FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42432

FusionGeneSummary for YY1AP1_ARHGEF2

check button Fusion gene summary
Fusion gene informationFusion gene name: YY1AP1_ARHGEF2
Fusion gene ID: 42432
HgeneTgene
Gene symbol

YY1AP1

ARHGEF2

Gene ID

55249

9181

Gene nameYY1 associated protein 1Rho/Rac guanine nucleotide exchange factor 2
SynonymsGRNG|HCCA1|HCCA2|YY1APGEF|GEF-H1|GEFH1|LFP40|NEDMHM|P40
Cytomap

1q22

1q22

Type of geneprotein-codingprotein-coding
DescriptionYY1-associated protein 1hepatocellular carcinoma susceptibility proteinhepatocellular carcinoma-associated protein 2rho guanine nucleotide exchange factor 2Rho/Rac guanine nucleotide exchange factor (GEF) 2guanine nucleotide exchange factor H1microtubule-regulated Rho-GEFproliferating cell nucleolar antigen p40
Modification date2018052320180522
UniProtAcc

Q9H869

Q92974

Ensembl transtripts involved in fusion geneENST00000311573, ENST00000368340, 
ENST00000347088, ENST00000361831, 
ENST00000355499, ENST00000404643, 
ENST00000407221, ENST00000359205, 
ENST00000295566, ENST00000368330, 
ENST00000368339, ENST00000535662, 
ENST00000405763, ENST00000438245, 
ENST00000476093, 
ENST00000368315, 
ENST00000313695, ENST00000361247, 
ENST00000368316, ENST00000462460, 
ENST00000477754, ENST00000313667, 
Fusion gene scores* DoF score7 X 7 X 3=1475 X 8 X 7=280
# samples 811
** MAII scorelog2(8/147*10)=-0.877744249949002
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/280*10)=-1.34792330342031
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: YY1AP1 [Title/Abstract] AND ARHGEF2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneYY1AP1

GO:0051726

regulation of cell cycle

17541814

TgeneARHGEF2

GO:0032755

positive regulation of interleukin-6 production

21887730

TgeneARHGEF2

GO:0032760

positive regulation of tumor necrosis factor production

21887730

TgeneARHGEF2

GO:0045666

positive regulation of neuron differentiation

28453519

TgeneARHGEF2

GO:0045944

positive regulation of transcription by RNA polymerase II

21887730

TgeneARHGEF2

GO:0050731

positive regulation of peptidyl-tyrosine phosphorylation

21887730

TgeneARHGEF2

GO:0051092

positive regulation of NF-kappaB transcription factor activity

19043560|21887730

TgeneARHGEF2

GO:0055059

asymmetric neuroblast division

28453519

TgeneARHGEF2

GO:0071225

cellular response to muramyl dipeptide

21887730


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-61-1736-01BYY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
TCGARVSARCTCGA-SG-A6Z7-01AYY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000311573ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000311573ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000311573ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000311573ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000311573ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000311573ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000311573ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
In-frameENST00000368340ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000368340ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000368340ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000368340ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000368340ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000368340ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000368340ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
In-frameENST00000347088ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000347088ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000347088ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000347088ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000347088ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000347088ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000347088ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
Frame-shitENST00000361831ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000361831ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000361831ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000361831ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000361831ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000361831ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000361831ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
Frame-shitENST00000355499ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000355499ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000355499ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000355499ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000355499ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000355499ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000355499ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
Frame-shitENST00000404643ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000404643ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000404643ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000404643ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000404643ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000404643ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000404643ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
In-frameENST00000407221ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000407221ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000407221ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000407221ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000407221ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000407221ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000407221ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
In-frameENST00000359205ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000359205ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000359205ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000359205ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000359205ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000359205ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000359205ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
In-frameENST00000295566ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000295566ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000295566ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000295566ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000295566ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000295566ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000295566ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
Frame-shitENST00000368330ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000368330ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000368330ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000368330ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000368330ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000368330ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000368330ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
In-frameENST00000368339ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000368339ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000368339ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000368339ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000368339ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000368339ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000368339ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
In-frameENST00000535662ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000535662ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000535662ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000535662ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000535662ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000535662ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000535662ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
In-frameENST00000405763ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000405763ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000405763ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000405763ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-5UTRENST00000405763ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000405763ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000405763ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
intron-3CDSENST00000438245ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
intron-5UTRENST00000438245ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
intron-5UTRENST00000438245ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
intron-5UTRENST00000438245ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
intron-5UTRENST00000438245ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
intron-intronENST00000438245ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
intron-intronENST00000438245ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
intron-3CDSENST00000476093ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
intron-5UTRENST00000476093ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
intron-5UTRENST00000476093ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
intron-5UTRENST00000476093ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
intron-5UTRENST00000476093ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
intron-intronENST00000476093ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
intron-intronENST00000476093ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155939091

-
5CDS-intronENST00000311573ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000311573ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000311573ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000311573ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000311573ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000311573ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000311573ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000368340ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000368340ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000368340ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000368340ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000368340ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000368340ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000368340ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000347088ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000347088ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000347088ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000347088ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000347088ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000347088ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000347088ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000361831ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000361831ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000361831ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000361831ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000361831ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000361831ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000361831ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000355499ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000355499ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000355499ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000355499ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000355499ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000355499ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000355499ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000404643ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000404643ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000404643ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000404643ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000404643ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000404643ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000404643ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000407221ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000407221ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000407221ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000407221ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000407221ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000407221ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000407221ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000359205ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000359205ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000359205ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000359205ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000359205ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000359205ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000359205ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000295566ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000295566ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000295566ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000295566ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000295566ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000295566ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000295566ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000368330ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000368330ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000368330ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000368330ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000368330ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000368330ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000368330ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000368339ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000368339ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000368339ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000368339ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000368339ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000368339ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000368339ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000535662ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000535662ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000535662ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000535662ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000535662ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000535662ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000535662ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000405763ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000405763ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000405763ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000405763ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-5UTRENST00000405763ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000405763ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
5CDS-intronENST00000405763ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
intron-intronENST00000438245ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
intron-intronENST00000438245ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
intron-intronENST00000438245ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
intron-5UTRENST00000438245ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
intron-5UTRENST00000438245ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
intron-intronENST00000438245ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
intron-intronENST00000438245ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
intron-intronENST00000476093ENST00000368315YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
intron-intronENST00000476093ENST00000313695YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
intron-intronENST00000476093ENST00000361247YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
intron-5UTRENST00000476093ENST00000368316YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
intron-5UTRENST00000476093ENST00000462460YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
intron-intronENST00000476093ENST00000477754YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-
intron-intronENST00000476093ENST00000313667YY1AP1chr1

155638418

-ARHGEF2chr1

155952991

-

Top

FusionProtFeatures for YY1AP1_ARHGEF2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
YY1AP1

Q9H869

ARHGEF2

Q92974

Activates Rho-GTPases by promoting the exchange of GDPfor GTP. May be involved in epithelial barrier permeability, cellmotility and polarization, dendritic spine morphology, antigenpresentation, leukemic cell differentiation, cell cycleregulation, innate immune response, and cancer. Binds Rac-GTPases,but does not seem to promote nucleotide exchange activity towardRac-GTPases, which was uniquely reported in PubMed:9857026. Maystimulate instead the cortical activity of Rac. Inactive towardCDC42, TC10, or Ras-GTPases. Forms an intracellular sensing systemalong with NOD1 for the detection of microbial effectors duringcell invasion by pathogens. Required for RHOA and RIP2 dependentNF-kappaB signaling pathways activation upon S.flexneri cellinvasion. Involved not only in sensing peptidoglycan (PGN)-derivedmuropeptides through NOD1 that is independent of its GEF activity,but also in the activation of NF-kappaB by Shigella effectorproteins (IpgB2 and OspB) which requires its GEF activity and theactivation of RhoA. Involved in innate immune signalingtransduction pathway promoting cytokine IL6/interleukin-6 and TNF-alpha secretion in macrophage upon stimulation by bacterialpeptidoglycans; acts as a signaling intermediate between NOD2receptor and RIPK2 kinase. Contributes to the tyrosinephosphorylation of RIPK2 through Src tyrosine kinase leading toNF-kappaB activation by NOD2. Overexpression activates Rho-, butnot Rac-GTPases, and increases paracellular permeability (Bysimilarity). Involved in neuronal progenitor cell division anddifferentiation (PubMed:28453519). Involved in the migration ofprecerebellar neurons (By similarity).{ECO:0000250|UniProtKB:Q60875, ECO:0000250|UniProtKB:Q865S3,ECO:0000269|PubMed:19043560, ECO:0000269|PubMed:21887730,ECO:0000269|PubMed:28453519, ECO:0000269|PubMed:9857026}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for YY1AP1_ARHGEF2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_YY1AP1_ENST00000368340_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_1377aa
MAGVGRSGGPWGRTRGGRSGRLGVSLGALSSLPLEELPRPLCCRRCRRHFGFALRGETIPVSVAGSASSQFAPLALHLSLLLSRISASRL
TRWPPPDKREGSAVDPGKRRSLAATPSSSLPCTLIALGLRHEKEANELMEDLFETFQDEMGFSNMEDDGPEEEERVAEPQANFNTPQALR
FEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEASS
TRICLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKVFMTPELLP
VCSLKAKNPQDKILFTKAEDNKYLLTCKTARQLTVRIKNLNMNRAPDNIIKTREKEKMKEAKDARTTNGHLFTTISVSGMTMCTACNKSI
TAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSV
STTNIAGHFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVI
TELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPS
AEQMCKTYSEFCSRHSKALKLTKELYARDKRFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALG
LVKELLSNVDEGITQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKY
IFPTLDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKMELQQK
DRALVELLREKVGLFAEMTHFQAEEDGGSGMALPTLPRGLFRSESLESPRGERLLQDAIREVEGLKDLLVGPGVELLLTPREPALPLEPD
SGGNTSPGVTANGEARTFNGSIELCRADSDSSQRDRNGNQLRSPQEEALQRLVNLTGLLHGLQAAVAQQDTLMEARFPEGPERREKLCRA
NSRDGEAGRAGAAPVAPEKQATELALLQRQHALLQEELRRCRRLGEERATEAGSLEARLRESEQARALLEREAEEARRQLAALGQTEPLP
AEAPWARRPVDPRRRSLPAGDALYLSFNPPQPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHS

>In-frame_YY1AP1_ENST00000347088_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_1259aa
MEDLFETFQDEMGFSNMEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQ
TLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEASSTRICLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTH
VSIDCSPHKTVKKTANEFPCLPKQVAWILATSKVFMTPELLPVCSLKAKNPQDKILFTKAEDNLLALGLKHFEGTEFLNPLISKYLLTCK
TARQLTVRIKNLNMNRAPDNIIKTREKEKMKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTK
VKQKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSL
NMRNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEE
LHLEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYAR
DKRFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNR
MDPRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGM
FLISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKMELQQKDRALVELLREKVGLFAEMTHFQAEEDGG
SGMALPTLPRGLFRSESLESPRGERLLQDAIREVEGLKDLLVGPGVELLLTPREPALPLEPDSGGNTSPGVTANGEARTFNGSIELCRAD
SDSSQRDRNGNQLRSPQEEALQRLVNLTGLLHGLQAAVAQQDTLMEARFPEGPERREKLCRANSRDGEAGRAGAAPVAPEKQATELALLQ
RQHALLQEELRRCRRLGEERATEAGSLEARLRESEQARALLEREAEEARRQLAALGQTEPLPAEAPWARRPVDPRRRSLPAGDALYLSFN

>In-frame_YY1AP1_ENST00000407221_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_966aa
TREKEKMKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLR
SKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEAEVIYSEL
MSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHT
RFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARDKRFQQFIRKVTRPAVLKRHGVQ
ECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRR
KLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRST
WIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKMELQQKDRALVELLREKVGLFAEMTHFQAEEDGGSGMALPTLPRGLFRSESLESPRG
ERLLQDAIREVEGLKDLLVGPGVELLLTPREPALPLEPDSGGNTSPGVTANGEARTFNGSIELCRADSDSSQRDRNGNQLRSPQEEALQR
LVNLTGLLHGLQAAVAQQDTLMEARFPEGPERREKLCRANSRDGEAGRAGAAPVAPEKQATELALLQRQHALLQEELRRCRRLGEERATE
AGSLEARLRESEQARALLEREAEEARRQLAALGQTEPLPAEAPWARRPVDPRRRSLPAGDALYLSFNPPQPSRGTDRLDLPVTTRSVHRN

>In-frame_YY1AP1_ENST00000359205_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_966aa
TREKEKMKEAKDARTTNGHLFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLR
SKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEAEVIYSEL
MSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHT
RFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARDKRFQQFIRKVTRPAVLKRHGVQ
ECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRR
KLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRST
WIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKMELQQKDRALVELLREKVGLFAEMTHFQAEEDGGSGMALPTLPRGLFRSESLESPRG
ERLLQDAIREVEGLKDLLVGPGVELLLTPREPALPLEPDSGGNTSPGVTANGEARTFNGSIELCRADSDSSQRDRNGNQLRSPQEEALQR
LVNLTGLLHGLQAAVAQQDTLMEARFPEGPERREKLCRANSRDGEAGRAGAAPVAPEKQATELALLQRQHALLQEELRRCRRLGEERATE
AGSLEARLRESEQARALLEREAEEARRQLAALGQTEPLPAEAPWARRPVDPRRRSLPAGDALYLSFNPPQPSRGTDRLDLPVTTRSVHRN

>In-frame_YY1AP1_ENST00000295566_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_1305aa
MEEEASRSAAATNPGSRLTRWPPPDKREGSAVDPGKRRSLAATPSSSLPCTLIALGLRHEKEANELMEDLFETFQDEMGFSNMEDDGPEE
EERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQTLILDPAQRKRLQQQMQQHVQLLT
QIHLLATCNPNLNPEASSTRICLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQ
VAWILATSKVFMTPELLPVCSLKAKNPQDKILFTKAEDNKYLLTCKTARQLTVRIKNLNMNRAPDNIIKTREKEKMKEAKDARTTNGHLF
TTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQ
SLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVD
SSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRN
FVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARDKRFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRIL
QHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVL
VLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLI
ETEDEAYLRRIKMELQQKDRALVELLREKVGLFAEMTHFQAEEDGGSGMALPTLPRGLFRSESLESPRGERLLQDAIREVEGLKDLLVGP
GVELLLTPREPALPLEPDSGGNTSPGVTANGEARTFNGSIELCRADSDSSQRDRNGNQLRSPQEEALQRLVNLTGLLHGLQAAVAQQDTL
MEARFPEGPERREKLCRANSRDGEAGRAGAAPVAPEKQATELALLQRQHALLQEELRRCRRLGEERATEAGSLEARLRESEQARALLERE
AEEARRQLAALGQTEPLPAEAPWARRPVDPRRRSLPAGDALYLSFNPPQPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERLQDSSD

>In-frame_YY1AP1_ENST00000368339_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_1397aa
MAGVGRSGGPWGRTRGGRSGRLGVSLGALSSLPLEELPRPLCCRRCRRHFGFALRGETIPVSVAGSASSQFAPLALHLSLLLSRISASRL
TRWPPPDKREGSAVDPGKRRSLAATPSSSLPCTLIALGLRHEKEANELMEDLFETFQDEMGFSNMEDDGPEEEERVAEPQANFNTPQALR
FEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEASS
TRICLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKVFMTPELLP
VCSLKAKNPQDKILFTKAEDNLLALGLKHFEGTEFLNPLISKYLLTCKTARQLTVRIKNLNMNRAPDNIIKTREKEKMKEAKDARTTNGH
LFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSF
RQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLA
VDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGST
RNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARDKRFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISR
ILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKD
VLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFP
LIETEDEAYLRRIKMELQQKDRALVELLREKVGLFAEMTHFQAEEDGGSGMALPTLPRGLFRSESLESPRGERLLQDAIREVEGLKDLLV
GPGVELLLTPREPALPLEPDSGGNTSPGVTANGEARTFNGSIELCRADSDSSQRDRNGNQLRSPQEEALQRLVNLTGLLHGLQAAVAQQD
TLMEARFPEGPERREKLCRANSRDGEAGRAGAAPVAPEKQATELALLQRQHALLQEELRRCRRLGEERATEAGSLEARLRESEQARALLE
REAEEARRQLAALGQTEPLPAEAPWARRPVDPRRRSLPAGDALYLSFNPPQPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERLQDS

>In-frame_YY1AP1_ENST00000535662_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_1105aa
MQQKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKVFMTPELLPVC
SLKAKNPQDKILFTKAEDNKYLLTCKTARQLTVRIKNLNMNRAPDNIIKTREKEKMKEAKDARTTNGHLFTTISVSGMTMCTACNKSITA
KEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVST
TNIAGHFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVITE
LIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAE
QMCKTYSEFCSRHSKALKLTKELYARDKRFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALGLV
KELLSNVDEGITQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKDVLVLLMTDVLVFLQEKDQKYIF
PTLDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKMELQQKDR
ALVELLREKVGLFAEMTHFQAEEDGGSGMALPTLPRGLFRSESLESPRGERLLQDAIREVEGLKDLLVGPGVELLLTPREPALPLEPDSG
GNTSPGVTANGEARTFNGSIELCRADSDSSQRDRNGNQLRSPQEEALQRLVNLTGLLHGLQAAVAQQDTLMEARFPEGPERREKLCRANS
RDGEAGRAGAAPVAPEKQATELALLQRQHALLQEELRRCRRLGEERATEAGSLEARLRESEQARALLEREAEEARRQLAALGQTEPLPAE
APWARRPVDPRRRSLPAGDALYLSFNPPQPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHSPR

>In-frame_YY1AP1_ENST00000405763_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_1397aa
MAGVGRSGGPWGRTRGGRSGRLGVSLGALSSLPLEELPRPLCCRRCRRHFGFALRGETIPVSVAGSASSQFAPLALHLSLLLSRISASRL
TRWPPPDKREGSAVDPGKRRSLAATPSSSLPCTLIALGLRHEKEANELMEDLFETFQDEMGFSNMEDDGPEEEERVAEPQANFNTPQALR
FEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEASS
TRICLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKVFMTPELLP
VCSLKAKNPQDKILFTKAEDNLLALGLKHFEGTEFLNPLISKYLLTCKTARQLTVRIKNLNMNRAPDNIIKTREKEKMKEAKDARTTNGH
LFTTISVSGMTMCTACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSF
RQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLA
VDSSFLQQHKKEVMKQQDVITELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHTRFLSQLLERRRQALCPGST
RNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLTKELYARDKRFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISR
ILQHSHGIEEERQDLTTALGLVKELLSNVDEGITQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCLLWKTATGRFKD
VLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFLISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFP
LIETEDEAYLRRIKMELQQKDRALVELLREKVGLFAEMTHFQAEEDGGSGMALPTLPRGLFRSESLESPRGERLLQDAIREVEGLKDLLV
GPGVELLLTPREPALPLEPDSGGNTSPGVTANGEARTFNGSIELCRADSDSSQRDRNGNQLRSPQEEALQRLVNLTGLLHGLQAAVAQQD
TLMEARFPEGPERREKLCRANSRDGEAGRAGAAPVAPEKQATELALLQRQHALLQEELRRCRRLGEERATEAGSLEARLRESEQARALLE
REAEEARRQLAALGQTEPLPAEAPWARRPVDPRRRSLPAGDALYLSFNPPQPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERLQDS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_YY1AP1_ENST00000368340_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_4131nt
ATGGCCGGAGTCGGGCGAAGCGGGGGACCGTGGGGAAGAACGCGAGGAGGGAGGAGTGGGAGGTTGGGGGTGTCGCTAGGCGCCCTTAGC
TCCCTCCCTCTGGAGGAGCTGCCGCGGCCACTCTGCTGCCGCCGCTGCCGCCGCCATTTTGGGTTCGCTTTGCGAGGGGAAACGATCCCA
GTGTCGGTTGCGGGATCCGCCTCCTCTCAGTTTGCCCCTTTAGCCCTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCGGCTT
ACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCGGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCTCACTT
CCCTGTACTCTCATCGCTCTCGGCCTCCGACACGAAAAGGAAGCAAATGAGCTGATGGAAGATCTGTTTGAAACTTTCCAAGATGAGATG
GGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGCGTGTGGCTGAGCCTCAAGCTAACTTTAACACCCCTCAAGCTCTACGG
TTTGAGGAACTACTGGCCAACCTACTAAATGAACAACATCAGATAGCGAAGGAACTATTTGAACAGCTGAAGATGAAGAAACCTTCAGCC
AAACAGCAGAAGGAGGTAGAGAAGGTTAAACCCCAGTGTAAGGAAGTTCATCAGACCCTGATTCTGGACCCAGCACAAAGGAAGAGACTC
CAGCAGCAGATGCAGCAGCATGTTCAGCTCTTGACACAAATCCACCTTCTTGCCACCTGCAACCCCAATCTCAATCCGGAGGCCAGTAGC
ACCAGGATATGTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTC
CAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAG
AAGACTGCCAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATCCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCA
GTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCCTCTTCACCAAGGCTGAGGACAACAAGTACCTTCTAACCTGCAAGACTGCC
CGCCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAAACCCGGGAAAAGGAGAAGATGAAGGAA
GCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATC
ACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAG
CAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCA
AGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTT
TCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATG
CGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAG
GACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATC
TATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACAC
TTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGC
CGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGT
GCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAA
CGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGC
ATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGG
CTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGAC
CCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTC
TGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTAC
ATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTG
ATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTG
CGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAG
GACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGG
ATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGT
GAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGAC
AGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGAC
TCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACAT
GGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCC
AACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAA
CATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGG
GAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCA
GCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCA
CAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTG
GGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGT

>In-frame_YY1AP1_ENST00000347088_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_3777nt
ATGGAAGATCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGCGTGTGGCTGAG
CCTCAAGCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACTACTGGCCAACCTACTAAATGAACAACATCAGATAGCGAAGGAA
CTATTTGAACAGCTGAAGATGAAGAAACCTTCAGCCAAACAGCAGAAGGAGGTAGAGAAGGTTAAACCCCAGTGTAAGGAAGTTCATCAG
ACCCTGATTCTGGACCCAGCACAAAGGAAGAGACTCCAGCAGCAGATGCAGCAGCATGTTCAGCTCTTGACACAAATCCACCTTCTTGCC
ACCTGCAACCCCAATCTCAATCCGGAGGCCAGTAGCACCAGGATATGTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTT
CACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACAT
GTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCCAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATCCTGGCC
ACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCCTCTTCACCAAGGCT
GAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGGACTGAGTTTCTTAACCCTCTAATCAGCAAGTACCTTCTAACCTGCAAG
ACTGCCCGCCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAAACCCGGGAAAAGGAGAAGATG
AAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAG
AGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAG
GTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAG
CGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAG
AGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTC
AACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGAT
GAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGAT
GTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAG
CTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTA
GAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGT
CCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGA
GACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACT
CAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCA
CTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGC
ATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGC
CTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAG
AAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATG
TTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAG
AGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAG
CAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGC
AGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCC
ATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAA
CCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGAC
TCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTT
CTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGC
CGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAG
CGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGG
CTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCA
CTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAAC
CCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAG
GAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCC

>In-frame_YY1AP1_ENST00000407221_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_2898nt
ACCCGGGAAAAGGAGAAGATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACC
ATGTGCTATGCCTGTAACAAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGAC
ACCCTCGCCAACTGTACCAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGA
AGTAAGACAACCATCCGGGAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGC
TCCTCCTTGTCTTTAGCCAAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTC
TCACAGTCCACAGACTCCCTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTG
ATGAGTGACTTTGAGATGGATGAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAG
GAGGTGATGAAGCAGCAAGATGTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTC
CGCACGGGGATGCTGGAAGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACA
CGCTTCCTCAGCCAGCTATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTG
CTCATCAGCCAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTC
TATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAG
GAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAG
CGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGT
CTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGC
AAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTG
TTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATT
GCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACC
TGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGG
CGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTC
CAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGC
GAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGA
GAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCC
ATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGA
TTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCT
GAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCC
ACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAA
GCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCC
GCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGAT
GCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAAC
TTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGT
AGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGGCT

>In-frame_YY1AP1_ENST00000359205_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_2898nt
ACCCGGGAAAAGGAGAAGATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACC
ATGTGCTATGCCTGTAACAAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGAC
ACCCTCGCCAACTGTACCAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGA
AGTAAGACAACCATCCGGGAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGC
TCCTCCTTGTCTTTAGCCAAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTC
TCACAGTCCACAGACTCCCTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTG
ATGAGTGACTTTGAGATGGATGAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAG
GAGGTGATGAAGCAGCAAGATGTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTC
CGCACGGGGATGCTGGAAGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACA
CGCTTCCTCAGCCAGCTATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTG
CTCATCAGCCAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTC
TATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAG
GAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAG
CGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGT
CTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGC
AAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTG
TTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATT
GCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACC
TGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGG
CGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTC
CAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGC
GAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGA
GAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCC
ATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGA
TTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCT
GAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCC
ACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAA
GCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCC
GCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGAT
GCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAAC
TTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGT
AGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGGCT

>In-frame_YY1AP1_ENST00000295566_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_3915nt
ATGGAGGAGGAGGCGAGCCGCAGCGCCGCGGCGACGAACCCAGGGAGTCGGCTTACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCC
GCGGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCTCACTTCCCTGTACTCTCATCGCTCTCGGCCTCCGACACGAA
AAGGAAGCAAATGAGCTGATGGAAGATCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAG
GAGGAGCGTGTGGCTGAGCCTCAAGCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACTACTGGCCAACCTACTAAATGAACAA
CATCAGATAGCGAAGGAACTATTTGAACAGCTGAAGATGAAGAAACCTTCAGCCAAACAGCAGAAGGAGGTAGAGAAGGTTAAACCCCAG
TGTAAGGAAGTTCATCAGACCCTGATTCTGGACCCAGCACAAAGGAAGAGACTCCAGCAGCAGATGCAGCAGCATGTTCAGCTCTTGACA
CAAATCCACCTTCTTGCCACCTGCAACCCCAATCTCAATCCGGAGGCCAGTAGCACCAGGATATGTCTTAAAGAGCTGGGAACCTTTGCT
CAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATT
GAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCCAATGAATTTCCCTGTTTGCCAAAGCAA
GTGGCTTGGATCCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAG
ATCCTCTTCACCAAGGCTGAGGACAACAAGTACCTTCTAACCTGCAAGACTGCCCGCCAACTGACAGTGAGAATCAAGAACCTCAACATG
AACAGAGCTCCTGACAACATCATTAAAACCCGGGAAAAGGAGAAGATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTC
ACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAAT
GTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAAC
ACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAG
TCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAG
TCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGAC
GAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGAC
AGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGG
ACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGC
GTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAAC
TTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGC
AGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCC
GCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTG
CAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGT
ATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCC
TTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTA
GTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCG
CTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCAC
ACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATT
GAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTC
GGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGC
TCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCA
GGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAAT
GGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGA
TCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTG
ATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCT
GCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGG
CGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAG
GCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCT
CGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCT
GTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGAC
CCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAG

>In-frame_YY1AP1_ENST00000368339_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_4191nt
ATGGCCGGAGTCGGGCGAAGCGGGGGACCGTGGGGAAGAACGCGAGGAGGGAGGAGTGGGAGGTTGGGGGTGTCGCTAGGCGCCCTTAGC
TCCCTCCCTCTGGAGGAGCTGCCGCGGCCACTCTGCTGCCGCCGCTGCCGCCGCCATTTTGGGTTCGCTTTGCGAGGGGAAACGATCCCA
GTGTCGGTTGCGGGATCCGCCTCCTCTCAGTTTGCCCCTTTAGCCCTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCGGCTT
ACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCGGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCTCACTT
CCCTGTACTCTCATCGCTCTCGGCCTCCGACACGAAAAGGAAGCAAATGAGCTGATGGAAGATCTGTTTGAAACTTTCCAAGATGAGATG
GGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGCGTGTGGCTGAGCCTCAAGCTAACTTTAACACCCCTCAAGCTCTACGG
TTTGAGGAACTACTGGCCAACCTACTAAATGAACAACATCAGATAGCGAAGGAACTATTTGAACAGCTGAAGATGAAGAAACCTTCAGCC
AAACAGCAGAAGGAGGTAGAGAAGGTTAAACCCCAGTGTAAGGAAGTTCATCAGACCCTGATTCTGGACCCAGCACAAAGGAAGAGACTC
CAGCAGCAGATGCAGCAGCATGTTCAGCTCTTGACACAAATCCACCTTCTTGCCACCTGCAACCCCAATCTCAATCCGGAGGCCAGTAGC
ACCAGGATATGTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTC
CAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAG
AAGACTGCCAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATCCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCA
GTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCCTCTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTT
GAAGGGACTGAGTTTCTTAACCCTCTAATCAGCAAGTACCTTCTAACCTGCAAGACTGCCCGCCAACTGACAGTGAGAATCAAGAACCTC
AACATGAACAGAGCTCCTGACAACATCATTAAAACCCGGGAAAAGGAGAAGATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCAC
CTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACC
TGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAG
AACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTC
CGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAAT
GATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTC
ATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCT
GTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTATGAGCTAATCCAGACAGAGCTGCACCAT
GTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTC
CCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACC
CGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAG
TTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACC
CGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGC
ATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGAC
GAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAG
GGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGAT
GTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTG
GTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAG
GTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCC
CTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAG
AAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTT
TTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTG
GGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACT
GCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAG
CTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGAC
ACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCT
GGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGC
TGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAG
CGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTG
GATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGAT
CTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGC
AGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATC

>In-frame_YY1AP1_ENST00000535662_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_3315nt
ATGCAGCAGAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCC
TGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACT
GCCAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATCCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGT
TCCCTGAAGGCAAAGAATCCCCAGGATAAGATCCTCTTCACCAAGGCTGAGGACAACAAGTACCTTCTAACCTGCAAGACTGCCCGCCAA
CTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAAACCCGGGAAAAGGAGAAGATGAAGGAAGCCAAG
GATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATCACAGCC
AAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAGCAGAAG
CAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCAAGCTCG
GCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTTTCTACC
ACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATGCGGAAC
CGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGACTTT
GCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTATGAG
CTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTGGAG
CCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGACGC
CAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCGGAG
CAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTC
CAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACC
AAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTG
AAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGG
GCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAG
ACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTT
CCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGC
GCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACA
TGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGG
GCACTGGTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCC
CTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTG
GAGGGTCTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGT
GGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGC
CAGAGGGATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTA
CAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCT
CGGGATGGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCG
CTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGT
GAGCAGGCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAG
GCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCC
AGCCGAGGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGC
CCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGA

>In-frame_YY1AP1_ENST00000405763_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_4191nt
ATGGCCGGAGTCGGGCGAAGCGGGGGACCGTGGGGAAGAACGCGAGGAGGGAGGAGTGGGAGGTTGGGGGTGTCGCTAGGCGCCCTTAGC
TCCCTCCCTCTGGAGGAGCTGCCGCGGCCACTCTGCTGCCGCCGCTGCCGCCGCCATTTTGGGTTCGCTTTGCGAGGGGAAACGATCCCA
GTGTCGGTTGCGGGATCCGCCTCCTCTCAGTTTGCCCCTTTAGCCCTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTCGGCTT
ACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCGGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCTCACTT
CCCTGTACTCTCATCGCTCTCGGCCTCCGACACGAAAAGGAAGCAAATGAGCTGATGGAAGATCTGTTTGAAACTTTCCAAGATGAGATG
GGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGCGTGTGGCTGAGCCTCAAGCTAACTTTAACACCCCTCAAGCTCTACGG
TTTGAGGAACTACTGGCCAACCTACTAAATGAACAACATCAGATAGCGAAGGAACTATTTGAACAGCTGAAGATGAAGAAACCTTCAGCC
AAACAGCAGAAGGAGGTAGAGAAGGTTAAACCCCAGTGTAAGGAAGTTCATCAGACCCTGATTCTGGACCCAGCACAAAGGAAGAGACTC
CAGCAGCAGATGCAGCAGCATGTTCAGCTCTTGACACAAATCCACCTTCTTGCCACCTGCAACCCCAATCTCAATCCGGAGGCCAGTAGC
ACCAGGATATGTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTC
CAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAG
AAGACTGCCAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATCCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCA
GTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCCTCTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTT
GAAGGGACTGAGTTTCTTAACCCTCTAATCAGCAAGTACCTTCTAACCTGCAAGACTGCCCGCCAACTGACAGTGAGAATCAAGAACCTC
AACATGAACAGAGCTCCTGACAACATCATTAAAACCCGGGAAAAGGAGAAGATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCAC
CTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACC
TGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAG
AACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTC
CGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAAT
GATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTC
ATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCT
GTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTATGAGCTAATCCAGACAGAGCTGCACCAT
GTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTC
CCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACC
CGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAG
TTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACC
CGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGC
ATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGAC
GAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAG
GGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGAT
GTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTG
GTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAG
GTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCC
CTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAG
AAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTT
TTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTG
GGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACT
GCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAG
CTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGAC
ACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCT
GGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGC
TGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAG
CGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTG
GATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGAT
CTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGC
AGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATC


* Fusion transcript sequences (Full-length transcript).
>In-frame_YY1AP1_ENST00000368340_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_5343nt
CGCGTACGGGATGGCTGGCTCGCAGGACGGCCGAAGGTGGTGGTTGGTGGGAGCAGCCAGCGACGAGCCCGTAGACACTCGTACGCGTGC
GGGCTGACGTGCGCGCTACATGGCCGGAGTCGGGCGAAGCGGGGGACCGTGGGGAAGAACGCGAGGAGGGAGGAGTGGGAGGTTGGGGGT
GTCGCTAGGCGCCCTTAGCTCCCTCCCTCTGGAGGAGCTGCCGCGGCCACTCTGCTGCCGCCGCTGCCGCCGCCATTTTGGGTTCGCTTT
GCGAGGGGAAACGATCCCAGTGTCGGTTGCGGGATCCGCCTCCTCTCAGTTTGCCCCTTTAGCCCTCCACCTTTCCCTTCTCCTCTCTCG
CATTTCCGCCAGTCGGCTTACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCGGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGC
CACCCCCTCTTCCTCACTTCCCTGTACTCTCATCGCTCTCGGCCTCCGACACGAAAAGGAAGCAAATGAGCTGATGGAAGATCTGTTTGA
AACTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGCGTGTGGCTGAGCCTCAAGCTAACTTTAA
CACCCCTCAAGCTCTACGGTTTGAGGAACTACTGGCCAACCTACTAAATGAACAACATCAGATAGCGAAGGAACTATTTGAACAGCTGAA
GATGAAGAAACCTTCAGCCAAACAGCAGAAGGAGGTAGAGAAGGTTAAACCCCAGTGTAAGGAAGTTCATCAGACCCTGATTCTGGACCC
AGCACAAAGGAAGAGACTCCAGCAGCAGATGCAGCAGCATGTTCAGCTCTTGACACAAATCCACCTTCTTGCCACCTGCAACCCCAATCT
CAATCCGGAGGCCAGTAGCACCAGGATATGTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCC
CAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAG
CCCTCATAAAACTGTCAAGAAGACTGCCAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATCCTGGCCACAAGCAAGGTTTTCAT
GTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCCTCTTCACCAAGGCTGAGGACAACAAGTACCT
TCTAACCTGCAAGACTGCCCGCCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAAACCCGGGA
AAAGGAGAAGATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTA
TGCCTGTAACAAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGC
CAACTGTACCAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGAC
AACCATCCGGGAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTT
GTCTTTAGCCAAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTC
CACAGACTCCCTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGA
CTTTGAGATGGATGAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGAT
GAAGCAGCAAGATGTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGG
GATGCTGGAAGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCT
CAGCCAGCTATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAG
CCAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGA
GCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCAT
CCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGA
CCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGA
GATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCAT
CCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCA
GGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCA
GGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCG
GGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAA
GATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGA
AGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCT
GCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGC
CCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACT
CTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAA
TCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCG
GGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACT
GGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAG
CCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGG
CCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTA
CTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGA
CCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCG
TCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGGCTGTAGCCTC
CGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGAGGGGGCTAACCTTGGGGACTCCAATTTGCCAAT
GATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTGGATACCTGGGGCCATTTAAGAAGCTAGGGGAAT
TAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGGAAAATTTATT
TATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATGGGAACCAAGCCATAGGGATCAGAGGGCCTTGTC
CTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATCCGTCTTGGAG
GAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAGGGCCATGTCCCTTTCTCCTCTCCCCTCAACCTC
TTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGC
CATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTGTTCTTTTGTTTTCTTTTTTGTACCAAAGTCAAC
TGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGG
AGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCCCCAGCCATTTAGAAACAAGTTCTAGGGTGGGTT
GGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAACCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAA
CCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAATTTTGTTGTTTAAAAAAAAAATTCAGGGAAAAT

>In-frame_YY1AP1_ENST00000347088_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_4940nt
GAAGAGGAGGTGGAGAAGGCTTGGGCTCGCGCCGCTGAAGAAAAGGAAGCAAATGAGCTGATGGAAGATCTGTTTGAAACTTTCCAAGAT
GAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGCGTGTGGCTGAGCCTCAAGCTAACTTTAACACCCCTCAAGCT
CTACGGTTTGAGGAACTACTGGCCAACCTACTAAATGAACAACATCAGATAGCGAAGGAACTATTTGAACAGCTGAAGATGAAGAAACCT
TCAGCCAAACAGCAGAAGGAGGTAGAGAAGGTTAAACCCCAGTGTAAGGAAGTTCATCAGACCCTGATTCTGGACCCAGCACAAAGGAAG
AGACTCCAGCAGCAGATGCAGCAGCATGTTCAGCTCTTGACACAAATCCACCTTCTTGCCACCTGCAACCCCAATCTCAATCCGGAGGCC
AGTAGCACCAGGATATGTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACC
CTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACT
GTCAAGAAGACTGCCAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATCCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTA
CTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCCTCTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAG
CATTTTGAAGGGACTGAGTTTCTTAACCCTCTAATCAGCAAGTACCTTCTAACCTGCAAGACTGCCCGCCAACTGACAGTGAGAATCAAG
AACCTCAACATGAACAGAGCTCCTGACAACATCATTAAAACCCGGGAAAAGGAGAAGATGAAGGAAGCCAAGGATGCCCGCTATACCAAT
GGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATCACAGCCAAGGAAGCCCTCATCTGC
CCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTG
CTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCAAGCTCGGCCATCTACCCCTCCGAC
AGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTTTCTACCACCAACATTGCTGGACAT
TTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATGCGGAACCGAACCCTATCCGTGGAA
TCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGACTTTGCAGCTGACTCTTGGAGT
CTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTATGAGCTAATCCAGACAGAGCTG
CACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGC
CTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGC
AGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTAC
TCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAA
GTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATC
AGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAAT
GTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCT
GGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTC
AAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCT
TCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATG
TACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGAC
TTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTG
CGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGG
GGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTG
CTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGG
GTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGA
AATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAG
CAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGC
AGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTA
CGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTG
CTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGA
CCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGC
CTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAA
GACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAG
GACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTG
AAGAACATTACTGAGGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGC
TCTTGGGATCCTTGGATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAG
ATGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAA
GGACCAGGGACATGGGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTG
CTGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGG
AGGGCTGTGGGCAGGGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGG
GAGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACC
AGAATGTTTTGTTGTTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGA
TCGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTA
TACTGACCTCTTCCCCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAA
CCATGACCTGAAACCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAAT

>In-frame_YY1AP1_ENST00000407221_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_5121nt
GTAGGGTGGGGGTGCTGGCGGCGGCTGCTTTGGCGGCGGTTGGTGGCCGTGCGGGCGGGGAGGGAGGGGGAGGAGAGAAGAGGAGGTGGA
GAAGGCTTGGGCTCGCGCCGCTGAAGTCGGCTTACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCGGTGGACCCAGGGAAGCGG
AGGAGCCTGGCGGCCACCCCCTCTTCCTCACTTCCCTGTACTCTCATCGCTCTCGGCCTCCGACACGAAAAGGAAGCAAATGAGCTGATG
GAAGATCTGTTTGAAACTGTGAGTAATGATCCTCAAGTGAGAACATGGGATTTTCCAAGATGAGATGGGATTCTCCAACATGGAAGATGA
TGGCCCAGAAGAGGAGGAGCGTGTGGCTGAGCCTCAAGCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACTACTGGCCAACCT
ACTAAATGAACAACATCAGATAGCGAAGGAACTATTTGAACAGCTGAAGATGAAGAAACCTTCAGCCAAACAGCAGAAGGAGGTAGAGAA
GGTTAAACCCCAGTGTAAGGAAGTTCATCAGACCCTGATTCTGGACCCAGCACAAAGGAAGAGACTCCAGCAGCAGATGCAGCAGCATGT
TCAGCTCTTGACACAAATCCACCTTCTTGCCACCTGCAACCCCAATCTCAATCCGGAGGCCAGTAGCACCAGGATATGTCTTAAAGAGCT
GGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGC
TATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCCAATGAATTTCCCTG
TTTGCCAAAGCAAGTGGCTTGGATCCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAA
TCCCCAGGATAAGATCCTCTTCACCAAGGCTGAGGACAACAAGTACCTTCTAACCTGCAAGACTGCCCGCCAACTGACAGTGAGAATCAA
GAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAAACCCGGGAAAAGGAGAAGATGAAGGAAGCCAAGGATGCCCGCTATACCAA
TGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATCACAGCCAAGGAAGCCCTCATCTG
CCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCT
GCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCAAGCTCGGCCATCTACCCCTCCGA
CAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTTTCTACCACCAACATTGCTGGACA
TTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATGCGGAACCGAACCCTATCCGTGGA
ATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGACTTTGCAGCTGACTCTTGGAG
TCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTATGAGCTAATCCAGACAGAGCT
GCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTGGAGCCAGGAGTGGTCCAGGG
CCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGACGCCAGGCCCTGTGCCCTGG
CAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTA
CTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAA
AGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCAT
CAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAA
TGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCC
TGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTT
CAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCC
TTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGAT
GTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGA
CTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCT
GCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAG
GGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCT
GCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGG
GGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGG
AAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCA
GCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGG
CAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCT
ACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACT
GCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAG
ACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCG
CCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCA
AGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCA
GGACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACT
GAAGAACATTACTGAGGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAG
CTCTTGGGATCCTTGGATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACA
GATGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAA
AGGACCAGGGACATGGGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCT
GCTGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAG
GAGGGCTGTGGGCAGGGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTG
GGAGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGAC
CAGAATGTTTTGTTGTTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAG
ATCGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCT
ATACTGACCTCTTCCCCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCA
ACCATGACCTGAAACCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAA

>In-frame_YY1AP1_ENST00000359205_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_5106nt
GTAGGGTGGGGGTGCTGGCGGCGGCTGCTTTGGCGGCGGTTGGTGGCCGTGCGGGCGGGGAGGGAGGGGGAGGAGAGAAGAGGAGGTGGA
GAAGGCTTGGGCTCGCGCCGCTGAAGTCGGCTTACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCGGTGGACCCAGGGAAGCGG
AGGAGCCTGGCGGCCACCCCCTCTTCCTCACTTCCCTGTACTCTCATCGCTCTCGGCCTCCGACACGTTCCAAGATGAGATGGGATTCTC
CAACATGGAAGATGATGGCCCAGAAGAGGAGGAGCGTGTGGCTGAGCCTCAAGCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGA
ACTACTGGCCAACCTACTAAATGAACAACATCAGATAGCGAAGGAACTATTTGAACAGCTGAAGATGAAGAAACCTTCAGCCAAACAGCA
GAAGGAGGTAGAGAAGGTTAAACCCCAGTGTAAGGAAGTTCATCAGACCCTGATTCTGGACCCAGCACAAAGGAAGAGACTCCAGCAGCA
GATGCAGCAGCATGTTCAGCTCTTGACACAAATCCACCTTCTTGCCACCTGCAACCCCAATCTCAATCCGGAGGCCAGTAGCACCAGGAT
ATGTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTG
TAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGC
CAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATCCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTC
CCTGAAGGCAAAGAATCCCCAGGATAAGATCCTCTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGCATTTTGAAGGGAC
TGAGTTTCTTAACCCTCTAATCAGCAAGTACCTTCTAACCTGCAAGACTGCCCGCCAACTGACAGTGAGAATCAAGAACCTCAACATGAA
CAGAGCTCCTGACAACATCATTAAAACCCGGGAAAAGGAGAAGATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCAC
CACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGT
GACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACAC
CGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTC
CCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTC
TCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGA
AGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAG
CAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGAC
ACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGT
GGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTT
TGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAG
CCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGC
CGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCA
GCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTAT
TTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTT
TGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGT
GCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCT
GCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACAC
AGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGA
GACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGG
GCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTC
TGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGG
AGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGG
TGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATC
ACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGAT
GGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGC
CCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCG
GCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGC
CGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCG
GCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGT
CACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCC
TGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGA
GACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGA
GGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTG
GATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCA
TGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATG
GGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCC
TAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAG
GGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCT
TCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTG
TTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTAT
CTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCC
CCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAAC
CTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAA

>In-frame_YY1AP1_ENST00000295566_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_5042nt
CCTCGATCCCCTCGCCGCGGTCCCATGGAGGAGGAGGCGAGCCGCAGCGCCGCGGCGACGAACCCAGGGAGTCGGCTTACCCGCTGGCCG
CCTCCTGACAAGCGGGAGGGATCCGCGGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCTCACTTCCCTGTACTCTC
ATCGCTCTCGGCCTCCGACACGAAAAGGAAGCAAATGAGCTGATGGAAGATCTGTTTGAAACTTTCCAAGATGAGATGGGATTCTCCAAC
ATGGAAGATGATGGCCCAGAAGAGGAGGAGCGTGTGGCTGAGCCTCAAGCTAACTTTAACACCCCTCAAGCTCTACGGTTTGAGGAACTA
CTGGCCAACCTACTAAATGAACAACATCAGATAGCGAAGGAACTATTTGAACAGCTGAAGATGAAGAAACCTTCAGCCAAACAGCAGAAG
GAGGTAGAGAAGGTTAAACCCCAGTGTAAGGAAGTTCATCAGACCCTGATTCTGGACCCAGCACAAAGGAAGAGACTCCAGCAGCAGATG
CAGCAGCATGTTCAGCTCTTGACACAAATCCACCTTCTTGCCACCTGCAACCCCAATCTCAATCCGGAGGCCAGTAGCACCAGGATATGT
CTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCCTGTTCCAACCCTGTAAC
TTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTGTCAAGAAGACTGCCAAT
GAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATCCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTACTTCCAGTGTGTTCCCTG
AAGGCAAAGAATCCCCAGGATAAGATCCTCTTCACCAAGGCTGAGGACAACAAGTACCTTCTAACCTGCAAGACTGCCCGCCAACTGACA
GTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAAACCCGGGAAAAGGAGAAGATGAAGGAAGCCAAGGATGCC
CGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATCACAGCCAAGGAA
GCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAGCAGAAGCAACAG
AAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCAAGCTCGGCCATC
TACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTTTCTACCACCAAC
ATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATGCGGAACCGAACC
CTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGACTTTGCAGCT
GACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTATGAGCTAATC
CAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTGGAGCCAGGA
GTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGACGCCAGGCC
CTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCGGAGCAGATG
TGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAA
TTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTAC
CCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAG
CTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAA
ACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCG
ACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACC
CTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCC
CCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCA
TCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTG
GTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCC
ACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGT
CTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAAC
ACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGG
GATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCA
GCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGAT
GGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTG
CAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAG
GCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCC
TGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGA
GGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAA
GAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTT
ACCAGAATGCAGGACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCC
CGTGCCCCACTGAAGAACATTACTGAGGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATT
GTCCTTGCCAGCTCTTGGGATCCTTGGATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAA
GCTACACCACAGATGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAG
GGGAGATTTAAAGGACCAGGGACATGGGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCA
TCCACGCAGCTGCTGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCC
TTTAAATAAAGGAGGGCTGTGGGCAGGGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCA
TGGAAGCCCTGGGAGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAA
CCCACAGGGACCAGAATGTTTTGTTGTTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTA
GGCAATTAGAGATCGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAA
CGGGGGGACCTATACTGACCTCTTCCCCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTT
CCACCTCAGCAACCATGACCTGAAACCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAA
ATGTCGAAGAATTTTCTTCTTGCCAATTTTGTTGTTTAAAAAAAAAATTCAGGGAAAATTAAAAACCTGGAACTCCATAAGGTACTGTCT

>In-frame_YY1AP1_ENST00000368339_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_5299nt
GCTACATGGCCGGAGTCGGGCGAAGCGGGGGACCGTGGGGAAGAACGCGAGGAGGGAGGAGTGGGAGGTTGGGGGTGTCGCTAGGCGCCC
TTAGCTCCCTCCCTCTGGAGGAGCTGCCGCGGCCACTCTGCTGCCGCCGCTGCCGCCGCCATTTTGGGTTCGCTTTGCGAGGGGAAACGA
TCCCAGTGTCGGTTGCGGGATCCGCCTCCTCTCAGTTTGCCCCTTTAGCCCTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCGCCAGTC
GGCTTACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCGGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCTCTTCCT
CACTTCCCTGTACTCTCATCGCTCTCGGCCTCCGACACGAAAAGGAAGCAAATGAGCTGATGGAAGATCTGTTTGAAACTTTCCAAGATG
AGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGCGTGTGGCTGAGCCTCAAGCTAACTTTAACACCCCTCAAGCTC
TACGGTTTGAGGAACTACTGGCCAACCTACTAAATGAACAACATCAGATAGCGAAGGAACTATTTGAACAGCTGAAGATGAAGAAACCTT
CAGCCAAACAGCAGAAGGAGGTAGAGAAGGTTAAACCCCAGTGTAAGGAAGTTCATCAGACCCTGATTCTGGACCCAGCACAAAGGAAGA
GACTCCAGCAGCAGATGCAGCAGCATGTTCAGCTCTTGACACAAATCCACCTTCTTGCCACCTGCAACCCCAATCTCAATCCGGAGGCCA
GTAGCACCAGGATATGTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTCAGACCC
TGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATAAAACTG
TCAAGAAGACTGCCAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATCCTGGCCACAAGCAAGGTTTTCATGTATCCAGAGTTAC
TTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCCTCTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGACTGAAGC
ATTTTGAAGGGACTGAGTTTCTTAACCCTCTAATCAGCAAGTACCTTCTAACCTGCAAGACTGCCCGCCAACTGACAGTGAGAATCAAGA
ACCTCAACATGAACAGAGCTCCTGACAACATCATTAAAACCCGGGAAAAGGAGAAGATGAAGGAAGCCAAGGATGCCCGCTATACCAATG
GGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATCACAGCCAAGGAAGCCCTCATCTGCC
CAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGC
TGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCAAGCTCGGCCATCTACCCCTCCGACA
GCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTTTCTACCACCAACATTGCTGGACATT
TCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATGCGGAACCGAACCCTATCCGTGGAAT
CCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGACTTTGCAGCTGACTCTTGGAGTC
TTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTATGAGCTAATCCAGACAGAGCTGC
ACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGCC
TGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGCA
GCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACT
CGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAG
TGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCA
GCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATG
TGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTG
GCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCA
AAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTT
CAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGT
ACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACT
TCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGC
GAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGG
GCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGC
TGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGG
TCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAA
ATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGC
AGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCA
GGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTAC
GGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGC
TGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGAC
CTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCC
TGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAG
ACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGG
ACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGA
AGAACATTACTGAGGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCT
CTTGGGATCCTTGGATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGA
TGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAG
GACCAGGGACATGGGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGC
TGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGA
GGGCTGTGGGCAGGGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGG
AGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCA
GAATGTTTTGTTGTTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGAT
CGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTAT
ACTGACCTCTTCCCCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAAC
CATGACCTGAAACCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATT

>In-frame_YY1AP1_ENST00000535662_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_4533nt
GAAGAAACCTTCAGCCAAACAGCAGAAGGAGGTAGAGAAGGTTAAACCCCAGTGTAAGGAAGTTCATCAGACCCTGATTCTGGACCCAGC
ACAAAGGAAGAGACTCCAGCAGCAGATGCAGCAGAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCC
CAAGTTTCAGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAG
CCCTCATAAAACTGTCAAGAAGACTGCCAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATCCTGGCCACAAGCAAGGTTTTCAT
GTATCCAGAGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCCTCTTCACCAAGGCTGAGGACAACAAGTACCT
TCTAACCTGCAAGACTGCCCGCCAACTGACAGTGAGAATCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAAACCCGGGA
AAAGGAGAAGATGAAGGAAGCCAAGGATGCCCGCTATACCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTA
TGCCTGTAACAAGAGCATCACAGCCAAGGAAGCCCTCATCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGC
CAACTGTACCAAGGTCAAGCAGAAGCAACAGAAAGCGGCCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGAC
AACCATCCGGGAGCGGCCAAGCTCGGCCATCTACCCCTCCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTT
GTCTTTAGCCAAGAGTGTTTCTACCACCAACATTGCTGGACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTC
CACAGACTCCCTCAACATGCGGAACCGAACCCTATCCGTGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGA
CTTTGAGATGGATGAGAAGGACTTTGCAGCTGACTCTTGGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGAT
GAAGCAGCAAGATGTCATCTATGAGCTAATCCAGACAGAGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGG
GATGCTGGAAGAGCTACACTTGGAGCCAGGAGTGGTCCAGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCT
CAGCCAGCTATTAGAACGCCGACGCCAGGCCCTGTGCCCTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAG
CCAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGACCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGA
GCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCCGGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCAT
CCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTACTCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGA
CCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGTCCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGA
GATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAGTGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCAT
CCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGCGCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCA
GGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACAAGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCA
GGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTGAGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCG
GGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGGAGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAA
GATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGCTGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGA
AGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGCCCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCT
GCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAGACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGC
CCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTCCTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACT
CTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAAATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAA
TCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGGCCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCG
GGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGGCTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACT
GGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGGAGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAG
CCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGGCACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGG
CCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCCGCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTA
CTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTGACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGA
CCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGCTGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCG
TCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAATGCAGGACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGGCTGTAGCCTC
CGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCCCACTGAAGAACATTACTGAGGGGGCTAACCTTGGGGACTCCAATTTGCCAAT
GATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTGCCAGCTCTTGGGATCCTTGGATACCTGGGGCCATTTAAGAAGCTAGGGGAAT
TAGGCCACAACACCCCCTGGGACATCCGAAAGCTACACCACAGATGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGGAAAATTTATT
TATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGATTTAAAGGACCAGGGACATGGGAACCAAGCCATAGGGATCAGAGGGCCTTGTC
CTTGAACACTACTGGGGTATATTCAGGCTCATCCACGCAGCTGCTGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATCCGTCTTGGAG
GAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAATAAAGGAGGGCTGTGGGCAGGGCCATGTCCCTTTCTCCTCTCCCCTCAACCTC
TTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGCCCTGGGAGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGC
CATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAGGGACCAGAATGTTTTGTTGTTCTTTTGTTTTCTTTTTTGTACCAAAGTCAAC
TGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATTAGAGATCGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGG
AGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGGACCTATACTGACCTCTTCCCCAGCCATTTAGAAACAAGTTCTAGGGTGGGTT
GGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTCAGCAACCATGACCTGAAACCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAA
CCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGAAGAATTTTCTTCTTGCCAATTTTGTTGTTTAAAAAAAAAATTCAGGGAAAAT

