FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42251

FusionGeneSummary for XXYLT1_OPA1

check button Fusion gene summary
Fusion gene informationFusion gene name: XXYLT1_OPA1
Fusion gene ID: 42251
HgeneTgene
Gene symbol

XXYLT1

OPA1

Gene ID

152002

9968

Gene namexyloside xylosyltransferase 1mediator complex subunit 12
SynonymsC3orf21ARC240|CAGH45|FGS1|HOPA|MED12S|OHDOX|OKS|OPA1|TNRC11|TRAP230
Cytomap

3q29

Xq13.1

Type of geneprotein-codingprotein-coding
Descriptionxyloside xylosyltransferase 1UDP-xylose:alpha-xyloside alpha-1,3-xylosyltransferasemediator of RNA polymerase II transcription subunit 12CAG repeat protein 45OPA-containing proteinactivator-recruited cofactor 240 kDa componenthuman opposite pairedmediator of RNA polymerase II transcription, subunit 12 homologputative mediator subu
Modification date2018051920180527
UniProtAcc

Q8NBI6

O60313

Ensembl transtripts involved in fusion geneENST00000310380, ENST00000437101, 
ENST00000429994, ENST00000355729, 
ENST00000460582, ENST00000356740, 
ENST00000361828, ENST00000361510, 
ENST00000361150, ENST00000361715, 
ENST00000361908, ENST00000392438, 
ENST00000487986, 
Fusion gene scores* DoF score8 X 5 X 6=2403 X 3 X 3=27
# samples 93
** MAII scorelog2(9/240*10)=-1.41503749927884
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: XXYLT1 [Title/Abstract] AND OPA1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneXXYLT1

GO:0016266

O-glycan processing

8982869|22117070

TgeneOPA1

GO:0006367

transcription initiation from RNA polymerase II promoter

12218053

TgeneOPA1

GO:0030518

intracellular steroid hormone receptor signaling pathway

11867769

TgeneOPA1

GO:0030521

androgen receptor signaling pathway

12218053

TgeneOPA1

GO:0045893

positive regulation of transcription, DNA-templated

10198638

TgeneOPA1

GO:0045944

positive regulation of transcription by RNA polymerase II

12037571


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDHNSCTCGA-CR-7367-01AXXYLT1chr3

194877178

-OPA1chr3

193332512

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000310380ENST00000361828XXYLT1chr3

