FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42314

FusionGeneSummary for YEATS4_AGAP2

check button Fusion gene summary
Fusion gene informationFusion gene name: YEATS4_AGAP2
Fusion gene ID: 42314
HgeneTgene
Gene symbol

YEATS4

AGAP2

Gene ID

8089

116986

Gene nameYEATS domain containing 4ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
Synonyms4930573H17Rik|B230215M10Rik|GAS41|NUBI-1|YAF9CENTG1|GGAP2|PIKE
Cytomap

12q15

12q14.1

Type of geneprotein-codingprotein-coding
DescriptionYEATS domain-containing protein 4NuMA binding protein 1glioma-amplified sequence 41nuBI1arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2Arf GAP with GTP-binding protein-like, ANK repeat and PH domains 2GTP-binding and GTPase activating protein 2centaurin, gamma 1cnt-g1phosphatidylinositol 3-kinase enhancerphosphoinosi
Modification date2018051920180523
UniProtAcc

O95619

Q99490

Ensembl transtripts involved in fusion geneENST00000247843, ENST00000548020, 
ENST00000257897, ENST00000547588, 
Fusion gene scores* DoF score13 X 4 X 8=4165 X 4 X 2=40
# samples 145
** MAII scorelog2(14/416*10)=-1.57115670119613
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/40*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: YEATS4 [Title/Abstract] AND AGAP2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneYEATS4

GO:0043967

histone H4 acetylation

14966270

HgeneYEATS4

GO:0043968

histone H2A acetylation

14966270

TgeneAGAP2

GO:0042177

negative regulation of protein catabolic process

18374643


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-DX-A2IZ-01AYEATS4chr12

69759664

+AGAP2chr12

58127956

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000247843ENST00000257897YEATS4chr12

69759664

+AGAP2chr12

58127956

-
In-frameENST00000247843ENST00000547588YEATS4chr12

69759664

+AGAP2chr12

58127956

-
intron-3CDSENST00000548020ENST00000257897YEATS4chr12

69759664

+AGAP2chr12

58127956

-
intron-3CDSENST00000548020ENST00000547588YEATS4chr12

69759664

+AGAP2chr12

58127956

-

Top

FusionProtFeatures for YEATS4_AGAP2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
YEATS4

O95619

AGAP2

Q99490

Component of the NuA4 histone acetyltransferase (HAT)complex which is involved in transcriptional activation of selectgenes principally by acetylation of nucleosomal histones H4 andH2A. This modification may both alter nucleosome - DNAinteractions and promote interaction of the modified histones withother proteins which positively regulate transcription. Thiscomplex may be required for the activation of transcriptionalprograms associated with oncogene and proto-oncogene mediatedgrowth induction, tumor suppressor mediated growth arrest andreplicative senescence, apoptosis, and DNA repair. NuA4 may alsoplay a direct role in DNA repair when recruited to sites of DNAdamage. {ECO:0000269|PubMed:14966270}. GTPase-activating protein (GAP) for ARF1 and ARF5, whichalso shows strong GTPase activity. Isoform 1 participates in theprevention of neuronal apoptosis by enhancing PI3 kinase activity.It aids the coupling of metabotropic glutamate receptor 1 (GRM1)to cytoplasmic PI3 kinase by interacting with Homer scaffoldingproteins, and also seems to mediate anti-apoptotic effects of NGFby activating nuclear PI3 kinase. Isoform 2 does not stimulate PI3kinase but may protect cells from apoptosis by stimulating Akt. Italso regulates the adapter protein 1 (AP-1)-dependent traffickingof proteins in the endosomal system. It seems to be oncogenic. Itis overexpressed in cancer cells, prevents apoptosis and promotescancer cell invasion. {ECO:0000269|PubMed:12640130,ECO:0000269|PubMed:14761976, ECO:0000269|PubMed:15118108,ECO:0000269|PubMed:16079295}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneAGAP2chr12:69759664chr12:58127956ENST00000257897-318676_910131837DomainPH
TgeneAGAP2chr12:69759664chr12:58127956ENST00000257897-318931_1051131837DomainArf-GAP
TgeneAGAP2chr12:69759664chr12:58127956ENST00000257897-318413_420131837Nucleotide bindingGTP
TgeneAGAP2chr12:69759664chr12:58127956ENST00000257897-318457_461131837Nucleotide bindingGTP
TgeneAGAP2chr12:69759664chr12:58127956ENST00000257897-318515_518131837Nucleotide bindingGTP
TgeneAGAP2chr12:69759664chr12:58127956ENST00000257897-318405_572131837RegionNote=G domain
TgeneAGAP2chr12:69759664chr12:58127956ENST00000257897-3181090_1119131837RepeatNote=ANK 1
TgeneAGAP2chr12:69759664chr12:58127956ENST00000257897-3181123_1152131837RepeatNote=ANK 2
TgeneAGAP2chr12:69759664chr12:58127956ENST00000257897-318946_969131837Zinc fingerC4-type

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneYEATS4chr12:69759664chr12:58127956ENST00000247843+47178_226111228Coiled coilOntology_term=ECO:0000255
HgeneYEATS4chr12:69759664chr12:58127956ENST00000247843+4722_126111228DomainYEATS


Top

FusionGeneSequence for YEATS4_AGAP2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_YEATS4_ENST00000247843_chr12_69759664_+_AGAP2_ENST00000257897_chr12_58127956_-_817aa
MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARTFGKKREEDGHTHQWTVTVKPTRNEDMSATVKKIQFKLHESTGNPLRVVTKPPTEITE
TGWGEFEIIIKIFFIDPNERPFSGWADAVIFVFSLEDENSFQAVSRLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALC
ADMKRCSYTETCATTGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAE
AAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKTVTLSSNGFLLYHPSIND
YIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGLEATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARA
LSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKTEGSAGQAEEENFEFLIVSSTGQTWHFEAASFEERDAWVQAIESQILASLQCC
ESSKVKLRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTLVLTAIGNDT
ANRVWESDTRGRAKPSRDSSREERESWIRAKYEQLLFLAPLSTSEEPLGRQLWAAVQAQDVATVLLLLAHARHGPLDTSVEDPQLRSPLH
LAAELAHVVITQLLLWYGADVAARDAQGRTALFYARQAGSQLCADILLQHGCPGEGGSAATTPSAATTPSITATPSPRRRSSAASVGRAD

>In-frame_YEATS4_ENST00000247843_chr12_69759664_+_AGAP2_ENST00000547588_chr12_58127956_-_837aa
MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARTFGKKREEDGHTHQWTVTVKPTRNEDMSATVKKIQFKLHESTGNPLRVVTKPPTEITE
TGWGEFEIIIKIFFIDPNERPFSGWADAVIFVFSLEDENSFQAVSRLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALC
ADMKRCSYTETCATTGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAE
AAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKTVTLSSNGFLLYHPSIND
YIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGLEATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARA
LSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKTEGSAGQAEAKRKMWKLKSFGSLRNITKAEENFEFLIVSSTGQTWHFEAASFE
ERDAWVQAIESQILASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSL
DLDDWPRELTLVLTAIGNDTANRVWESDTRGRAKPSRDSSREERESWIRAKYEQLLFLAPLSTSEEPLGRQLWAAVQAQDVATVLLLLAH
ARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQGRTALFYARQAGSQLCADILLQHGCPGEGGSAATTPSAATTPS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_YEATS4_ENST00000247843_chr12_69759664_+_AGAP2_ENST00000257897_chr12_58127956_-_2451nt
ATGTTCAAGAGAATGGCCGAATTTGGGCCTGACTCCGGCGGGAGAGTAAAGGGTGTTACTATCGTTAAACCAATAGTTTACGGTAATGTT
GCTCGGTATTTTGGAAAGAAAAGAGAAGAAGATGGGCACACTCATCAGTGGACAGTATATGTGAAACCATATAGAAATGAGGATATGTCA
GCATATGTGAAGAAAATCCAGTTTAAATTACATGAAAGCTATGGCAATCCTTTAAGAGTTGTTACTAAACCTCCATATGAAATTACTGAA
ACAGGATGGGGTGAATTCGAAATAATCATCAAAATATTTTTCATTGACCCTAATGAAAGACCTTTCTCAGGCTGGGCAGATGCTGTGATC
TTCGTCTTCAGCCTGGAGGATGAGAACAGTTTCCAGGCTGTGAGCCGTCTCCATGGGCAGCTGAGTTCCCTTCGCGGGGAGGGACGAGGA
GGCCTGGCCTTGGCACTGGTGGGGACACAAGACAGGATCAGTGCTTCCTCCCCTCGGGTGGTGGGAGATGCTCGTGCCAGAGCTCTGTGC
GCGGACATGAAACGCTGCAGCTACTATGAGACTTGTGCAACCTATGGGCTCAATGTGGATCGGGTCTTCCAGGAGGTGGCCCAGAAGGTG
GTGACCTTGCGCAAGCAGCAACAGCTTCTGGCTGCCTGCAAGTCCCTGCCCAGCTCCCCAAGCCACTCAGCTGCATCCACTCCGGTAGCT
GGCCAGGCTAGTAACGGGGGCCACACTAGCGACTACTCTTCTTCCCTCCCGTCCTCACCGAATGTTGGTCACCGGGAGCTCCGAGCCGAG
GCAGCTGCAGTGGCTGGATTGAGCACCCCAGGGTCCCTGCACCGGGCAGCCAAGCGCAGGACCAGCCTTTTTGCGAATCGTCGGGGTAGT
GACTCCGAGAAACGAAGCTTGGATAGTCGGGGAGAGACAACAGGGAGTGGGCGAGCCATCCCCATCAAACAGAGCTTCCTACTAAAACGA
AGTGGCAATTCCTTGAACAAAGAATGGAAGAAGAAATATGTAACCCTGTCCAGTAATGGCTTTCTACTCTACCACCCCAGTATTAACGAT
TACATCCACAGTACCCACGGCAAGGAGATGGACTTGCTGCGAACAACAGTCAAAGTCCCGGGCAAGCGGCCCCCGAGGGCCATCTCTGCC
TTTGGCCCCTCAGCCAGCATTAACGGGCTCGTCAAGGACATGAGCACTGTCCAGATGGGTGAAGGCCTGGAAGCCACTACTCCCATGCCA
AGCCCTAGCCCCAGCCCCAGTTCCCTGCAGCCACCACCAGATCAGACATCCAAACACCTGCTGAAGCCAGACCGGAATTTGGCCCGAGCC
CTCAGCACGGACTGTACCCCATCTGGAGACCTGAGCCCCCTGAGTCGGGAACCCCCTCCTTCTCCCATGGTGAAGAAGCAGAGGAGGAAA
AAATTGACAACACCATCCAAGACTGAAGGCTCGGCTGGGCAGGCTGAAGAGGAAAACTTTGAGTTCCTGATCGTGTCCAGCACGGGTCAG
ACGTGGCACTTTGAGGCAGCCAGTTTTGAGGAGCGGGATGCCTGGGTCCAGGCCATCGAGAGTCAGATCCTAGCCAGTCTGCAATGCTGT
GAGAGCAGCAAGGTCAAGCTGCGCACAGACAGCCAAAGCGAGGCCGTGGCCATCCAGGCGATCCGGAACGCCAAGGGGAATTCAATCTGC
GTGGACTGCGGGGCCCCCAACCCCACGTGGGCCAGCTTGAACCTGGGCGCCCTCATCTGCATCGAGTGTTCTGGCATCCACCGCAACCTG
GGCACACACCTGTCCCGCGTTCGCTCGCTGGACTTGGACGACTGGCCACGGGAGCTGACCCTGGTGCTGACGGCTATTGGCAACGACACG
GCCAACCGCGTGTGGGAAAGCGACACGCGAGGCCGTGCCAAGCCCTCGCGGGACTCTTCGCGGGAGGAGCGCGAGTCGTGGATTCGCGCC
AAGTACGAGCAGCTACTGTTCCTGGCGCCGCTGAGCACCTCGGAGGAGCCGCTGGGCCGCCAGCTGTGGGCCGCCGTGCAGGCCCAGGAC
GTGGCTACCGTTCTCCTGCTTTTGGCCCATGCGCGACACGGGCCGCTCGACACCAGCGTAGAGGACCCACAGCTGCGCTCCCCACTCCAC
CTGGCGGCCGAGCTCGCCCACGTCGTCATCACGCAACTGCTGCTGTGGTACGGCGCGGACGTGGCGGCCCGTGACGCCCAGGGCCGCACG
GCGCTGTTCTACGCCCGCCAGGCTGGAAGCCAGCTGTGCGCCGACATCCTTCTCCAGCACGGCTGCCCGGGTGAGGGCGGCAGCGCGGCC
ACCACGCCCAGCGCGGCCACCACGCCCAGCATCACCGCCACGCCCAGCCCCCGCCGCCGGAGCAGCGCCGCTAGCGTGGGCCGCGCCGAC

>In-frame_YEATS4_ENST00000247843_chr12_69759664_+_AGAP2_ENST00000547588_chr12_58127956_-_2511nt
ATGTTCAAGAGAATGGCCGAATTTGGGCCTGACTCCGGCGGGAGAGTAAAGGGTGTTACTATCGTTAAACCAATAGTTTACGGTAATGTT
GCTCGGTATTTTGGAAAGAAAAGAGAAGAAGATGGGCACACTCATCAGTGGACAGTATATGTGAAACCATATAGAAATGAGGATATGTCA
GCATATGTGAAGAAAATCCAGTTTAAATTACATGAAAGCTATGGCAATCCTTTAAGAGTTGTTACTAAACCTCCATATGAAATTACTGAA
ACAGGATGGGGTGAATTCGAAATAATCATCAAAATATTTTTCATTGACCCTAATGAAAGACCTTTCTCAGGCTGGGCAGATGCTGTGATC
TTCGTCTTCAGCCTGGAGGATGAGAACAGTTTCCAGGCTGTGAGCCGTCTCCATGGGCAGCTGAGTTCCCTTCGCGGGGAGGGACGAGGA
GGCCTGGCCTTGGCACTGGTGGGGACACAAGACAGGATCAGTGCTTCCTCCCCTCGGGTGGTGGGAGATGCTCGTGCCAGAGCTCTGTGC
GCGGACATGAAACGCTGCAGCTACTATGAGACTTGTGCAACCTATGGGCTCAATGTGGATCGGGTCTTCCAGGAGGTGGCCCAGAAGGTG
GTGACCTTGCGCAAGCAGCAACAGCTTCTGGCTGCCTGCAAGTCCCTGCCCAGCTCCCCAAGCCACTCAGCTGCATCCACTCCGGTAGCT
GGCCAGGCTAGTAACGGGGGCCACACTAGCGACTACTCTTCTTCCCTCCCGTCCTCACCGAATGTTGGTCACCGGGAGCTCCGAGCCGAG
GCAGCTGCAGTGGCTGGATTGAGCACCCCAGGGTCCCTGCACCGGGCAGCCAAGCGCAGGACCAGCCTTTTTGCGAATCGTCGGGGTAGT
GACTCCGAGAAACGAAGCTTGGATAGTCGGGGAGAGACAACAGGGAGTGGGCGAGCCATCCCCATCAAACAGAGCTTCCTACTAAAACGA
AGTGGCAATTCCTTGAACAAAGAATGGAAGAAGAAATATGTAACCCTGTCCAGTAATGGCTTTCTACTCTACCACCCCAGTATTAACGAT
TACATCCACAGTACCCACGGCAAGGAGATGGACTTGCTGCGAACAACAGTCAAAGTCCCGGGCAAGCGGCCCCCGAGGGCCATCTCTGCC
TTTGGCCCCTCAGCCAGCATTAACGGGCTCGTCAAGGACATGAGCACTGTCCAGATGGGTGAAGGCCTGGAAGCCACTACTCCCATGCCA
AGCCCTAGCCCCAGCCCCAGTTCCCTGCAGCCACCACCAGATCAGACATCCAAACACCTGCTGAAGCCAGACCGGAATTTGGCCCGAGCC
CTCAGCACGGACTGTACCCCATCTGGAGACCTGAGCCCCCTGAGTCGGGAACCCCCTCCTTCTCCCATGGTGAAGAAGCAGAGGAGGAAA
AAATTGACAACACCATCCAAGACTGAAGGCTCGGCTGGGCAGGCTGAAGCCAAGCGCAAAATGTGGAAACTAAAATCCTTTGGTAGTTTA
AGAAATATTTATAAAGCAGAGGAAAACTTTGAGTTCCTGATCGTGTCCAGCACGGGTCAGACGTGGCACTTTGAGGCAGCCAGTTTTGAG
GAGCGGGATGCCTGGGTCCAGGCCATCGAGAGTCAGATCCTAGCCAGTCTGCAATGCTGTGAGAGCAGCAAGGTCAAGCTGCGCACAGAC
AGCCAAAGCGAGGCCGTGGCCATCCAGGCGATCCGGAACGCCAAGGGGAATTCAATCTGCGTGGACTGCGGGGCCCCCAACCCCACGTGG
GCCAGCTTGAACCTGGGCGCCCTCATCTGCATCGAGTGTTCTGGCATCCACCGCAACCTGGGCACACACCTGTCCCGCGTTCGCTCGCTG
GACTTGGACGACTGGCCACGGGAGCTGACCCTGGTGCTGACGGCTATTGGCAACGACACGGCCAACCGCGTGTGGGAAAGCGACACGCGA
GGCCGTGCCAAGCCCTCGCGGGACTCTTCGCGGGAGGAGCGCGAGTCGTGGATTCGCGCCAAGTACGAGCAGCTACTGTTCCTGGCGCCG
CTGAGCACCTCGGAGGAGCCGCTGGGCCGCCAGCTGTGGGCCGCCGTGCAGGCCCAGGACGTGGCTACCGTTCTCCTGCTTTTGGCCCAT
GCGCGACACGGGCCGCTCGACACCAGCGTAGAGGACCCACAGCTGCGCTCCCCACTCCACCTGGCGGCCGAGCTCGCCCACGTCGTCATC
ACGCAACTGCTGCTGTGGTACGGCGCGGACGTGGCGGCCCGTGACGCCCAGGGCCGCACGGCGCTGTTCTACGCCCGCCAGGCTGGAAGC
CAGCTGTGCGCCGACATCCTTCTCCAGCACGGCTGCCCGGGTGAGGGCGGCAGCGCGGCCACCACGCCCAGCGCGGCCACCACGCCCAGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_YEATS4_ENST00000247843_chr12_69759664_+_AGAP2_ENST00000257897_chr12_58127956_-_4062nt
CGCGAGCCCGTTGCGCCTGCGCGCGGTGCGGCCGTCGCCCCTCTTTTCGCGGCGTTCTCCACCTGCGCGGGCCTGAATGGCCTTCAGGAG
CACAGTCGGCCTGAGGAGTTGACGGTTACTCACCGCCGTGAGCCCAAGTAACTCGCCCTCCTTCGGCTAGAAACCCTCCGCCTGGGCCCG
CGCGACAGGAGCGCGGTCTCTGAGGGGAGCGGCGACCCCGCCAGCCCCGGTCTCTTTCCCTGGCGGCGGCGGCTTCTTCCGTGGGACAAT
ATGTTCAAGAGAATGGCCGAATTTGGGCCTGACTCCGGCGGGAGAGTAAAGGGTGTTACTATCGTTAAACCAATAGTTTACGGTAATGTT
GCTCGGTATTTTGGAAAGAAAAGAGAAGAAGATGGGCACACTCATCAGTGGACAGTATATGTGAAACCATATAGAAATGAGGATATGTCA
GCATATGTGAAGAAAATCCAGTTTAAATTACATGAAAGCTATGGCAATCCTTTAAGAGTTGTTACTAAACCTCCATATGAAATTACTGAA
ACAGGATGGGGTGAATTCGAAATAATCATCAAAATATTTTTCATTGACCCTAATGAAAGACCTTTCTCAGGCTGGGCAGATGCTGTGATC
TTCGTCTTCAGCCTGGAGGATGAGAACAGTTTCCAGGCTGTGAGCCGTCTCCATGGGCAGCTGAGTTCCCTTCGCGGGGAGGGACGAGGA
GGCCTGGCCTTGGCACTGGTGGGGACACAAGACAGGATCAGTGCTTCCTCCCCTCGGGTGGTGGGAGATGCTCGTGCCAGAGCTCTGTGC
GCGGACATGAAACGCTGCAGCTACTATGAGACTTGTGCAACCTATGGGCTCAATGTGGATCGGGTCTTCCAGGAGGTGGCCCAGAAGGTG
GTGACCTTGCGCAAGCAGCAACAGCTTCTGGCTGCCTGCAAGTCCCTGCCCAGCTCCCCAAGCCACTCAGCTGCATCCACTCCGGTAGCT
GGCCAGGCTAGTAACGGGGGCCACACTAGCGACTACTCTTCTTCCCTCCCGTCCTCACCGAATGTTGGTCACCGGGAGCTCCGAGCCGAG
GCAGCTGCAGTGGCTGGATTGAGCACCCCAGGGTCCCTGCACCGGGCAGCCAAGCGCAGGACCAGCCTTTTTGCGAATCGTCGGGGTAGT
GACTCCGAGAAACGAAGCTTGGATAGTCGGGGAGAGACAACAGGGAGTGGGCGAGCCATCCCCATCAAACAGAGCTTCCTACTAAAACGA
AGTGGCAATTCCTTGAACAAAGAATGGAAGAAGAAATATGTAACCCTGTCCAGTAATGGCTTTCTACTCTACCACCCCAGTATTAACGAT
TACATCCACAGTACCCACGGCAAGGAGATGGACTTGCTGCGAACAACAGTCAAAGTCCCGGGCAAGCGGCCCCCGAGGGCCATCTCTGCC
TTTGGCCCCTCAGCCAGCATTAACGGGCTCGTCAAGGACATGAGCACTGTCCAGATGGGTGAAGGCCTGGAAGCCACTACTCCCATGCCA
AGCCCTAGCCCCAGCCCCAGTTCCCTGCAGCCACCACCAGATCAGACATCCAAACACCTGCTGAAGCCAGACCGGAATTTGGCCCGAGCC
CTCAGCACGGACTGTACCCCATCTGGAGACCTGAGCCCCCTGAGTCGGGAACCCCCTCCTTCTCCCATGGTGAAGAAGCAGAGGAGGAAA
AAATTGACAACACCATCCAAGACTGAAGGCTCGGCTGGGCAGGCTGAAGAGGAAAACTTTGAGTTCCTGATCGTGTCCAGCACGGGTCAG
ACGTGGCACTTTGAGGCAGCCAGTTTTGAGGAGCGGGATGCCTGGGTCCAGGCCATCGAGAGTCAGATCCTAGCCAGTCTGCAATGCTGT
GAGAGCAGCAAGGTCAAGCTGCGCACAGACAGCCAAAGCGAGGCCGTGGCCATCCAGGCGATCCGGAACGCCAAGGGGAATTCAATCTGC
GTGGACTGCGGGGCCCCCAACCCCACGTGGGCCAGCTTGAACCTGGGCGCCCTCATCTGCATCGAGTGTTCTGGCATCCACCGCAACCTG
GGCACACACCTGTCCCGCGTTCGCTCGCTGGACTTGGACGACTGGCCACGGGAGCTGACCCTGGTGCTGACGGCTATTGGCAACGACACG
GCCAACCGCGTGTGGGAAAGCGACACGCGAGGCCGTGCCAAGCCCTCGCGGGACTCTTCGCGGGAGGAGCGCGAGTCGTGGATTCGCGCC
AAGTACGAGCAGCTACTGTTCCTGGCGCCGCTGAGCACCTCGGAGGAGCCGCTGGGCCGCCAGCTGTGGGCCGCCGTGCAGGCCCAGGAC
GTGGCTACCGTTCTCCTGCTTTTGGCCCATGCGCGACACGGGCCGCTCGACACCAGCGTAGAGGACCCACAGCTGCGCTCCCCACTCCAC
CTGGCGGCCGAGCTCGCCCACGTCGTCATCACGCAACTGCTGCTGTGGTACGGCGCGGACGTGGCGGCCCGTGACGCCCAGGGCCGCACG
GCGCTGTTCTACGCCCGCCAGGCTGGAAGCCAGCTGTGCGCCGACATCCTTCTCCAGCACGGCTGCCCGGGTGAGGGCGGCAGCGCGGCC
ACCACGCCCAGCGCGGCCACCACGCCCAGCATCACCGCCACGCCCAGCCCCCGCCGCCGGAGCAGCGCCGCTAGCGTGGGCCGCGCCGAC
GCCCCGGTTGCGCTGGTATAGTTGCCCAGCGGGAGAGACACCCCCATCCCCACGCGGGCCGGGCACGACCACACCGGGCGGACCGCTGGA
CAGACGCACCCACTCACCTCTCCGATCCGCACCCCGCCCCACGGGAGCACTTCCTACCCCCACGAGGGCACAGCCCCCACGCCTTCCAGA
AGACACAAACTCACCTCCCTCTCCCCAACGAGGCATGGAGACCCCAGCTCAACACGCCCCCTCTCCATTGTTTCCACACTCGGATTGCTC
TGGGTCTACCCGCTCGGGGTTCGCGGAAGGGGAGGTCCCCAGCGGTACGGGCTCCTAGGCGCTTGGACATGCCCGCTTGTGCCCCCTAGG
GGCGGAAAGAAGACCCGGTCCTGCCCGAGCTCAACAATCCCAGGGCGGGAGCCCATACCCAGGCTGGCTCCTGGGGCGACGCCACGCCAG
AGGGAGGGTTTAGTACATGGGAGGGCTAGCCCCGGGACTTGGGGCCAATACGGAAACCCTACCCCTTCCATGCTCATCTCACTGCCCAGT
GAAGGGGGCAAGGGCAGCGAGGGGCAGGACCCCTGCTGCTCATGGGGGTGGGGGTTCCCAACCCTTTCCGTGAAAGGGACCGTGAGTAGT
GGAAACCAGGACGTCCCCTACACCTACCCATGGGTGGAAGCTAAAGAGTCCGGGGGGAACCAAGAGCCTGGGTCCCTCCCACTACTATCT
TGGGAGGGAGAAGGGATGGAGCAGGAGCGGGCTAAGAGGGCTGCGGGGGCCTTGTAATTTATTGCTTTGTTCCCCAACATGGGGATGGGG
GCGGGCAGGGGCGTGGGGAGGGCGTTTTGGGGTAGGGGAAGCCCAGGGTGGGCAGGGGGTGGGTTGGGGTGGGGGTGCTCTCGGGTTGTG
TCTGTGACCGTGACTGCGTACCTGTGACTGTGCAGCGCCCGTGGTGATCTGGGGTAGGGGGCACCCCTACAGTGGGACCCCTCCCCCATT
ATTCTTTCTGTCCAGCCCCTCCCTCCCACTGGAGCAGCTCCAGAGCCATTCCTCACCCCCGTGACCTCTCCCAGCCAGGGCTGAGAGGAT
TCGAGGTGGCTGGGAGGGTTTCCAGGCCCCCTGCCCCTTCCCCACAAACTGGGTGATAGGGCGGACTTACCTGGCCCAGCCCTGCCTCCC
TCAGCCAACCCAGCCCTTGGGCTGTCTGTGTCAGTGGTTTCCGGTCTTTTTTTTTTTTTTTTTTTCTGGCTAAAATAGTTTGCAAAGGAC
CAGGTAATTGGGGAGGGGAGAGAGGTGGGGGCAAGGGGGAAATGCCCCCCCATCTCCTTGGAGGCAGTGGTGTGAATCTTCTTCAACAGC

>In-frame_YEATS4_ENST00000247843_chr12_69759664_+_AGAP2_ENST00000547588_chr12_58127956_-_2781nt
CGCGAGCCCGTTGCGCCTGCGCGCGGTGCGGCCGTCGCCCCTCTTTTCGCGGCGTTCTCCACCTGCGCGGGCCTGAATGGCCTTCAGGAG
CACAGTCGGCCTGAGGAGTTGACGGTTACTCACCGCCGTGAGCCCAAGTAACTCGCCCTCCTTCGGCTAGAAACCCTCCGCCTGGGCCCG
CGCGACAGGAGCGCGGTCTCTGAGGGGAGCGGCGACCCCGCCAGCCCCGGTCTCTTTCCCTGGCGGCGGCGGCTTCTTCCGTGGGACAAT
ATGTTCAAGAGAATGGCCGAATTTGGGCCTGACTCCGGCGGGAGAGTAAAGGGTGTTACTATCGTTAAACCAATAGTTTACGGTAATGTT
GCTCGGTATTTTGGAAAGAAAAGAGAAGAAGATGGGCACACTCATCAGTGGACAGTATATGTGAAACCATATAGAAATGAGGATATGTCA
GCATATGTGAAGAAAATCCAGTTTAAATTACATGAAAGCTATGGCAATCCTTTAAGAGTTGTTACTAAACCTCCATATGAAATTACTGAA
ACAGGATGGGGTGAATTCGAAATAATCATCAAAATATTTTTCATTGACCCTAATGAAAGACCTTTCTCAGGCTGGGCAGATGCTGTGATC
TTCGTCTTCAGCCTGGAGGATGAGAACAGTTTCCAGGCTGTGAGCCGTCTCCATGGGCAGCTGAGTTCCCTTCGCGGGGAGGGACGAGGA
GGCCTGGCCTTGGCACTGGTGGGGACACAAGACAGGATCAGTGCTTCCTCCCCTCGGGTGGTGGGAGATGCTCGTGCCAGAGCTCTGTGC
GCGGACATGAAACGCTGCAGCTACTATGAGACTTGTGCAACCTATGGGCTCAATGTGGATCGGGTCTTCCAGGAGGTGGCCCAGAAGGTG
GTGACCTTGCGCAAGCAGCAACAGCTTCTGGCTGCCTGCAAGTCCCTGCCCAGCTCCCCAAGCCACTCAGCTGCATCCACTCCGGTAGCT
GGCCAGGCTAGTAACGGGGGCCACACTAGCGACTACTCTTCTTCCCTCCCGTCCTCACCGAATGTTGGTCACCGGGAGCTCCGAGCCGAG
GCAGCTGCAGTGGCTGGATTGAGCACCCCAGGGTCCCTGCACCGGGCAGCCAAGCGCAGGACCAGCCTTTTTGCGAATCGTCGGGGTAGT
GACTCCGAGAAACGAAGCTTGGATAGTCGGGGAGAGACAACAGGGAGTGGGCGAGCCATCCCCATCAAACAGAGCTTCCTACTAAAACGA
AGTGGCAATTCCTTGAACAAAGAATGGAAGAAGAAATATGTAACCCTGTCCAGTAATGGCTTTCTACTCTACCACCCCAGTATTAACGAT
TACATCCACAGTACCCACGGCAAGGAGATGGACTTGCTGCGAACAACAGTCAAAGTCCCGGGCAAGCGGCCCCCGAGGGCCATCTCTGCC
TTTGGCCCCTCAGCCAGCATTAACGGGCTCGTCAAGGACATGAGCACTGTCCAGATGGGTGAAGGCCTGGAAGCCACTACTCCCATGCCA
AGCCCTAGCCCCAGCCCCAGTTCCCTGCAGCCACCACCAGATCAGACATCCAAACACCTGCTGAAGCCAGACCGGAATTTGGCCCGAGCC
CTCAGCACGGACTGTACCCCATCTGGAGACCTGAGCCCCCTGAGTCGGGAACCCCCTCCTTCTCCCATGGTGAAGAAGCAGAGGAGGAAA
AAATTGACAACACCATCCAAGACTGAAGGCTCGGCTGGGCAGGCTGAAGCCAAGCGCAAAATGTGGAAACTAAAATCCTTTGGTAGTTTA
AGAAATATTTATAAAGCAGAGGAAAACTTTGAGTTCCTGATCGTGTCCAGCACGGGTCAGACGTGGCACTTTGAGGCAGCCAGTTTTGAG
GAGCGGGATGCCTGGGTCCAGGCCATCGAGAGTCAGATCCTAGCCAGTCTGCAATGCTGTGAGAGCAGCAAGGTCAAGCTGCGCACAGAC
AGCCAAAGCGAGGCCGTGGCCATCCAGGCGATCCGGAACGCCAAGGGGAATTCAATCTGCGTGGACTGCGGGGCCCCCAACCCCACGTGG
GCCAGCTTGAACCTGGGCGCCCTCATCTGCATCGAGTGTTCTGGCATCCACCGCAACCTGGGCACACACCTGTCCCGCGTTCGCTCGCTG
GACTTGGACGACTGGCCACGGGAGCTGACCCTGGTGCTGACGGCTATTGGCAACGACACGGCCAACCGCGTGTGGGAAAGCGACACGCGA
GGCCGTGCCAAGCCCTCGCGGGACTCTTCGCGGGAGGAGCGCGAGTCGTGGATTCGCGCCAAGTACGAGCAGCTACTGTTCCTGGCGCCG
CTGAGCACCTCGGAGGAGCCGCTGGGCCGCCAGCTGTGGGCCGCCGTGCAGGCCCAGGACGTGGCTACCGTTCTCCTGCTTTTGGCCCAT
GCGCGACACGGGCCGCTCGACACCAGCGTAGAGGACCCACAGCTGCGCTCCCCACTCCACCTGGCGGCCGAGCTCGCCCACGTCGTCATC
ACGCAACTGCTGCTGTGGTACGGCGCGGACGTGGCGGCCCGTGACGCCCAGGGCCGCACGGCGCTGTTCTACGCCCGCCAGGCTGGAAGC
CAGCTGTGCGCCGACATCCTTCTCCAGCACGGCTGCCCGGGTGAGGGCGGCAGCGCGGCCACCACGCCCAGCGCGGCCACCACGCCCAGC