>In-frame_YY1AP1_ENST00000405763_chr1_155638418_-_ARHGEF2_ENST00000368315_chr1_155939091_-_5305nt
GTGCGCGCTACATGGCCGGAGTCGGGCGAAGCGGGGGACCGTGGGGAAGAACGCGAGGAGGGAGGAGTGGGAGGTTGGGGGTGTCGCTAG
GCGCCCTTAGCTCCCTCCCTCTGGAGGAGCTGCCGCGGCCACTCTGCTGCCGCCGCTGCCGCCGCCATTTTGGGTTCGCTTTGCGAGGGG
AAACGATCCCAGTGTCGGTTGCGGGATCCGCCTCCTCTCAGTTTGCCCCTTTAGCCCTCCACCTTTCCCTTCTCCTCTCTCGCATTTCCG
CCAGTCGGCTTACCCGCTGGCCGCCTCCTGACAAGCGGGAGGGATCCGCGGTGGACCCAGGGAAGCGGAGGAGCCTGGCGGCCACCCCCT
CTTCCTCACTTCCCTGTACTCTCATCGCTCTCGGCCTCCGACACGAAAAGGAAGCAAATGAGCTGATGGAAGATCTGTTTGAAACTTTCC
AAGATGAGATGGGATTCTCCAACATGGAAGATGATGGCCCAGAAGAGGAGGAGCGTGTGGCTGAGCCTCAAGCTAACTTTAACACCCCTC
AAGCTCTACGGTTTGAGGAACTACTGGCCAACCTACTAAATGAACAACATCAGATAGCGAAGGAACTATTTGAACAGCTGAAGATGAAGA
AACCTTCAGCCAAACAGCAGAAGGAGGTAGAGAAGGTTAAACCCCAGTGTAAGGAAGTTCATCAGACCCTGATTCTGGACCCAGCACAAA
GGAAGAGACTCCAGCAGCAGATGCAGCAGCATGTTCAGCTCTTGACACAAATCCACCTTCTTGCCACCTGCAACCCCAATCTCAATCCGG
AGGCCAGTAGCACCAGGATATGTCTTAAAGAGCTGGGAACCTTTGCTCAAAGCTCCATCGCCCTTCACCATCAGTACAACCCCAAGTTTC
AGACCCTGTTCCAACCCTGTAACTTGATGGGAGCTATGCAGCTGATTGAAGACTTCAGCACACATGTCAGCATTGACTGCAGCCCTCATA
AAACTGTCAAGAAGACTGCCAATGAATTTCCCTGTTTGCCAAAGCAAGTGGCTTGGATCCTGGCCACAAGCAAGGTTTTCATGTATCCAG
AGTTACTTCCAGTGTGTTCCCTGAAGGCAAAGAATCCCCAGGATAAGATCCTCTTCACCAAGGCTGAGGACAATTTGTTAGCTTTAGGAC
TGAAGCATTTTGAAGGGACTGAGTTTCTTAACCCTCTAATCAGCAAGTACCTTCTAACCTGCAAGACTGCCCGCCAACTGACAGTGAGAA
TCAAGAACCTCAACATGAACAGAGCTCCTGACAACATCATTAAAACCCGGGAAAAGGAGAAGATGAAGGAAGCCAAGGATGCCCGCTATA
CCAATGGGCACCTCTTCACCACCATTTCAGTTTCAGGCATGACCATGTGCTATGCCTGTAACAAGAGCATCACAGCCAAGGAAGCCCTCA
TCTGCCCAACCTGCAATGTGACTATCCACAACCGCTGTAAAGACACCCTCGCCAACTGTACCAAGGTCAAGCAGAAGCAACAGAAAGCGG
CCCTGCTGAAGAACAACACCGCCTTGCAGTCCGTTTCTCTTCGAAGTAAGACAACCATCCGGGAGCGGCCAAGCTCGGCCATCTACCCCT
CCGACAGCTTCCGGCAGTCCCTCCTGGGCTCCCGCCGTGGCCGCTCCTCCTTGTCTTTAGCCAAGAGTGTTTCTACCACCAACATTGCTG
GACATTTCAATGATGAGTCTCCCCTGGGGCTGCGCCGGATCCTCTCACAGTCCACAGACTCCCTCAACATGCGGAACCGAACCCTATCCG
TGGAATCCCTCATTGACGAAGCAGAGGTAATCTACAGTGAGCTGATGAGTGACTTTGAGATGGATGAGAAGGACTTTGCAGCTGACTCTT
GGAGTCTTGCTGTGGACAGCAGCTTCCTGCAGCAGCATAAAAAGGAGGTGATGAAGCAGCAAGATGTCATCTATGAGCTAATCCAGACAG
AGCTGCACCATGTGAGGACACTGAAGATCATGACCCGCCTCTTCCGCACGGGGATGCTGGAAGAGCTACACTTGGAGCCAGGAGTGGTCC
AGGGCCTGTTCCCCTGCGTGGACGAGCTCAGTGACATCCATACACGCTTCCTCAGCCAGCTATTAGAACGCCGACGCCAGGCCCTGTGCC
CTGGCAGCACCCGGAACTTTGTCATCCATCGCTTGGGTGATCTGCTCATCAGCCAGTTCTCAGGTCCTAGTGCGGAGCAGATGTGTAAGA
CCTACTCGGAGTTCTGCAGCCGCCACAGCAAGGCCTTAAAGCTCTATAAGGAGCTGTACGCCCGAGACAAACGCTTCCAGCAATTCATCC
GGAAAGTGACCCGCCCCGCCGTGCTCAAGCGGCACGGGGTACAGGAGTGCATCCTGCTGGTGACTCAGCGCATCACCAAGTACCCGTTAC
TCATCAGCCGCATCCTGCAGCATTCCCACGGGATCGAGGAGGAGCGCCAGGACCTGACCACAGCACTGGGGCTAGTGAAGGAGCTGCTGT
CCAATGTGGACGAGGGTATTTATCAGCTGGAGAAAGGGGCCCGTCTGCAGGAGATCTACAACCGCATGGACCCTCGGGCCCAAACCCCAG
TGCCTGGCAAGGGCCCCTTTGGCCGAGAGGAACTTCTGAGGCGCAAACTCATCCACGATGGCTGCCTGCTCTGGAAGACAGCGACGGGGC
GCTTCAAAGATGTGCTAGTGCTGCTGATGACAGATGTACTGGTGTTTCTCCAGGAAAAGGACCAGAAGTACATCTTTCCTACCCTGGACA
AGCCTTCAGTGGTATCGCTGCAGAATCTAATCGTACGAGACATTGCCAACCAGGAGAAAGGGATGTTTCTGATCAGCGCAGCCCCACCTG
AGATGTACGAGGTGCACACAGCATCCCGGGATGACCGGAGCACCTGGATCCGGGTCATTCAGCAGAGCGTGCGCACATGCCCATCCAGGG
AGGACTTCCCCCTGATTGAGACAGAGGATGAGGCTTACCTGCGGCGAATTAAGATGGAGTTGCAGCAGAAGGACCGGGCACTGGTGGAGC
TGCTGCGAGAGAAGGTCGGGCTGTTTGCTGAGATGACCCATTTCCAGGCCGAAGAGGATGGTGGCAGTGGGATGGCCCTGCCCACCCTGC
CCAGGGGCCTTTTCCGCTCTGAGTCCCTTGAGTCCCCTCGTGGCGAGCGGCTGCTGCAGGATGCCATCCGTGAGGTGGAGGGTCTGAAAG
ACCTGCTGGTGGGGCCAGGAGTGGAACTGCTCTTGACACCCCGAGAGCCAGCCCTGCCCTTGGAACCAGACAGCGGTGGTAACACGAGTC
CTGGGGTCACTGCCAATGGTGAGGCCAGAACCTTCAATGGCTCCATTGAACTCTGCAGAGCTGACTCAGACTCTAGCCAGAGGGATCGAA
ATGGAAATCAGCTGAGATCACCGCAAGAGGAGGCGTTACAGCGATTGGTCAATCTCTATGGACTTCTACATGGCCTACAGGCAGCTGTGG
CCCAGCAGGACACTCTGATGGAAGCCCGGTTCCCTGAGGGCCCTGAGCGGCGGGAGAAGCTGTGCCGAGCCAACTCTCGGGATGGGGAGG
CTGGCAGGGCTGGGGCTGCCCCTGTGGCCCCTGAAAAGCAGGCCACGGAACTGGCATTACTGCAGCGGCAACATGCGCTGCTGCAGGAGG
AGCTACGGCGCTGCCGGCGGCTAGGTGAAGAACGGGCAACCGAAGCTGGCAGCCTGGAGGCCCGGCTCCGGGAGAGTGAGCAGGCCCGGG
CACTGCTGGAGCGTGAGGCCGAAGAGGCTCGAAGGCAGCTGGCCGCCCTGGGCCAGACCGAGCCACTCCCAGCTGAGGCCCCCTGGGCCC
GCAGACCTGTGGATCCTCGGCGGCGCAGCCTCCCCGCAGGCGATGCCCTGTACTTGAGTTTCAACCCCCCACAGCCCAGCCGAGGCACTG
ACCGCCTGGATCTACCTGTCACTACTCGCTCTGTCCATCGAAACTTTGAGGACCGAGAGAGGCAGGAACTGGGGAGCCCCGAAGAGCGGC
TGCAAGACAGCAGTGACCCTGACACTGGCAGCGAGGAGGAAGGTAGCAGCCGTCTGTCTCCGCCCCACAGTCCACGAGACTTTACCAGAA
TGCAGGACATCCCGGAGGAGACGGAGAGCCGCGACGGGGAGGCTGTAGCCTCCGAGAGCTAAGGGGGCCCCTCCCCCCTGCCCCGTGCCC
CACTGAAGAACATTACTGAGGGGGCTAACCTTGGGGACTCCAATTTGCCAATGATGAGGGAACATTTGAAAGAACTGCAAATTGTCCTTG
CCAGCTCTTGGGATCCTTGGATACCTGGGGCCATTTAAGAAGCTAGGGGAATTAGGCCACAACACCCCCTGGGACATCCGAAAGCTACAC
CACAGATGCCAGTGGTTCATGCCTTCTTCCCGCAACTTTAGGAAAATTTATTTATTTATTGTTTATTAGTTATGGGGGGAGAGGGGAGAT
TTAAAGGACCAGGGACATGGGAACCAAGCCATAGGGATCAGAGGGCCTTGTCCTTGAACACTACTGGGGTATATTCAGGCTCATCCACGC
AGCTGCTGGGTTCTTGCCCTAACGGCCCTCCCCTGCAACATCCGTCTTGGAGGAGAGGCTGCAGCCACAGCACCCTACTGCCCTTTAAAT
AAAGGAGGGCTGTGGGCAGGGCCATGTCCCTTTCTCCTCTCCCCTCAACCTCTTACTGCTGTTCTCCCTTTCTCCGTCCTTCATGGAAGC
CCTGGGAGATAACCTGGCTTCCTGGAGTTGATGGAATAAAGGTTGGGGTGGCCATAATGGTTTGTTGGGGGTGAGGGAAAAAACCCACAG
GGACCAGAATGTTTTGTTGTTCTTTTGTTTTCTTTTTTGTACCAAAGTCAACTGCACGTGTTTTATATTTTTAAGAGATCGTAGGCAATT
AGAGATCGAAGCCTCCTATCTCCACATCTCTGAAGAAGTTGAGGGGTGGGGGAGAGAATGACTTCTGCCTTCATCTGCAGTAACGGGGGG
ACCTATACTGACCTCTTCCCCAGCCATTTAGAAACAAGTTCTAGGGTGGGTTGGAAAATCTCCAAGAGCCCTGACCTCATCTTCCACCTC
AGCAACCATGACCTGAAACCTCAGCGTGAATTTGGGGGATTTTTCAGTGGAACCCTTGCCCCCAAATGTCGACCAGCCCCCAAATGTCGA


Top

FusionGenePPI for YY1AP1_ARHGEF2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
YY1AP1EWSR1, MAPK14, MAPK8IP2, VHL, MAD2L2, ATXN1, ATXN1L, SMURF1, CEBPA, ZFAT, MDM2, PRKAB2, FBL, LUC7L, ZNF524, SS18L2, CLEC3A, NEUROG3, PRR20E, CDC16, ZNF579, BAG1, ZNF496, HIC2, DCAF12, CEBPZ, ZMYM4, B3GALNT2, TRIM25ARHGEF2MYC, PAK1, YWHAQ, RAC1, RHOA, PLCG1, MARK2, TAF10, MAPK1, YWHAG, MARK4, YWHAH, ELAVL1, USP21, YWHAZ, NOTCH1, VCP, PEX14, MMS19, FBXO6, ANKRD28, PPP6C, PPP6R1, YWHAB, RPA3, RPA2, RPA1, CEP250, RPP25L, MOV10, NXF1, CCDC8, EGFR, WDR83, FGL1, NTRK1, COPS7A, KLC2, PRDX1, PSME3, CEP170, CNTRL, SCLT1, DCTN1, PPP2R1A, FOXO3, SNW1, CDC5L, PPP2CA, PPP2CB, PAK7, UBE2A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for YY1AP1_ARHGEF2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for YY1AP1_ARHGEF2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource