary for ZC3HAV1_BRAF

check button Fusion gene summary
Fusion gene informationFusion gene name: ZC3HAV1_BRAF
Fusion gene ID: 42610
HgeneTgene
Gene symbol

ZC3HAV1

BRAF

Gene ID

56829

673

Gene namezinc finger CCCH-type containing, antiviral 1B-Raf proto-oncogene, serine/threonine kinase
SynonymsARTD13|FLB6421|PARP13|ZAP|ZC3H2|ZC3HDC2B-RAF1|B-raf|BRAF1|NS7|RAFB1
Cytomap

7q34

7q34

Type of geneprotein-codingprotein-coding
Descriptionzinc finger CCCH-type antiviral protein 1ADP-ribosyltransferase diphtheria toxin-like 13zinc finger CCCH domain-containing protein 2zinc finger CCCH-type, antiviral 1serine/threonine-protein kinase B-raf94 kDa B-raf proteinB-Raf proto-oncogene serine/threonine-protein kinase (p94)B-Raf serine/threonine-proteinmurine sarcoma viral (v-raf) oncogene homolog B1proto-oncogene B-Rafv-raf murine sarcoma viral oncogene
Modification date2018052220180527
UniProtAcc

Q7Z2W4

P15056

Ensembl transtripts involved in fusion geneENST00000242351, ENST00000464606, 
ENST00000471652, 
ENST00000288602, 
Fusion gene scores* DoF score4 X 3 X 4=4824 X 11 X 10=2640
# samples 435
** MAII scorelog2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(35/2640*10)=-2.91511110241349
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ZC3HAV1 [Title/Abstract] AND BRAF [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneZC3HAV1

GO:0009615

response to virus

21876179

HgeneZC3HAV1

GO:0045071

negative regulation of viral genome replication

21876179

HgeneZC3HAV1

GO:0061014

positive regulation of mRNA catabolic process

21876179

TgeneBRAF

GO:0006468

protein phosphorylation

17563371

TgeneBRAF

GO:0010828

positive regulation of glucose transmembrane transport

23010278

TgeneBRAF

GO:0033138

positive regulation of peptidyl-serine phosphorylation

19667065

TgeneBRAF

GO:0043066

negative regulation of apoptotic process

19667065

TgeneBRAF

GO:0070374

positive regulation of ERK1 and ERK2 cascade

22065586

TgeneBRAF

GO:0071277

cellular response to calcium ion

18567582

TgeneBRAF

GO:0090150

establishment of protein localization to membrane

23010278


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVTHCATCGA-KS-A4ID-01AZC3HAV1chr7

138758602

-BRAFchr7

140481493

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000242351ENST00000288602ZC3HAV1chr7

138758602

-BRAFchr7

140481493

-
In-frameENST00000464606ENST00000288602ZC3HAV1chr7

138758602

-BRAFchr7

140481493

-
In-frameENST00000471652ENST00000288602ZC3HAV1chr7

138758602

-BRAFchr7

140481493

-

Top

FusionProtFeatures for ZC3HAV1_BRAF


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ZC3HAV1

Q7Z2W4

BRAF

P15056

Antiviral protein which inhibits the replication ofviruses by recruiting the cellular RNA degradation machineries todegrade the viral mRNAs. Binds to a ZAP-responsive element (ZRE)present in the target viral mRNA, recruits cellular poly(A)-specific ribonuclease PARN to remove the poly(A) tail, and the 3'-5' exoribonuclease complex exosome to degrade the RNA body fromthe 3'-end. It also recruits the decapping complex DCP1-DCP2through RNA helicase p72 (DDX17) to remove the cap structure ofthe viral mRNA to initiate its degradation from the 5'-end. Itstarget viruses belong to families which include retroviridae:human immunodeficiency virus type 1 (HIV-1), moloney and murineleukemia virus (MoMLV) and xenotropic MuLV-related virus (XMRV),filoviridae: ebola virus (EBOV) and marburg virus (MARV),togaviridae: sindbis virus (SINV) and Ross river virus (RRV).Specifically targets the multiply spliced but not unspliced orsingly spliced HIV-1 mRNAs for degradation. Isoform 1 is a morepotent viral inhibitor than isoform 2. Isoform 2 acts as apositive regulator of DDX58/RIG-I signaling resulting inactivation of the downstream effector IRF3 leading to theexpression of type I IFNs and IFN stimulated genes (ISGs).{ECO:0000269|PubMed:18225958, ECO:0000269|PubMed:21102435,ECO:0000269|PubMed:21876179, ECO:0000269|PubMed:22720057}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000242351-713285_292624903MotifNuclear export signal
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000242351-71369_76624903MotifNuclear localization signal
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000471652-79285_292624700MotifNuclear export signal
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000471652-7969_76624700MotifNuclear localization signal
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000242351-713224_254624903RegionBinding to EXOSC5
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000242351-7132_254624903RegionNote=N-terminal domain
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000471652-79224_254624700RegionBinding to EXOSC5
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000471652-792_254624700RegionNote=N-terminal domain
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000242351-713150_172624903Zinc fingerC3H1-type 3
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000242351-713169_193624903Zinc fingerC3H1-type 4
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000242351-71373_86624903Zinc fingerC3H1-type 1
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000242351-71388_110624903Zinc fingerC3H1-type 2
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000471652-79150_172624700Zinc fingerC3H1-type 3
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000471652-79169_193624700Zinc fingerC3H1-type 4
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000471652-7973_86624700Zinc fingerC3H1-type 1
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000471652-7988_110624700Zinc fingerC3H1-type 2
TgeneBRAFchr7:138758602chr7:140481493ENST00000288602-918457_717438767DomainProtein kinase
TgeneBRAFchr7:138758602chr7:140481493ENST00000288602-918463_471438767Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000242351-713594_681624903DomainWWE
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000242351-713716_902624903DomainPARP catalytic
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000471652-79594_681624700DomainWWE
HgeneZC3HAV1chr7:138758602chr7:140481493ENST00000471652-79716_902624700DomainPARP catalytic
TgeneBRAFchr7:138758602chr7:140481493ENST00000288602-918122_129438767Compositional biasNote=Poly-Ser
TgeneBRAFchr7:138758602chr7:140481493ENST00000288602-918428_432438767Compositional biasNote=Poly-Ser
TgeneBRAFchr7:138758602chr7:140481493ENST00000288602-9186_11438767Compositional biasNote=Poly-Gly
TgeneBRAFchr7:138758602chr7:140481493ENST00000288602-918155_227438767DomainRBD
TgeneBRAFchr7:138758602chr7:140481493ENST00000288602-918234_280438767Zinc fingerPhorbol-ester/DAG-type


Top

FusionGeneSequence for ZC3HAV1_BRAF


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ZC3HAV1_ENST00000242351_chr7_138758602_-_BRAF_ENST00000288602_chr7_140481493_-_953aa
MADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGITRSVVATTRARVCRRKYCQRPCDNLHLCKL
NLLGRCNTSQSERNLCKTSHEVLSEENFKVLKNHELSGLNKEELAVLLLQSDPFFMPEICKSTKGEGRQQICNQQPPCSRLHICDHFTRG
NCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQKNPPGPRAPSSHRRNMATRARSKSRDRFFQGSQEFLASASASAER
SCTPSPDQISHRASLEDAPVDDLTRKFTTLGSQDRARPPSGSSKATDLGGTSQAGTSQRFLENGSQEDLLHGNPGSTYLASNSTSAPNWK
SLTSWTNDQGARRKTVFSPTLPAARSSLGSLQTPEAVTTRKGTGLLSSDYRIINGKSGTQDIQPGPLFNNNADGVATDITSTRSLNYKST
SSGHREISSPRIQDAGPASRDVQATGRIADDADPRVALVNDSLSDVTSTTSSRVDDHDSEEICLDHLCKGCPLNGSCSKVHFHLPYRWQM
LIGKTWTDFEHMETIEKGYCNPGIHLCSVGSTTINFRVMSCDSFPIRRLSTPSSVTKPANSVFTTKWIWTWKNESGTWIQTGEEKTLGRR
DSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGTSTKPQLAIVTQWCEG
SSLTHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEV
IRMQDKNPYSFQSDVTAFGIVLTELMTGQLPTSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASI

>In-frame_ZC3HAV1_ENST00000464606_chr7_138758602_-_BRAF_ENST00000288602_chr7_140481493_-_1075aa
MADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGITRSVVATTRARVCRRKYCQRPCDNLHLCKL
NLLGRCNTSQSERNLCKTSHEVLSEENFKVLKNHELSGLNKEELAVLLLQSDPFFMPEICKSTKGEGRQQICNQQPPCSRLHICDHFTRG
NCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQKNPPGPRAPSSHRRNMATRARSKSRDRFFQGSQEFLASASASAER
SCTPSPDQISHRASLEDAPVDDLTRKFTTLGSQDRARPPSGSSKATDLGGTSQAGTSQRFLENGSQEDLLHGNPGSTYLASNSTSAPNWK
SLTSWTNDQGARRKTVFSPTLPAARSSLGSLQTPEAVTTRKGTGLLSSDYRIINGKSGTQDIQPGPLFNNNADGVATDITSTRSLNYKST
SSGHREISSPRIQDAGPASRDVQATGRIADDADPRVALVNGKYKGKTLWASTFVHDIPNGSSQVVDKTTDVEKTGATGFGLTMAVKAEKD
MLRTGSQSLRNLVPTTPGESTAPAQVSTLPQSPAALSSSNRAAVWGAQGQNCTQVPVSSASELTRKTTGSAQTSLSDVTSTTSSRVDDHD
SEEICLDHLCKGCPLNGSCSKVHFHLPYRWQMLIGKTWTDFEHMETIEKGYCNPGIHLCSVGSTTINFRVMSCDSFPIRRLSTPSSVTKP
ANSVFTTKWIWTWKNESGTWIQTGEEKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEV
GVLRKTRHVNILLFMGTSTKPQLAIVTQWCEGSSLTHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKI
GDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVTAFGIVLTELMTGQLPTSNINNRDQIIFMVGRGYLSPDLSKVR

>In-frame_ZC3HAV1_ENST00000471652_chr7_138758602_-_BRAF_ENST00000288602_chr7_140481493_-_953aa
MADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGITRSVVATTRARVCRRKYCQRPCDNLHLCKL
NLLGRCNTSQSERNLCKTSHEVLSEENFKVLKNHELSGLNKEELAVLLLQSDPFFMPEICKSTKGEGRQQICNQQPPCSRLHICDHFTRG
NCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQKNPPGPRAPSSHRRNMATRARSKSRDRFFQGSQEFLASASASAER
SCTPSPDQISHRASLEDAPVDDLTRKFTTLGSQDRARPPSGSSKATDLGGTSQAGTSQRFLENGSQEDLLHGNPGSTYLASNSTSAPNWK
SLTSWTNDQGARRKTVFSPTLPAARSSLGSLQTPEAVTTRKGTGLLSSDYRIINGKSGTQDIQPGPLFNNNADGVATDITSTRSLNYKST
SSGHREISSPRIQDAGPASRDVQATGRIADDADPRVALVNDSLSDVTSTTSSRVDDHDSEEICLDHLCKGCPLNGSCSKVHFHLPYRWQM
LIGKTWTDFEHMETIEKGYCNPGIHLCSVGSTTINFRVMSCDSFPIRRLSTPSSVTKPANSVFTTKWIWTWKNESGTWIQTGEEKTLGRR
DSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGTSTKPQLAIVTQWCEG
SSLTHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEV
IRMQDKNPYSFQSDVTAFGIVLTELMTGQLPTSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ZC3HAV1_ENST00000242351_chr7_138758602_-_BRAF_ENST00000288602_chr7_140481493_-_2859nt
ATGGCGGACCCGGAGGTGTGCTGCTTCATCACCAAAATCCTGTGCGCCCACGGGGGCCGCATGGCCCTGGACGCGCTGCTCCAGGAGATC
GCGCTGTCTGAGCCGCAGCTCTGTGAGGTGCTGCAGGTGGCCGGGCCCGACCGCTTTGTGGTGTTGGAGACCGGCGGCGAGGCCGGGATC
ACCCGATCGGTGGTGGCCACCACTCGAGCCCGGGTCTGCCGTCGCAAGTACTGCCAGAGACCCTGCGATAACCTGCATCTCTGCAAACTC
AACTTGCTGGGCCGGTGCAACTATTCGCAGTCCGAGCGGAATTTATGCAAATATTCTCATGAGGTTCTCTCAGAAGAGAACTTCAAAGTC
CTGAAAAATCACGAACTCTCTGGACTGAACAAAGAGGAATTAGCAGTGCTCCTCCTCCAAAGTGATCCTTTTTTTATGCCCGAGATATGC
AAAAGTTATAAGGGAGAGGGTCGGCAGCAGATTTGTAACCAGCAGCCACCGTGTTCAAGACTCCACATCTGTGACCACTTCACCCGAGGG
AACTGTCGTTTTCCCAACTGCCTCCGGTCCCATAACCTGATGGACAGAAAGGTGCTGGCCATCATGAGGGAGCACGGGCTGAACCCCGAC
GTGGTCCAGAACATCCAGGACATCTGCAACAGCAAGCACATGCAGAAGAATCCCCCAGGGCCCAGAGCTCCTTCTTCACATCGTAGAAAC
ATGGCATATAGGGCTAGAAGCAAGAGTAGAGATCGGTTCTTTCAGGGCAGCCAAGAATTTCTTGCGTCTGCTTCAGCGTCTGCTGAGAGG
TCCTGCACACCTAGTCCAGATCAGATCAGCCACAGGGCTTCCCTGGAGGACGCGCCTGTGGACGATCTCACCCGCAAGTTCACGTATCTG
GGGAGTCAGGATCGCGCTCGGCCTCCCTCAGGCTCGTCCAAGGCTACTGATCTTGGAGGAACAAGTCAGGCCGGGACAAGCCAGAGGTTT
TTAGAGAACGGCAGTCAAGAGGACCTCTTGCATGGAAATCCAGGCAGCACTTACCTTGCTTCCAATTCAACATCAGCCCCCAACTGGAAG
AGCCTCACATCCTGGACGAATGACCAAGGCGCCAGGAGAAAGACTGTGTTTTCTCCCACGCTACCTGCCGCCCGCTCTTCTCTTGGCTCT
CTGCAAACACCTGAAGCTGTGACCACCAGAAAGGGCACAGGCTTGCTTTCCTCAGACTACAGGATCATCAATGGCAAAAGTGGAACTCAG
GACATCCAGCCTGGCCCTCTTTTTAATAATAATGCTGATGGAGTGGCCACAGATATAACTTCTACCAGATCCTTAAATTACAAAAGCACT
AGCAGCGGTCACAGAGAAATATCATCACCTAGGATTCAGGATGCTGGACCTGCTTCCCGAGATGTCCAGGCCACTGGCAGAATCGCAGAT
GATGCTGACCCAAGAGTAGCACTTGTTAACGATTCTTTATCTGATGTCACAAGTACCACATCTTCTAGGGTGGATGATCATGACTCAGAG
GAAATTTGTCTTGACCATCTGTGTAAGGGTTGTCCGCTTAATGGTAGCTGCAGCAAAGTCCACTTCCATCTGCCTTACCGGTGGCAGATG
CTTATTGGTAAAACCTGGACGGACTTTGAGCACATGGAGACGATCGAGAAAGGCTACTGTAACCCCGGAATCCACCTCTGTTCTGTAGGA
AGTTATACAATCAATTTTCGGGTAATGAGTTGTGATTCCTTTCCCATCCGACGCCTCTCCACTCCTTCTTCTGTCACCAAGCCAGCCAAT
TCTGTCTTCACCACCAAATGGATTTGGTATTGGAAGAATGAATCTGGCACATGGATTCAGTATGGAGAAGAGAAAACACTTGGTAGACGG
GACTCGAGTGATGATTGGGAGATTCCTGATGGGCAGATTACAGTGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGA
AAGTGGCATGGTGATGTGGCAGTGAAAATGTTGAATGTGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTA
CTCAGGAAAACACGACATGTGAATATCCTACTCTTCATGGGCTATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGC
TCCAGCTTGTATCACCATCTCCATATCATTGAGACCAAATTTGAGATGATCAAACTTATAGATATTGCACGACAGACTGCACAGGGCATG
GATTACTTACACGCCAAGTCAATCATCCACAGAGACCTCAAGAGTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGAT
TTTGGTCTAGCTACAGTGAAATCTCGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTC
ATCAGAATGCAAGATAAAAATCCATACAGCTTTCAGTCAGATGTATATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTA
CCTTATTCAAACATCAACAACAGGGACCAGATAATTTTTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAAC
TGTCCAAAAGCCATGAAGAGATTAATGGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATT
GAGCTGCTGGCCCGCTCATTGCCAAAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGT

>In-frame_ZC3HAV1_ENST00000464606_chr7_138758602_-_BRAF_ENST00000288602_chr7_140481493_-_3225nt
ATGGCGGACCCGGAGGTGTGCTGCTTCATCACCAAAATCCTGTGCGCCCACGGGGGCCGCATGGCCCTGGACGCGCTGCTCCAGGAGATC
GCGCTGTCTGAGCCGCAGCTCTGTGAGGTGCTGCAGGTGGCCGGGCCCGACCGCTTTGTGGTGTTGGAGACCGGCGGCGAGGCCGGGATC
ACCCGATCGGTGGTGGCCACCACTCGAGCCCGGGTCTGCCGTCGCAAGTACTGCCAGAGACCCTGCGATAACCTGCATCTCTGCAAACTC
AACTTGCTGGGCCGGTGCAACTATTCGCAGTCCGAGCGGAATTTATGCAAATATTCTCATGAGGTTCTCTCAGAAGAGAACTTCAAAGTC
CTGAAAAATCACGAACTCTCTGGACTGAACAAAGAGGAATTAGCAGTGCTCCTCCTCCAAAGTGATCCTTTTTTTATGCCCGAGATATGC
AAAAGTTATAAGGGAGAGGGTCGGCAGCAGATTTGTAACCAGCAGCCACCGTGTTCAAGACTCCACATCTGTGACCACTTCACCCGAGGG
AACTGTCGTTTTCCCAACTGCCTCCGGTCCCATAACCTGATGGACAGAAAGGTGCTGGCCATCATGAGGGAGCACGGGCTGAACCCCGAC
GTGGTCCAGAACATCCAGGACATCTGCAACAGCAAGCACATGCAGAAGAATCCCCCAGGGCCCAGAGCTCCTTCTTCACATCGTAGAAAC
ATGGCATATAGGGCTAGAAGCAAGAGTAGAGATCGGTTCTTTCAGGGCAGCCAAGAATTTCTTGCGTCTGCTTCAGCGTCTGCTGAGAGG
TCCTGCACACCTAGTCCAGATCAGATCAGCCACAGGGCTTCCCTGGAGGACGCGCCTGTGGACGATCTCACCCGCAAGTTCACGTATCTG
GGGAGTCAGGATCGCGCTCGGCCTCCCTCAGGCTCGTCCAAGGCTACTGATCTTGGAGGAACAAGTCAGGCCGGGACAAGCCAGAGGTTT
TTAGAGAACGGCAGTCAAGAGGACCTCTTGCATGGAAATCCAGGCAGCACTTACCTTGCTTCCAATTCAACATCAGCCCCCAACTGGAAG
AGCCTCACATCCTGGACGAATGACCAAGGCGCCAGGAGAAAGACTGTGTTTTCTCCCACGCTACCTGCCGCCCGCTCTTCTCTTGGCTCT
CTGCAAACACCTGAAGCTGTGACCACCAGAAAGGGCACAGGCTTGCTTTCCTCAGACTACAGGATCATCAATGGCAAAAGTGGAACTCAG
GACATCCAGCCTGGCCCTCTTTTTAATAATAATGCTGATGGAGTGGCCACAGATATAACTTCTACCAGATCCTTAAATTACAAAAGCACT
AGCAGCGGTCACAGAGAAATATCATCACCTAGGATTCAGGATGCTGGACCTGCTTCCCGAGATGTCCAGGCCACTGGCAGAATCGCAGAT
GATGCTGACCCAAGAGTAGCACTTGTTAACGGTAAATACAAAGGGAAGACACTTTGGGCTAGTACATTTGTTCATGATATACCAAATGGC
TCTAGTCAAGTAGTGGATAAAACTACTGATGTAGAAAAAACTGGTGCCACTGGTTTTGGCTTAACAATGGCAGTCAAGGCAGAAAAAGAT
ATGTTACGTACTGGAAGTCAGAGTCTGAGGAACCTGGTCCCCACCACACCTGGGGAATCCACTGCCCCTGCACAAGTCAGCACTCTGCCT
CAGTCACCTGCTGCCCTTTCCTCAAGCAACAGAGCTGCAGTCTGGGGGGCCCAAGGGCAGAACTGCACCCAGGTTCCTGTTTCCTCTGCC
AGCGAGCTCACAAGGAAGACAACAGGCTCTGCTCAGTATTCTTTATCTGATGTCACAAGTACCACATCTTCTAGGGTGGATGATCATGAC
TCAGAGGAAATTTGTCTTGACCATCTGTGTAAGGGTTGTCCGCTTAATGGTAGCTGCAGCAAAGTCCACTTCCATCTGCCTTACCGGTGG
CAGATGCTTATTGGTAAAACCTGGACGGACTTTGAGCACATGGAGACGATCGAGAAAGGCTACTGTAACCCCGGAATCCACCTCTGTTCT
GTAGGAAGTTATACAATCAATTTTCGGGTAATGAGTTGTGATTCCTTTCCCATCCGACGCCTCTCCACTCCTTCTTCTGTCACCAAGCCA
GCCAATTCTGTCTTCACCACCAAATGGATTTGGTATTGGAAGAATGAATCTGGCACATGGATTCAGTATGGAGAAGAGAAAACACTTGGT
AGACGGGACTCGAGTGATGATTGGGAGATTCCTGATGGGCAGATTACAGTGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTAC
AAGGGAAAGTGGCATGGTGATGTGGCAGTGAAAATGTTGAATGTGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTA
GGAGTACTCAGGAAAACACGACATGTGAATATCCTACTCTTCATGGGCTATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGT
GAGGGCTCCAGCTTGTATCACCATCTCCATATCATTGAGACCAAATTTGAGATGATCAAACTTATAGATATTGCACGACAGACTGCACAG
GGCATGGATTACTTACACGCCAAGTCAATCATCCACAGAGACCTCAAGAGTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAATA
GGTGATTTTGGTCTAGCTACAGTGAAATCTCGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCA
GAAGTCATCAGAATGCAAGATAAAAATCCATACAGCTTTCAGTCAGATGTATATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGA
CAGTTACCTTATTCAAACATCAACAACAGGGACCAGATAATTTTTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGG
AGTAACTGTCCAAAAGCCATGAAGAGATTAATGGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCC
TCTATTGAGCTGCTGGCCCGCTCATTGCCAAAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGAT

>In-frame_ZC3HAV1_ENST00000471652_chr7_138758602_-_BRAF_ENST00000288602_chr7_140481493_-_2859nt
ATGGCGGACCCGGAGGTGTGCTGCTTCATCACCAAAATCCTGTGCGCCCACGGGGGCCGCATGGCCCTGGACGCGCTGCTCCAGGAGATC
GCGCTGTCTGAGCCGCAGCTCTGTGAGGTGCTGCAGGTGGCCGGGCCCGACCGCTTTGTGGTGTTGGAGACCGGCGGCGAGGCCGGGATC
ACCCGATCGGTGGTGGCCACCACTCGAGCCCGGGTCTGCCGTCGCAAGTACTGCCAGAGACCCTGCGATAACCTGCATCTCTGCAAACTC
AACTTGCTGGGCCGGTGCAACTATTCGCAGTCCGAGCGGAATTTATGCAAATATTCTCATGAGGTTCTCTCAGAAGAGAACTTCAAAGTC
CTGAAAAATCACGAACTCTCTGGACTGAACAAAGAGGAATTAGCAGTGCTCCTCCTCCAAAGTGATCCTTTTTTTATGCCCGAGATATGC
AAAAGTTATAAGGGAGAGGGTCGGCAGCAGATTTGTAACCAGCAGCCACCGTGTTCAAGACTCCACATCTGTGACCACTTCACCCGAGGG
AACTGTCGTTTTCCCAACTGCCTCCGGTCCCATAACCTGATGGACAGAAAGGTGCTGGCCATCATGAGGGAGCACGGGCTGAACCCCGAC
GTGGTCCAGAACATCCAGGACATCTGCAACAGCAAGCACATGCAGAAGAATCCCCCAGGGCCCAGAGCTCCTTCTTCACATCGTAGAAAC
ATGGCATATAGGGCTAGAAGCAAGAGTAGAGATCGGTTCTTTCAGGGCAGCCAAGAATTTCTTGCGTCTGCTTCAGCGTCTGCTGAGAGG
TCCTGCACACCTAGTCCAGATCAGATCAGCCACAGGGCTTCCCTGGAGGACGCGCCTGTGGACGATCTCACCCGCAAGTTCACGTATCTG
GGGAGTCAGGATCGCGCTCGGCCTCCCTCAGGCTCGTCCAAGGCTACTGATCTTGGAGGAACAAGTCAGGCCGGGACAAGCCAGAGGTTT
TTAGAGAACGGCAGTCAAGAGGACCTCTTGCATGGAAATCCAGGCAGCACTTACCTTGCTTCCAATTCAACATCAGCCCCCAACTGGAAG
AGCCTCACATCCTGGACGAATGACCAAGGCGCCAGGAGAAAGACTGTGTTTTCTCCCACGCTACCTGCCGCCCGCTCTTCTCTTGGCTCT
CTGCAAACACCTGAAGCTGTGACCACCAGAAAGGGCACAGGCTTGCTTTCCTCAGACTACAGGATCATCAATGGCAAAAGTGGAACTCAG
GACATCCAGCCTGGCCCTCTTTTTAATAATAATGCTGATGGAGTGGCCACAGATATAACTTCTACCAGATCCTTAAATTACAAAAGCACT
AGCAGCGGTCACAGAGAAATATCATCACCTAGGATTCAGGATGCTGGACCTGCTTCCCGAGATGTCCAGGCCACTGGCAGAATCGCAGAT
GATGCTGACCCAAGAGTAGCACTTGTTAACGATTCTTTATCTGATGTCACAAGTACCACATCTTCTAGGGTGGATGATCATGACTCAGAG
GAAATTTGTCTTGACCATCTGTGTAAGGGTTGTCCGCTTAATGGTAGCTGCAGCAAAGTCCACTTCCATCTGCCTTACCGGTGGCAGATG
CTTATTGGTAAAACCTGGACGGACTTTGAGCACATGGAGACGATCGAGAAAGGCTACTGTAACCCCGGAATCCACCTCTGTTCTGTAGGA
AGTTATACAATCAATTTTCGGGTAATGAGTTGTGATTCCTTTCCCATCCGACGCCTCTCCACTCCTTCTTCTGTCACCAAGCCAGCCAAT
TCTGTCTTCACCACCAAATGGATTTGGTATTGGAAGAATGAATCTGGCACATGGATTCAGTATGGAGAAGAGAAAACACTTGGTAGACGG
GACTCGAGTGATGATTGGGAGATTCCTGATGGGCAGATTACAGTGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGA
AAGTGGCATGGTGATGTGGCAGTGAAAATGTTGAATGTGACAGCACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTA
CTCAGGAAAACACGACATGTGAATATCCTACTCTTCATGGGCTATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGC
TCCAGCTTGTATCACCATCTCCATATCATTGAGACCAAATTTGAGATGATCAAACTTATAGATATTGCACGACAGACTGCACAGGGCATG
GATTACTTACACGCCAAGTCAATCATCCACAGAGACCTCAAGAGTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGAT
TTTGGTCTAGCTACAGTGAAATCTCGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTC
ATCAGAATGCAAGATAAAAATCCATACAGCTTTCAGTCAGATGTATATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTA
CCTTATTCAAACATCAACAACAGGGACCAGATAATTTTTATGGTGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAAC
TGTCCAAAAGCCATGAAGAGATTAATGGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATT
GAGCTGCTGGCCCGCTCATTGCCAAAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ZC3HAV1_ENST00000242351_chr7_138758602_-_BRAF_ENST00000288602_chr7_140481493_-_3294nt
GAACCGAGAGGGGGCCACCCCAGGCGGTCACCAGCAGATTTGCCCGCGCGTTCTCTTTCTTTCCACCCAGTTGCCCTTGCGGCCGGCTGT
AAACCTGCCACTAGGACCCGGTCGGTGAGATCTAGCCTCTTGACCTGAGAGCCGAGAGTGGATCGCTGGGCTGGGCTAACGGCGACGGAG
AGCGCGCCCTCGCTGACTCCGGGCGCGCCCAGCAGTAGCACCGCCCGCGCCCGCCCCTGGACACTTGTAAGTTTCGATTTCCGATTTCCG
CGGAACCGAGTCCCGCGCCGCGGCAGAGCCAGCACAGCCAGCGCGCCATGGCGGACCCGGAGGTGTGCTGCTTCATCACCAAAATCCTGT
GCGCCCACGGGGGCCGCATGGCCCTGGACGCGCTGCTCCAGGAGATCGCGCTGTCTGAGCCGCAGCTCTGTGAGGTGCTGCAGGTGGCCG
GGCCCGACCGCTTTGTGGTGTTGGAGACCGGCGGCGAGGCCGGGATCACCCGATCGGTGGTGGCCACCACTCGAGCCCGGGTCTGCCGTC
GCAAGTACTGCCAGAGACCCTGCGATAACCTGCATCTCTGCAAACTCAACTTGCTGGGCCGGTGCAACTATTCGCAGTCCGAGCGGAATT
TATGCAAATATTCTCATGAGGTTCTCTCAGAAGAGAACTTCAAAGTCCTGAAAAATCACGAACTCTCTGGACTGAACAAAGAGGAATTAG
CAGTGCTCCTCCTCCAAAGTGATCCTTTTTTTATGCCCGAGATATGCAAAAGTTATAAGGGAGAGGGTCGGCAGCAGATTTGTAACCAGC
AGCCACCGTGTTCAAGACTCCACATCTGTGACCACTTCACCCGAGGGAACTGTCGTTTTCCCAACTGCCTCCGGTCCCATAACCTGATGG
ACAGAAAGGTGCTGGCCATCATGAGGGAGCACGGGCTGAACCCCGACGTGGTCCAGAACATCCAGGACATCTGCAACAGCAAGCACATGC
AGAAGAATCCCCCAGGGCCCAGAGCTCCTTCTTCACATCGTAGAAACATGGCATATAGGGCTAGAAGCAAGAGTAGAGATCGGTTCTTTC
AGGGCAGCCAAGAATTTCTTGCGTCTGCTTCAGCGTCTGCTGAGAGGTCCTGCACACCTAGTCCAGATCAGATCAGCCACAGGGCTTCCC
TGGAGGACGCGCCTGTGGACGATCTCACCCGCAAGTTCACGTATCTGGGGAGTCAGGATCGCGCTCGGCCTCCCTCAGGCTCGTCCAAGG
CTACTGATCTTGGAGGAACAAGTCAGGCCGGGACAAGCCAGAGGTTTTTAGAGAACGGCAGTCAAGAGGACCTCTTGCATGGAAATCCAG
GCAGCACTTACCTTGCTTCCAATTCAACATCAGCCCCCAACTGGAAGAGCCTCACATCCTGGACGAATGACCAAGGCGCCAGGAGAAAGA
CTGTGTTTTCTCCCACGCTACCTGCCGCCCGCTCTTCTCTTGGCTCTCTGCAAACACCTGAAGCTGTGACCACCAGAAAGGGCACAGGCT
TGCTTTCCTCAGACTACAGGATCATCAATGGCAAAAGTGGAACTCAGGACATCCAGCCTGGCCCTCTTTTTAATAATAATGCTGATGGAG
TGGCCACAGATATAACTTCTACCAGATCCTTAAATTACAAAAGCACTAGCAGCGGTCACAGAGAAATATCATCACCTAGGATTCAGGATG
CTGGACCTGCTTCCCGAGATGTCCAGGCCACTGGCAGAATCGCAGATGATGCTGACCCAAGAGTAGCACTTGTTAACGATTCTTTATCTG
ATGTCACAAGTACCACATCTTCTAGGGTGGATGATCATGACTCAGAGGAAATTTGTCTTGACCATCTGTGTAAGGGTTGTCCGCTTAATG
GTAGCTGCAGCAAAGTCCACTTCCATCTGCCTTACCGGTGGCAGATGCTTATTGGTAAAACCTGGACGGACTTTGAGCACATGGAGACGA
TCGAGAAAGGCTACTGTAACCCCGGAATCCACCTCTGTTCTGTAGGAAGTTATACAATCAATTTTCGGGTAATGAGTTGTGATTCCTTTC
CCATCCGACGCCTCTCCACTCCTTCTTCTGTCACCAAGCCAGCCAATTCTGTCTTCACCACCAAATGGATTTGGTATTGGAAGAATGAAT
CTGGCACATGGATTCAGTATGGAGAAGAGAAAACACTTGGTAGACGGGACTCGAGTGATGATTGGGAGATTCCTGATGGGCAGATTACAG
TGGGACAAAGAATTGGATCTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTGGCAGTGAAAATGTTGAATGTGACAG
CACCTACACCTCAGCAGTTACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAAACACGACATGTGAATATCCTACTCTTCATGGGCT
ATTCCACAAAGCCACAACTGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCATCTCCATATCATTGAGACCAAATTTG
AGATGATCAAACTTATAGATATTGCACGACAGACTGCACAGGGCATGGATTACTTACACGCCAAGTCAATCATCCACAGAGACCTCAAGA
GTAATAATATATTTCTTCATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTGAAATCTCGATGGAGTGGGTCCCATC
AGTTTGAACAGTTGTCTGGATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATGCAAGATAAAAATCCATACAGCTTTCAGTCAGATG
TATATGCATTTGGAATTGTTCTGTATGAATTGATGACTGGACAGTTACCTTATTCAAACATCAACAACAGGGACCAGATAATTTTTATGG
TGGGACGAGGATACCTGTCTCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAAGCCATGAAGAGATTAATGGCAGAGTGCCTCAAAA
AGAAAAGAGATGAGAGACCACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCATTGCCAAAAATTCACCGCAGTGCAT
CAGAACCCTCCTTGAATCGGGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCTTGTGCTTCTCCAAAAACACCCATCCAGGCAGGGG
GATATGGTGCGTTTCCTGTCCACTGAAACAAATGAGTGAGAGAGTTCAGGAGAGTAGCAACAAAAGGAAAATAAATGAACATATGTTTGC

>In-frame_ZC3HAV1_ENST00000464606_chr7_138758602_-_BRAF_ENST00000288602_chr7_140481493_-_3366nt
AGAGCCAGCACAGCCAGCGCGCCATGGCGGACCCGGAGGTGTGCTGCTTCATCACCAAAATCCTGTGCGCCCACGGGGGCCGCATGGCCC
TGGACGCGCTGCTCCAGGAGATCGCGCTGTCTGAGCCGCAGCTCTGTGAGGTGCTGCAGGTGGCCGGGCCCGACCGCTTTGTGGTGTTGG
AGACCGGCGGCGAGGCCGGGATCACCCGATCGGTGGTGGCCACCACTCGAGCCCGGGTCTGCCGTCGCAAGTACTGCCAGAGACCCTGCG
ATAACCTGCATCTCTGCAAACTCAACTTGCTGGGCCGGTGCAACTATTCGCAGTCCGAGCGGAATTTATGCAAATATTCTCATGAGGTTC
TCTCAGAAGAGAACTTCAAAGTCCTGAAAAATCACGAACTCTCTGGACTGAACAAAGAGGAATTAGCAGTGCTCCTCCTCCAAAGTGATC
CTTTTTTTATGCCCGAGATATGCAAAAGTTATAAGGGAGAGGGTCGGCAGCAGATTTGTAACCAGCAGCCACCGTGTTCAAGACTCCACA
TCTGTGACCACTTCACCCGAGGGAACTGTCGTTTTCCCAACTGCCTCCGGTCCCATAACCTGATGGACAGAAAGGTGCTGGCCATCATGA
GGGAGCACGGGCTGAACCCCGACGTGGTCCAGAACATCCAGGACATCTGCAACAGCAAGCACATGCAGAAGAATCCCCCAGGGCCCAGAG
CTCCTTCTTCACATCGTAGAAACATGGCATATAGGGCTAGAAGCAAGAGTAGAGATCGGTTCTTTCAGGGCAGCCAAGAATTTCTTGCGT
CTGCTTCAGCGTCTGCTGAGAGGTCCTGCACACCTAGTCCAGATCAGATCAGCCACAGGGCTTCCCTGGAGGACGCGCCTGTGGACGATC
TCACCCGCAAGTTCACGTATCTGGGGAGTCAGGATCGCGCTCGGCCTCCCTCAGGCTCGTCCAAGGCTACTGATCTTGGAGGAACAAGTC
AGGCCGGGACAAGCCAGAGGTTTTTAGAGAACGGCAGTCAAGAGGACCTCTTGCATGGAAATCCAGGCAGCACTTACCTTGCTTCCAATT
CAACATCAGCCCCCAACTGGAAGAGCCTCACATCCTGGACGAATGACCAAGGCGCCAGGAGAAAGACTGTGTTTTCTCCCACGCTACCTG
CCGCCCGCTCTTCTCTTGGCTCTCTGCAAACACCTGAAGCTGTGACCACCAGAAAGGGCACAGGCTTGCTTTCCTCAGACTACAGGATCA
TCAATGGCAAAAGTGGAACTCAGGACATCCAGCCTGGCCCTCTTTTTAATAATAATGCTGATGGAGTGGCCACAGATATAACTTCTACCA
GATCCTTAAATTACAAAAGCACTAGCAGCGGTCACAGAGAAATATCATCACCTAGGATTCAGGATGCTGGACCTGCTTCCCGAGATGTCC
AGGCCACTGGCAGAATCGCAGATGATGCTGACCCAAGAGTAGCACTTGTTAACGGTAAATACAAAGGGAAGACACTTTGGGCTAGTACAT
TTGTTCATGATATACCAAATGGCTCTAGTCAAGTAGTGGATAAAACTACTGATGTAGAAAAAACTGGTGCCACTGGTTTTGGCTTAACAA
TGGCAGTCAAGGCAGAAAAAGATATGTTACGTACTGGAAGTCAGAGTCTGAGGAACCTGGTCCCCACCACACCTGGGGAATCCACTGCCC
CTGCACAAGTCAGCACTCTGCCTCAGTCACCTGCTGCCCTTTCCTCAAGCAACAGAGCTGCAGTCTGGGGGGCCCAAGGGCAGAACTGCA
CCCAGGTTCCTGTTTCCTCTGCCAGCGAGCTCACAAGGAAGACAACAGGCTCTGCTCAGTATTCTTTATCTGATGTCACAAGTACCACAT
CTTCTAGGGTGGATGATCATGACTCAGAGGAAATTTGTCTTGACCATCTGTGTAAGGGTTGTCCGCTTAATGGTAGCTGCAGCAAAGTCC
ACTTCCATCTGCCTTACCGGTGGCAGATGCTTATTGGTAAAACCTGGACGGACTTTGAGCACATGGAGACGATCGAGAAAGGCTACTGTA
ACCCCGGAATCCACCTCTGTTCTGTAGGAAGTTATACAATCAATTTTCGGGTAATGAGTTGTGATTCCTTTCCCATCCGACGCCTCTCCA
CTCCTTCTTCTGTCACCAAGCCAGCCAATTCTGTCTTCACCACCAAATGGATTTGGTATTGGAAGAATGAATCTGGCACATGGATTCAGT
ATGGAGAAGAGAAAACACTTGGTAGACGGGACTCGAGTGATGATTGGGAGATTCCTGATGGGCAGATTACAGTGGGACAAAGAATTGGAT
CTGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTGGCAGTGAAAATGTTGAATGTGACAGCACCTACACCTCAGCAGT
TACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAAACACGACATGTGAATATCCTACTCTTCATGGGCTATTCCACAAAGCCACAAC
TGGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCATCTCCATATCATTGAGACCAAATTTGAGATGATCAAACTTATAG
ATATTGCACGACAGACTGCACAGGGCATGGATTACTTACACGCCAAGTCAATCATCCACAGAGACCTCAAGAGTAATAATATATTTCTTC
ATGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTGAAATCTCGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTG
GATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATGCAAGATAAAAATCCATACAGCTTTCAGTCAGATGTATATGCATTTGGAATTG
TTCTGTATGAATTGATGACTGGACAGTTACCTTATTCAAACATCAACAACAGGGACCAGATAATTTTTATGGTGGGACGAGGATACCTGT
CTCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAAGCCATGAAGAGATTAATGGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGAC
CACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCATTGCCAAAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATC
GGGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCTTGTGCTTCTCCAAAAACACCCATCCAGGCAGGGGGATATGGTGCGTTTCCTG
TCCACTGAAACAAATGAGTGAGAGAGTTCAGGAGAGTAGCAACAAAAGGAAAATAAATGAACATATGTTTGCTTATATGTTAAATTGAAT

>In-frame_ZC3HAV1_ENST00000471652_chr7_138758602_-_BRAF_ENST00000288602_chr7_140481493_-_3365nt
CTTTTAGTTTCTCTTCTTTCTAAAGAAGGCTCGCGGAGCCCGGCTGGAGAACCTCACCCTCGCCGAGCCTAGAACCGAGAGGGGGCCACC
CCAGGCGGTCACCAGCAGATTTGCCCGCGCGTTCTCTTTCTTTCCACCCAGTTGCCCTTGCGGCCGGCTGTAAACCTGCCACTAGGACCC
GGTCGGTGAGATCTAGCCTCTTGACCTGAGAGCCGAGAGTGGATCGCTGGGCTGGGCTAACGGCGACGGAGAGCGCGCCCTCGCTGACTC
CGGGCGCGCCCAGCAGTAGCACCGCCCGCGCCCGCCCCTGGACACTTGTAAGTTTCGATTTCCGATTTCCGCGGAACCGAGTCCCGCGCC
GCGGCAGAGCCAGCACAGCCAGCGCGCCATGGCGGACCCGGAGGTGTGCTGCTTCATCACCAAAATCCTGTGCGCCCACGGGGGCCGCAT
GGCCCTGGACGCGCTGCTCCAGGAGATCGCGCTGTCTGAGCCGCAGCTCTGTGAGGTGCTGCAGGTGGCCGGGCCCGACCGCTTTGTGGT
GTTGGAGACCGGCGGCGAGGCCGGGATCACCCGATCGGTGGTGGCCACCACTCGAGCCCGGGTCTGCCGTCGCAAGTACTGCCAGAGACC
CTGCGATAACCTGCATCTCTGCAAACTCAACTTGCTGGGCCGGTGCAACTATTCGCAGTCCGAGCGGAATTTATGCAAATATTCTCATGA
GGTTCTCTCAGAAGAGAACTTCAAAGTCCTGAAAAATCACGAACTCTCTGGACTGAACAAAGAGGAATTAGCAGTGCTCCTCCTCCAAAG
TGATCCTTTTTTTATGCCCGAGATATGCAAAAGTTATAAGGGAGAGGGTCGGCAGCAGATTTGTAACCAGCAGCCACCGTGTTCAAGACT
CCACATCTGTGACCACTTCACCCGAGGGAACTGTCGTTTTCCCAACTGCCTCCGGTCCCATAACCTGATGGACAGAAAGGTGCTGGCCAT
CATGAGGGAGCACGGGCTGAACCCCGACGTGGTCCAGAACATCCAGGACATCTGCAACAGCAAGCACATGCAGAAGAATCCCCCAGGGCC
CAGAGCTCCTTCTTCACATCGTAGAAACATGGCATATAGGGCTAGAAGCAAGAGTAGAGATCGGTTCTTTCAGGGCAGCCAAGAATTTCT
TGCGTCTGCTTCAGCGTCTGCTGAGAGGTCCTGCACACCTAGTCCAGATCAGATCAGCCACAGGGCTTCCCTGGAGGACGCGCCTGTGGA
CGATCTCACCCGCAAGTTCACGTATCTGGGGAGTCAGGATCGCGCTCGGCCTCCCTCAGGCTCGTCCAAGGCTACTGATCTTGGAGGAAC
AAGTCAGGCCGGGACAAGCCAGAGGTTTTTAGAGAACGGCAGTCAAGAGGACCTCTTGCATGGAAATCCAGGCAGCACTTACCTTGCTTC
CAATTCAACATCAGCCCCCAACTGGAAGAGCCTCACATCCTGGACGAATGACCAAGGCGCCAGGAGAAAGACTGTGTTTTCTCCCACGCT
ACCTGCCGCCCGCTCTTCTCTTGGCTCTCTGCAAACACCTGAAGCTGTGACCACCAGAAAGGGCACAGGCTTGCTTTCCTCAGACTACAG
GATCATCAATGGCAAAAGTGGAACTCAGGACATCCAGCCTGGCCCTCTTTTTAATAATAATGCTGATGGAGTGGCCACAGATATAACTTC
TACCAGATCCTTAAATTACAAAAGCACTAGCAGCGGTCACAGAGAAATATCATCACCTAGGATTCAGGATGCTGGACCTGCTTCCCGAGA
TGTCCAGGCCACTGGCAGAATCGCAGATGATGCTGACCCAAGAGTAGCACTTGTTAACGATTCTTTATCTGATGTCACAAGTACCACATC
TTCTAGGGTGGATGATCATGACTCAGAGGAAATTTGTCTTGACCATCTGTGTAAGGGTTGTCCGCTTAATGGTAGCTGCAGCAAAGTCCA
CTTCCATCTGCCTTACCGGTGGCAGATGCTTATTGGTAAAACCTGGACGGACTTTGAGCACATGGAGACGATCGAGAAAGGCTACTGTAA
CCCCGGAATCCACCTCTGTTCTGTAGGAAGTTATACAATCAATTTTCGGGTAATGAGTTGTGATTCCTTTCCCATCCGACGCCTCTCCAC
TCCTTCTTCTGTCACCAAGCCAGCCAATTCTGTCTTCACCACCAAATGGATTTGGTATTGGAAGAATGAATCTGGCACATGGATTCAGTA
TGGAGAAGAGAAAACACTTGGTAGACGGGACTCGAGTGATGATTGGGAGATTCCTGATGGGCAGATTACAGTGGGACAAAGAATTGGATC
TGGATCATTTGGAACAGTCTACAAGGGAAAGTGGCATGGTGATGTGGCAGTGAAAATGTTGAATGTGACAGCACCTACACCTCAGCAGTT
ACAAGCCTTCAAAAATGAAGTAGGAGTACTCAGGAAAACACGACATGTGAATATCCTACTCTTCATGGGCTATTCCACAAAGCCACAACT
GGCTATTGTTACCCAGTGGTGTGAGGGCTCCAGCTTGTATCACCATCTCCATATCATTGAGACCAAATTTGAGATGATCAAACTTATAGA
TATTGCACGACAGACTGCACAGGGCATGGATTACTTACACGCCAAGTCAATCATCCACAGAGACCTCAAGAGTAATAATATATTTCTTCA
TGAAGACCTCACAGTAAAAATAGGTGATTTTGGTCTAGCTACAGTGAAATCTCGATGGAGTGGGTCCCATCAGTTTGAACAGTTGTCTGG
ATCCATTTTGTGGATGGCACCAGAAGTCATCAGAATGCAAGATAAAAATCCATACAGCTTTCAGTCAGATGTATATGCATTTGGAATTGT
TCTGTATGAATTGATGACTGGACAGTTACCTTATTCAAACATCAACAACAGGGACCAGATAATTTTTATGGTGGGACGAGGATACCTGTC
TCCAGATCTCAGTAAGGTACGGAGTAACTGTCCAAAAGCCATGAAGAGATTAATGGCAGAGTGCCTCAAAAAGAAAAGAGATGAGAGACC
ACTCTTTCCCCAAATTCTCGCCTCTATTGAGCTGCTGGCCCGCTCATTGCCAAAAATTCACCGCAGTGCATCAGAACCCTCCTTGAATCG
GGCTGGTTTCCAAACAGAGGATTTTAGTCTATATGCTTGTGCTTCTCCAAAAACACCCATCCAGGCAGGGGGATATGGTGCGTTTCCTGT
CCACTGAAACAAATGAGTGAGAGAGTTCAGGAGAGTAGCAACAAAAGGAAAATAAATGAACATATGTTTGCTTATATGTTAAATTGAATA


Top

FusionGenePPI for ZC3HAV1_BRAF


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ZC3HAV1SAP25, PPP2R2B, HDGF, ELAVL1, SIRT7, ISG15, CUL3, COPS5, CAND1, APP, RTCA, PVR, SLTM, RAE1, USP48, SFPQ, NTHL1, ESR2, TARDBP, LIN28A, IVNS1ABP, SPRTN, AURKB, CEP250, BRCA1, EZH2, RNF2, BMI1, ILK, MAST3, WDR76, HIST1H1A, NOL12, RPL8, NIFK, NTRK1, IFI16, TMEM17, XPO1, AHSA1, SORT1, CBX8, LDHD, PES1, MIRLET7A1, MEX3C, TRIM25, CDH1, EGFR, HIST1H1D, HIST1H1C, HIST1H1T, ZNF777, RPL37A, RRP8, BAZ1B, H2AFX, PABPC4L, KHNYN, RPL26L1, ZBTB48, ZNF354A, RBM34, KIAA0020, CNBP, GNL2, NOP2, DKC1, RPL30, GLTSCR2, RBM28, LARP1, RBM19, RPS8, RPL18A, MRPS9, RPL17, ZNF574, BRIX1, YBX1, RPL10A, RPL36, ZCRB1, DHX30, RPS3A, RPS15, PRDM15, GLYR1, YBX3, GADD45GIP1, WDR46, STAU1, STAU2, NOP16, RPL18, HP1BP3, EBNA1BP2, DGCR8, NMNAT1, KRR1, ZNF2, GTPBP4, RRS1, RPL12, PPAN-P2RY11, NGRN, NSA2, DDX24, PAPD5, RPL7, RPL32, GPATCH4, RPL7A, MRPS35, DDX27, RPL13, RPS13, LIN28B, RPL26, MAK16, MOV10, UPF1, DDX10, NXF2, NIP7, RPLP0, MRPS31, LLPH, MPHOSPH10, WHSC1, RPS6, COPZ1, DRG1, NCL, COX15, DLD, PDHA1, G3BP1, TES, URI1BRAFYWHAB, YWHAG, YWHAQ, YWHAZ, SFN, HRAS, AKT1, MAPK3, RAP1GAP, RAF1, MRAS, RAP1A, PAK2, TERF1, CCDC88A, NEDD4L, MAP2K1, RNF149, KSR1, BRAP, PRKCE, RPS6KB2, HSP90AA1, BRAF, YWHAE, HSPA5, MAP2K2, HSPA1A, HSPA8, YWHAH, HSPA9, ARAF, CDC37, HSP90AB1, PHKB, LIMK1, IQGAP1, MAPK1, BAD, LIPF, MUS81, FBXW7, FGFR2, BRCA2, VHL, FNTA, HDAC2, PIK3CA, EGFR, PTEN, FNIP1, FNIP2, RAB3GAP1, KRAS, KIAA0141, FKBPL, ARMCX3, KCNC4, RPTOR, CYLD, NRAS


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ZC3HAV1_BRAF


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneBRAFP15056DB08881VemurafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved
TgeneBRAFP15056DB08896RegorafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved
TgeneBRAFP15056DB00398SorafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved|investigational
TgeneBRAFP15056DB08912DabrafenibSerine/threonine-protein kinase B-rafsmall moleculeapproved|investigational

Top

RelatedDiseases for ZC3HAV1_BRAF


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneBRAFC0025202melanoma21CTD_human
TgeneBRAFC1527249Colorectal Cancer8UNIPROT
TgeneBRAFC1275081Cardio-facio-cutaneous syndrome6CTD_human;ORPHANET;UNIPROT
TgeneBRAFC0009404Colorectal Neoplasms4CTD_human
TgeneBRAFC0040136Thyroid Neoplasm4CTD_human
TgeneBRAFC0024305Lymphoma, Non-Hodgkin3UNIPROT
TgeneBRAFC0684249Carcinoma of lung3UNIPROT
TgeneBRAFC3150970NOONAN SYNDROME 73CTD_human;UNIPROT
TgeneBRAFC0152013Adenocarcinoma of lung (disorder)2CTD_human
TgeneBRAFC0002448Ameloblastoma1CTD_human
TgeneBRAFC0004114Astrocytoma1CTD_human
TgeneBRAFC0010276Craniopharyngioma1CTD_human;ORPHANET
TgeneBRAFC0017638Glioma1CTD_human
TgeneBRAFC0022665Kidney Neoplasm1CTD_human
TgeneBRAFC0023903Liver neoplasms1CTD_human
TgeneBRAFC0024694Mandibular Neoplasms1CTD_human
TgeneBRAFC0028326Noonan Syndrome1CTD_human;ORPHANET
TgeneBRAFC0033578Prostatic Neoplasms1CTD_human
TgeneBRAFC0036920Sezary Syndrome1CTD_human
TgeneBRAFC0079773Lymphoma, T-Cell, Cutaneous1CTD_human
TgeneBRAFC0206686Adrenocortical carcinoma1CTD_human
TgeneBRAFC0206754Neuroendocrine Tumors1CTD_human
TgeneBRAFC0238463Papillary thyroid carcinoma1CTD_human;ORPHANET
TgeneBRAFC0587248Costello syndrome (disorder)1CTD_human
TgeneBRAFC0596263Carcinogenesis1CTD_human
TgeneBRAFC0920269Microsatellite Instability1CTD_human
TgeneBRAFC2239176Liver carcinoma1CTD_human