Top

FusionGenePPI for YEATS4_AGAP2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
YEATS4TACC1, TACC2, NUMA1, CEP162, PFDN1, MLLT10, SMARCB1, ING3, RUVBL2, RUVBL1, MRGBP, KAT5, DMAP1, H2AFZ, MYCN, KDM1A, FRMD4A, RNF8, MYC, VIM, UBTF, BRD3, TFAP2B, LYN, HECW2, PLAC1, FOXR1, FOXR2, MORF4L1, FOSL2, FOS, GRAMD3, HIST1H2BA, EP400, FUS, MEAF6, EPC1, EPC2, SRCAP, TRRAP, BRD8, VPS72, SUGP1, HDGFRP2, MYO18A, SNX16, ACTL6B, MBTD1, UPF3B, ACTR6, GABPA, WEE1, MORF4L2, JAZF1, ZNHIT1, C12orf43, FBXO34, AGGF1, LENG1, POLDIP3, ANP32A, HIST1H2BG, MED23, XPO1, ACTL6A, COX6B1, ECHS1, FANCD2, MTOR, JUP, KRT2, KRT5, MLLT6, NFKBIE, PPM1G, S100A6, ATXN2, STIL, PTTG1, SNUPN, ZNF292, POLE3, WHSC1L1, PRPF40A, ZNF687, TSPYL2, KLF16, DOT1L, MICALL1, GPRIN1, CDYL2, PTGR2, EME1, ESCO2, REEP3, KPRP, MAX, FOXO6, POU5F1, MTMR7, PPP2R2D, TPH1, MYCL, P4HA3, ACTBL2, PKN3, NCKAP5L, TFPT, CCHCR1, TUFT1, RABGAP1L, GOLGA5, CLOCK, PSMD9, VPS53, DZIP3, GRIPAP1, RCOR1, HMG20A, CCDC132, GIT2, CCDC93, OIP5, PHF21A, PTRF, PHLDB3, HAUS6, RPRD1A, ARNTL, RABGEF1, NUF2, THAP11, VPS51, TSSC1, RABEP1, STRNAGAP2HOMER1, EPB41L1, PIK3R1, NF2, MPRIP, GRIP1, GRIA2, CDC42, RAC1, RAC2, RHOA, ARF1, AKT1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneAGAP2chr12:69759664chr12:58127956ENST00000257897-318267_390131837PLCG1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneYEATS4chr12:69759664chr12:58127956ENST00000247843+47163_227111228MLLT10
HgeneYEATS4chr12:69759664chr12:58127956ENST00000247843+47168_227111228TACC1
TgeneAGAP2chr12:69759664chr12:58127956ENST00000257897-3181_23131837EPB41L1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for YEATS4_AGAP2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for YEATS4_AGAP2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneYEATS4C0023827liposarcoma1CTD_human