194877178

-OPA1chr3

193332512

+
In-frameENST00000310380ENST00000361510XXYLT1chr3

194877178

-OPA1chr3

193332512

+
In-frameENST00000310380ENST00000361150XXYLT1chr3

194877178

-OPA1chr3

193332512

+
In-frameENST00000310380ENST00000361715XXYLT1chr3

194877178

-OPA1chr3

193332512

+
In-frameENST00000310380ENST00000361908XXYLT1chr3

194877178

-OPA1chr3

193332512

+
In-frameENST00000310380ENST00000392438XXYLT1chr3

194877178

-OPA1chr3

193332512

+
5CDS-intronENST00000310380ENST00000487986XXYLT1chr3

194877178

-OPA1chr3

193332512

+
Frame-shitENST00000437101ENST00000361828XXYLT1chr3

194877178

-OPA1chr3

193332512

+
Frame-shitENST00000437101ENST00000361510XXYLT1chr3

194877178

-OPA1chr3

193332512

+
Frame-shitENST00000437101ENST00000361150XXYLT1chr3

194877178

-OPA1chr3

193332512

+
Frame-shitENST00000437101ENST00000361715XXYLT1chr3

194877178

-OPA1chr3

193332512

+
Frame-shitENST00000437101ENST00000361908XXYLT1chr3

194877178

-OPA1chr3

193332512

+
Frame-shitENST00000437101ENST00000392438XXYLT1chr3

194877178

-OPA1chr3

193332512

+
5CDS-intronENST00000437101ENST00000487986XXYLT1chr3

194877178

-OPA1chr3

193332512

+
In-frameENST00000429994ENST00000361828XXYLT1chr3

194877178

-OPA1chr3

193332512

+
In-frameENST00000429994ENST00000361510XXYLT1chr3

194877178

-OPA1chr3

193332512

+
In-frameENST00000429994ENST00000361150XXYLT1chr3

194877178

-OPA1chr3

193332512

+
In-frameENST00000429994ENST00000361715XXYLT1chr3

194877178

-OPA1chr3

193332512

+
In-frameENST00000429994ENST00000361908XXYLT1chr3

194877178

-OPA1chr3

193332512

+
In-frameENST00000429994ENST00000392438XXYLT1chr3

194877178

-OPA1chr3

193332512

+
5CDS-intronENST00000429994ENST00000487986XXYLT1chr3

194877178

-OPA1chr3

193332512

+
In-frameENST00000355729ENST00000361828XXYLT1chr3

194877178

-OPA1chr3

193332512

+
In-frameENST00000355729ENST00000361510XXYLT1chr3

194877178

-OPA1chr3

193332512

+
In-frameENST00000355729ENST00000361150XXYLT1chr3

194877178

-OPA1chr3

193332512

+
In-frameENST00000355729ENST00000361715XXYLT1chr3

194877178

-OPA1chr3

193332512

+
In-frameENST00000355729ENST00000361908XXYLT1chr3

194877178

-OPA1chr3

193332512

+
In-frameENST00000355729ENST00000392438XXYLT1chr3

194877178

-OPA1chr3

193332512

+
5CDS-intronENST00000355729ENST00000487986XXYLT1chr3

194877178

-OPA1chr3

193332512

+
intron-3CDSENST00000460582ENST00000361828XXYLT1chr3

194877178

-OPA1chr3

193332512

+
intron-3CDSENST00000460582ENST00000361510XXYLT1chr3

194877178

-OPA1chr3

193332512

+
intron-3CDSENST00000460582ENST00000361150XXYLT1chr3

194877178

-OPA1chr3

193332512

+
intron-3CDSENST00000460582ENST00000361715XXYLT1chr3

194877178

-OPA1chr3

193332512

+
intron-3CDSENST00000460582ENST00000361908XXYLT1chr3

194877178

-OPA1chr3

193332512

+
intron-3CDSENST00000460582ENST00000392438XXYLT1chr3

194877178

-OPA1chr3

193332512

+
intron-intronENST00000460582ENST00000487986XXYLT1chr3

194877178

-OPA1chr3

193332512

+
intron-3CDSENST00000356740ENST00000361828XXYLT1chr3

194877178

-OPA1chr3

193332512

+
intron-3CDSENST00000356740ENST00000361510XXYLT1chr3

194877178

-OPA1chr3

193332512

+
intron-3CDSENST00000356740ENST00000361150XXYLT1chr3

194877178

-OPA1chr3

193332512

+
intron-3CDSENST00000356740ENST00000361715XXYLT1chr3

194877178

-OPA1chr3

193332512

+
intron-3CDSENST00000356740ENST00000361908XXYLT1chr3

194877178

-OPA1chr3

193332512

+
intron-3CDSENST00000356740ENST00000392438XXYLT1chr3

194877178

-OPA1chr3

193332512

+
intron-intronENST00000356740ENST00000487986XXYLT1chr3

194877178

-OPA1chr3

193332512

+

Top

FusionProtFeatures for XXYLT1_OPA1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
XXYLT1

Q8NBI6

OPA1

O60313

Alpha-1,3-xylosyltransferase, which elongates the O-linked xylose-glucose disaccharide attached to EGF-like repeats inthe extracellular domain of target proteins by catalyzing theaddition of the second xylose (PubMed:22117070, PubMed:8982869).Known targets include Notch proteins and coagulation factors, suchas F9 (PubMed:22117070, PubMed:8982869).{ECO:0000269|PubMed:22117070, ECO:0000269|PubMed:8982869}. Dynamin-related GTPase that is essential for normalmitochondrial morphology by regulating the equilibrium betweenmitochondrial fusion and mitochondrial fission (PubMed:16778770,PubMed:17709429, PubMed:20185555, PubMed:24616225,PubMed:28746876). Coexpression of isoform 1 with shorteralternative products is required for optimal activity in promotingmitochondrial fusion (PubMed:17709429). Binds lipid membranesenriched in negatively charged phospholipids, such as cardiolipin,and promotes membrane tubulation (PubMed:20185555). The intrinsicGTPase activity is low, and is strongly increased by interactionwith lipid membranes (PubMed:20185555). Plays a role in remodelingcristae and the release of cytochrome c during apoptosis (Bysimilarity). Proteolytic processing in response to intrinsicapoptotic signals may lead to disassembly of OPA1 oligomers andrelease of the caspase activator cytochrome C (CYCS) into themitochondrial intermembrane space (By similarity). Plays a role inmitochondrial genome maintenance (PubMed:20974897,PubMed:18158317). {ECO:0000250|UniProtKB:P58281,ECO:0000269|PubMed:16778770, ECO:0000269|PubMed:17709429,ECO:0000269|PubMed:18158317, ECO:0000269|PubMed:20185555,ECO:0000269|PubMed:20974897, ECO:0000269|PubMed:24616225,ECO:0000269|PubMed:28746876}. Dynamin-like 120 kDa protein, form S1: Inactive formproduced by cleavage at S1 position by OMA1 following stressconditions that induce loss of mitochondrial membrane potential,leading to negative regulation of mitochondrial fusion.{ECO:0000269|PubMed:20038677}. Isoforms that contain the alternative exon 4b (presentin isoform 4 and isoform 5) are required for mitochondrial genomemaintenance, possibly by anchoring the mitochondrial nucleoids tothe inner mitochondrial membrane. {ECO:0000269|PubMed:20974897}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000310380-34104_106261394RegionUDP-alpha-D-xylose binding
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000310380-341_23261394Topological domainCytoplasmic
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000355729-231_2358191Topological domainCytoplasmic
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000437101-451_2358191Topological domainCytoplasmic
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000310380-3424_44261394TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000355729-2324_4458191TransmembraneHelical%3B Signal-anchor for type II membrane protein
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000437101-4524_4458191TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneOPA1chr3:194877178chr3:193332512ENST00000361908+030210_254101978Coiled coilOntology_term=ECO:0000255
TgeneOPA1chr3:194877178chr3:193332512ENST00000361908+030895_960101978Coiled coilOntology_term=ECO:0000255
TgeneOPA1chr3:194877178chr3:193332512ENST00000392438+029210_254101945Coiled coilOntology_term=ECO:0000255
TgeneOPA1chr3:194877178chr3:193332512ENST00000392438+029895_960101945Coiled coilOntology_term=ECO:0000255
TgeneOPA1chr3:194877178chr3:193332512ENST00000361908+030285_561101978DomainDynamin-type G
TgeneOPA1chr3:194877178chr3:193332512ENST00000392438+029285_561101945DomainDynamin-type G
TgeneOPA1chr3:194877178chr3:193332512ENST00000361908+030398_402101978Nucleotide bindingGTP
TgeneOPA1chr3:194877178chr3:193332512ENST00000392438+029398_402101945Nucleotide bindingGTP
TgeneOPA1chr3:194877178chr3:193332512ENST00000361908+030295_302101978RegionG1 motif
TgeneOPA1chr3:194877178chr3:193332512ENST00000361908+030321_324101978RegionG2 motif
TgeneOPA1chr3:194877178chr3:193332512ENST00000361908+030398_401101978RegionG3 motif
TgeneOPA1chr3:194877178chr3:193332512ENST00000361908+030467_470101978RegionG4 motif
TgeneOPA1chr3:194877178chr3:193332512ENST00000361908+030501_504101978RegionG5 motif
TgeneOPA1chr3:194877178chr3:193332512ENST00000392438+029295_302101945RegionG1 motif
TgeneOPA1chr3:194877178chr3:193332512ENST00000392438+029321_324101945RegionG2 motif
TgeneOPA1chr3:194877178chr3:193332512ENST00000392438+029398_401101945RegionG3 motif
TgeneOPA1chr3:194877178chr3:193332512ENST00000392438+029467_470101945RegionG4 motif
TgeneOPA1chr3:194877178chr3:193332512ENST00000392438+029501_504101945RegionG5 motif
TgeneOPA1chr3:194877178chr3:193332512ENST00000361908+030114_960101978Topological domainMitochondrial intermembrane
TgeneOPA1chr3:194877178chr3:193332512ENST00000361908+03088_96101978Topological domainMitochondrial matrix
TgeneOPA1chr3:194877178chr3:193332512ENST00000392438+029114_960101945Topological domainMitochondrial intermembrane
TgeneOPA1chr3:194877178chr3:193332512ENST00000392438+02988_96101945Topological domainMitochondrial matrix
TgeneOPA1chr3:194877178chr3:193332512ENST00000361908+03097_113101978TransmembraneHelical
TgeneOPA1chr3:194877178chr3:193332512ENST00000392438+02997_113101945TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000355729-23104_10658191RegionUDP-alpha-D-xylose binding
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000356740-12104_1060188RegionUDP-alpha-D-xylose binding
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000437101-45104_10658191RegionUDP-alpha-D-xylose binding
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000310380-3445_393261394Topological domainLumenal
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000355729-2345_39358191Topological domainLumenal
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000356740-121_230188Topological domainCytoplasmic
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000356740-1245_3930188Topological domainLumenal
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000437101-4545_39358191Topological domainLumenal
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000356740-1224_440188TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for XXYLT1_OPA1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000361828_chr3_193332512_+_1230aa
MGLLRGGLPCARAMARLGAVRSHYCALLLAAALAVCAFYYLGSGRETFSSATKRLKEARAGAPAAPSPPALELARGSVAPAPGAKAKSLE
GGGAGPVDYHLLMMFTKAEHNAALQAKARVALRSLLRLAKFEAHEVLNLHFVSEEASREVAKGLLRELLPPAAGFKCKVIFHDVAVLTDK
LFPIVEAMQKHFSAGLGTYYSDSIFFLSVAMHQIMPKEILQIIQLDLDLKFKTNIRELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVK
HSSGIKGSLPLQKLHLVSRSITHSHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKFSPIKTGYQPRRNFWPARLATRLLKLRTLILGSAV
GGGYTAKKTFDQWKDMIPDLSETKWIVPDIVWEIDETIDFEKIRKALPSSEDLVKLAPDFDKIVESLSLLKDFFTSGHKLVSEVIGASDL
LLLLGSPEETAFRATDRGSESDKHFRKVSDKEKIDQLQEELLHTQLKTQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMTSEV
LDVLSDTDASTNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRH
EIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDL
VSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMKALGTFAVVTGKGNSSESIEAIRETEEEFFQNSKLLKTSMLKAHQVTT
RNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNNTPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVSTH
VIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDS
LRVIQHNALEDRSISDKQQWDAAITFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNEEHPATLAS
DEITTVRKNLESRGVEVDPSLIKDTWHQVTRRHFLKTALNHCNLCRRGFTYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNT

>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000361510_chr3_193332512_+_1267aa
MGLLRGGLPCARAMARLGAVRSHYCALLLAAALAVCAFYYLGSGRETFSSATKRLKEARAGAPAAPSPPALELARGSVAPAPGAKAKSLE
GGGAGPVDYHLLMMFTKAEHNAALQAKARVALRSLLRLAKFEAHEVLNLHFVSEEASREVAKGLLRELLPPAAGFKCKVIFHDVAVLTDK
LFPIVEAMQKHFSAGLGTYYSDSIFFLSVAMHQIMPKEILQIIQLDLDLKFKTNIRELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVK
HSSGIKGSLPLQKLHLVSRSITHSHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKFSPIKTGYQPRRNFWPARLATRLLKLRTLILGSAV
GGGYTAKKTFDQWKDMIPDLSETKWIVPDIVWEIDETIDFEKIRKALPSSEDLVKLAPDFDKIVESLSLLKDFFTSGHKLVSEVIGASDL
LLLLGSPEETAFRATDRGSESDKHFRKGLLGELILLQQQIQEHEEEARRAAGQTSTSTAQQKRKVSDKEKIDQLQEELLHTQLKTQRILE
RLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMTSEVLDVLSDTDASTNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTR
SPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDT
KETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMKALGTFAVVTG
KGNSSESIEAIRETEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNNTPRLRELDRNELF
EKAKNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRF
MTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAITFMEEALQARLKDTENAIENMVGPDWKKR
WLYWKNRTQEQCVHNETKNELEKMLKCNEEHPATLASDEITTVRKNLESRGVEVDPSLIKDTWHQVTRRHFLKTALNHCNLCRRGFTYYQ
RHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIE

>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000361150_chr3_193332512_+_1213aa
MGLLRGGLPCARAMARLGAVRSHYCALLLAAALAVCAFYYLGSGRETFSSATKRLKEARAGAPAAPSPPALELARGSVAPAPGAKAKSLE
GGGAGPVDYHLLMMFTKAEHNAALQAKARVALRSLLRLAKFEAHEVLNLHFVSEEASREVAKGLLRELLPPAAGFKCKVIFHDVAVLTDK
LFPIVEAMQKHFSAGLGTYYSDSIFFLSVAMHQIMPKEILQIIQLDLDLKFKTNIRELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVK
HSSGIKGSLPLQKLHLVSRSITHSHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKFSPIKTGYQPRRNFWPARLATRLLKLRTLILGSAV
GGGYTAKKTFDQWKDMIPDLSETKWIVPDIVWEIDETIDFGSPEETAFRATDRGSESDKHFRKGLLGELILLQQQIQEHEEEARRAAGQT
STSTAQQKRKVSDKEKIDQLQEELLHTQLKTQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMTSEVLDVLSDTDASTNTQDHL
PRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEGCTVS
PETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTK
VDLAEKNVASPSRIQQIIEGKLFPMKALGTFAVVTGKGNSSESIEAIRETEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRE
SVEQQADSFKATRFNLETEWKNNTPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGT
FNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDK
QQWDAAITFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNEEHPATLASDEITTVRKNLESRGVEV
DPSLIKDTWHQVTRRHFLKTALNHCNLCRRGFTYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFA

>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000361715_chr3_193332512_+_1231aa
MGLLRGGLPCARAMARLGAVRSHYCALLLAAALAVCAFYYLGSGRETFSSATKRLKEARAGAPAAPSPPALELARGSVAPAPGAKAKSLE
GGGAGPVDYHLLMMFTKAEHNAALQAKARVALRSLLRLAKFEAHEVLNLHFVSEEASREVAKGLLRELLPPAAGFKCKVIFHDVAVLTDK
LFPIVEAMQKHFSAGLGTYYSDSIFFLSVAMHQIMPKEILQIIQLDLDLKFKTNIRELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVK
HSSGIKGSLPLQKLHLVSRSITHSHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKFSPIKTGYQPRRNFWPARLATRLLKLRTLILGSAV
GGGYTAKKTFDQWKDMIPDLSETKWIVPDIVWEIDETIDFGHKLVSEVIGASDLLLLLGSPEETAFRATDRGSESDKHFRKGLLGELILL
QQQIQEHEEEARRAAGQTSTSTAQQKRKVSDKEKIDQLQEELLHTQLKTQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMTSE
VLDVLSDTDASTNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALR
HEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTD
LVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMKALGTFAVVTGKGNSSESIEAIRETEEEFFQNSKLLKTSMLKAHQVT
TRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNNTPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVST
HVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAED
SLRVIQHNALEDRSISDKQQWDAAITFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNEEHPATLA
SDEITTVRKNLESRGVEVDPSLIKDTWHQVTRRHFLKTALNHCNLCRRGFTYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTN

>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000361908_chr3_193332512_+_1249aa
MGLLRGGLPCARAMARLGAVRSHYCALLLAAALAVCAFYYLGSGRETFSSATKRLKEARAGAPAAPSPPALELARGSVAPAPGAKAKSLE
GGGAGPVDYHLLMMFTKAEHNAALQAKARVALRSLLRLAKFEAHEVLNLHFVSEEASREVAKGLLRELLPPAAGFKCKVIFHDVAVLTDK
LFPIVEAMQKHFSAGLGTYYSDSIFFLSVAMHQIMPKEILQIIQLDLDLKFKTNIRELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVK
HSSGIKGSLPLQKLHLVSRSITHSHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKFSPIKTGYQPRRNFWPARLATRLLKLRTLILGSAV
GGGYTAKKTFDQWKDMIPDLSETKWIVPDIVWEIDETIDFEKIRKALPSSEDLVKLAPDFDKIVESLSLLKDFFTSGSPEETAFRATDRG
SESDKHFRKGLLGELILLQQQIQEHEEEARRAAGQTSTSTAQQKRKVSDKEKIDQLQEELLHTQLKTQRILERLEKENKELRKLVLQKDD
KGIHHRKLKKSLIDMTSEVLDVLSDTDASTNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFK
DSSREFDLTKEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAI
ILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMKALGTFAVVTGKGNSSESIEAIRETEEEF
FQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNNTPRLRELDRNELFEKAKNEILDEVISLSQVT
PKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKE
AVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAITFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETK
NELEKMLKCNEEHPATLASDEITTVRKNLESRGVEVDPSLIKDTWHQVTRRHFLKTALNHCNLCRRGFTYYQRHFVDSELECNDVVLFWR

>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000392438_chr3_193332512_+_1212aa
MGLLRGGLPCARAMARLGAVRSHYCALLLAAALAVCAFYYLGSGRETFSSATKRLKEARAGAPAAPSPPALELARGSVAPAPGAKAKSLE
GGGAGPVDYHLLMMFTKAEHNAALQAKARVALRSLLRLAKFEAHEVLNLHFVSEEASREVAKGLLRELLPPAAGFKCKVIFHDVAVLTDK
LFPIVEAMQKHFSAGLGTYYSDSIFFLSVAMHQIMPKEILQIIQLDLDLKFKTNIRELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVK
HSSGIKGSLPLQKLHLVSRSITHSHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKFSPIKTGYQPRRNFWPARLATRLLKLRTLILGSAV
GGGYTAKKTFDQWKDMIPDLSETKWIVPDIVWEIDETIDFEKIRKALPSSEDLVKLAPDFDKIVESLSLLKDFFTSGSPEETAFRATDRG
SESDKHFRKVSDKEKIDQLQEELLHTQLKTQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMTSEVLDVLSDTDASTNTQDHLP
RVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEGCTVSP
ETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKV
DLAEKNVASPSRIQQIIEGKLFPMKALGTFAVVTGKGNSSESIEAIRETEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRES
VEQQADSFKATRFNLETEWKNNTPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTF
NTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQ
QWDAAITFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNEEHPATLASDEITTVRKNLESRGVEVD
PSLIKDTWHQVTRRHFLKTALNHCNLCRRGFTYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAE

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000361828_chr3_193332512_+_1084aa
MVRCVPSAVIVCFLRPPQPGRTVIFHDVAVLTDKLFPIVEAMQKHFSAGLGTYYSDSIFFLSVAMHQIMPKEILQIIQLDLDLKFKTNIR
ELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVKHSSGIKGSLPLQKLHLVSRSITHSHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKF
SPIKTGYQPRRNFWPARLATRLLKLRTLILGSAVGGGYTAKKTFDQWKDMIPDLSETKWIVPDIVWEIDETIDFEKIRKALPSSEDLVKL
APDFDKIVESLSLLKDFFTSGHKLVSEVIGASDLLLLLGSPEETAFRATDRGSESDKHFRKVSDKEKIDQLQEELLHTQLKTQRILERLE
KENKELRKLVLQKDDKGIHHRKLKKSLIDMTSEVLDVLSDTDASTNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPV
KVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKET
IFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMKALGTFAVVTGKGN
SSESIEAIRETEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNNTPRLRELDRNELFEKA
KNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTE
PKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAITFMEEALQARLKDTENAIENMVGPDWKKRWLY
WKNRTQEQCVHNETKNELEKMLKCNEEHPATLASDEITTVRKNLESRGVEVDPSLIKDTWHQVTRRHFLKTALNHCNLCRRGFTYYQRHF
VDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALH

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000361510_chr3_193332512_+_1121aa
MVRCVPSAVIVCFLRPPQPGRTVIFHDVAVLTDKLFPIVEAMQKHFSAGLGTYYSDSIFFLSVAMHQIMPKEILQIIQLDLDLKFKTNIR
ELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVKHSSGIKGSLPLQKLHLVSRSITHSHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKF
SPIKTGYQPRRNFWPARLATRLLKLRTLILGSAVGGGYTAKKTFDQWKDMIPDLSETKWIVPDIVWEIDETIDFEKIRKALPSSEDLVKL
APDFDKIVESLSLLKDFFTSGHKLVSEVIGASDLLLLLGSPEETAFRATDRGSESDKHFRKGLLGELILLQQQIQEHEEEARRAAGQTST
STAQQKRKVSDKEKIDQLQEELLHTQLKTQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMTSEVLDVLSDTDASTNTQDHLPR
VVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEGCTVSPE
TISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVD
LAEKNVASPSRIQQIIEGKLFPMKALGTFAVVTGKGNSSESIEAIRETEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESV
EQQADSFKATRFNLETEWKNNTPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFN
TTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQ
WDAAITFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNEEHPATLASDEITTVRKNLESRGVEVDP
SLIKDTWHQVTRRHFLKTALNHCNLCRRGFTYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAED

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000361150_chr3_193332512_+_1067aa
MVRCVPSAVIVCFLRPPQPGRTVIFHDVAVLTDKLFPIVEAMQKHFSAGLGTYYSDSIFFLSVAMHQIMPKEILQIIQLDLDLKFKTNIR
ELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVKHSSGIKGSLPLQKLHLVSRSITHSHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKF
SPIKTGYQPRRNFWPARLATRLLKLRTLILGSAVGGGYTAKKTFDQWKDMIPDLSETKWIVPDIVWEIDETIDFGSPEETAFRATDRGSE
SDKHFRKGLLGELILLQQQIQEHEEEARRAAGQTSTSTAQQKRKVSDKEKIDQLQEELLHTQLKTQRILERLEKENKELRKLVLQKDDKG
IHHRKLKKSLIDMTSEVLDVLSDTDASTNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDS
SREFDLTKEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIIL
CIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMKALGTFAVVTGKGNSSESIEAIRETEEEFFQ
NSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNNTPRLRELDRNELFEKAKNEILDEVISLSQVTPK
HWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAV
KEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAITFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNE
LEKMLKCNEEHPATLASDEITTVRKNLESRGVEVDPSLIKDTWHQVTRRHFLKTALNHCNLCRRGFTYYQRHFVDSELECNDVVLFWRIQ

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000361715_chr3_193332512_+_1085aa
MVRCVPSAVIVCFLRPPQPGRTVIFHDVAVLTDKLFPIVEAMQKHFSAGLGTYYSDSIFFLSVAMHQIMPKEILQIIQLDLDLKFKTNIR
ELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVKHSSGIKGSLPLQKLHLVSRSITHSHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKF
SPIKTGYQPRRNFWPARLATRLLKLRTLILGSAVGGGYTAKKTFDQWKDMIPDLSETKWIVPDIVWEIDETIDFGHKLVSEVIGASDLLL
LLGSPEETAFRATDRGSESDKHFRKGLLGELILLQQQIQEHEEEARRAAGQTSTSTAQQKRKVSDKEKIDQLQEELLHTQLKTQRILERL
EKENKELRKLVLQKDDKGIHHRKLKKSLIDMTSEVLDVLSDTDASTNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSP
VKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKE
TIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMKALGTFAVVTGKG
NSSESIEAIRETEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNNTPRLRELDRNELFEK
AKNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMT
EPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAITFMEEALQARLKDTENAIENMVGPDWKKRWL
YWKNRTQEQCVHNETKNELEKMLKCNEEHPATLASDEITTVRKNLESRGVEVDPSLIKDTWHQVTRRHFLKTALNHCNLCRRGFTYYQRH
FVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEAL

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000361908_chr3_193332512_+_1103aa
MVRCVPSAVIVCFLRPPQPGRTVIFHDVAVLTDKLFPIVEAMQKHFSAGLGTYYSDSIFFLSVAMHQIMPKEILQIIQLDLDLKFKTNIR
ELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVKHSSGIKGSLPLQKLHLVSRSITHSHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKF
SPIKTGYQPRRNFWPARLATRLLKLRTLILGSAVGGGYTAKKTFDQWKDMIPDLSETKWIVPDIVWEIDETIDFEKIRKALPSSEDLVKL
APDFDKIVESLSLLKDFFTSGSPEETAFRATDRGSESDKHFRKGLLGELILLQQQIQEHEEEARRAAGQTSTSTAQQKRKVSDKEKIDQL
QEELLHTQLKTQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMTSEVLDVLSDTDASTNTQDHLPRVVVVGDQSAGKTSVLEMI
AQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVD
LPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEG
KLFPMKALGTFAVVTGKGNSSESIEAIRETEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEW
KNNTPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNK
AVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAITFMEEALQARLKD
TENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNEEHPATLASDEITTVRKNLESRGVEVDPSLIKDTWHQVTRRHFLKT
ALNHCNLCRRGFTYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAED

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000392438_chr3_193332512_+_1066aa
MVRCVPSAVIVCFLRPPQPGRTVIFHDVAVLTDKLFPIVEAMQKHFSAGLGTYYSDSIFFLSVAMHQIMPKEILQIIQLDLDLKFKTNIR
ELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVKHSSGIKGSLPLQKLHLVSRSITHSHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKF
SPIKTGYQPRRNFWPARLATRLLKLRTLILGSAVGGGYTAKKTFDQWKDMIPDLSETKWIVPDIVWEIDETIDFEKIRKALPSSEDLVKL
APDFDKIVESLSLLKDFFTSGSPEETAFRATDRGSESDKHFRKVSDKEKIDQLQEELLHTQLKTQRILERLEKENKELRKLVLQKDDKGI
HHRKLKKSLIDMTSEVLDVLSDTDASTNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSS
REFDLTKEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILC
IQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMKALGTFAVVTGKGNSSESIEAIRETEEEFFQN
SKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNNTPRLRELDRNELFEKAKNEILDEVISLSQVTPKH
WEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVK
EESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAITFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNEL
EKMLKCNEEHPATLASDEITTVRKNLESRGVEVDPSLIKDTWHQVTRRHFLKTALNHCNLCRRGFTYYQRHFVDSELECNDVVLFWRIQR

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000361828_chr3_193332512_+_1027aa
MWPPRCKDPGRQSAEILQIIQLDLDLKFKTNIRELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVKHSSGIKGSLPLQKLHLVSRSITH
SHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKFSPIKTGYQPRRNFWPARLATRLLKLRTLILGSAVGGGYTAKKTFDQWKDMIPDLSET
KWIVPDIVWEIDETIDFEKIRKALPSSEDLVKLAPDFDKIVESLSLLKDFFTSGHKLVSEVIGASDLLLLLGSPEETAFRATDRGSESDK
HFRKVSDKEKIDQLQEELLHTQLKTQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMTSEVLDVLSDTDASTNTQDHLPRVVVV
GDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEGCTVSPETISL
NVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEK
NVASPSRIQQIIEGKLFPMKALGTFAVVTGKGNSSESIEAIRETEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQA
DSFKATRFNLETEWKNNTPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVD
IKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAA
ITFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNEEHPATLASDEITTVRKNLESRGVEVDPSLIK
DTWHQVTRRHFLKTALNHCNLCRRGFTYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKK

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000361510_chr3_193332512_+_1064aa
MWPPRCKDPGRQSAEILQIIQLDLDLKFKTNIRELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVKHSSGIKGSLPLQKLHLVSRSITH
SHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKFSPIKTGYQPRRNFWPARLATRLLKLRTLILGSAVGGGYTAKKTFDQWKDMIPDLSET
KWIVPDIVWEIDETIDFEKIRKALPSSEDLVKLAPDFDKIVESLSLLKDFFTSGHKLVSEVIGASDLLLLLGSPEETAFRATDRGSESDK
HFRKGLLGELILLQQQIQEHEEEARRAAGQTSTSTAQQKRKVSDKEKIDQLQEELLHTQLKTQRILERLEKENKELRKLVLQKDDKGIHH
RKLKKSLIDMTSEVLDVLSDTDASTNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSRE
FDLTKEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQ
DGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMKALGTFAVVTGKGNSSESIEAIRETEEEFFQNSK
LLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNNTPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWE
EILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEE
SIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAITFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEK
MLKCNEEHPATLASDEITTVRKNLESRGVEVDPSLIKDTWHQVTRRHFLKTALNHCNLCRRGFTYYQRHFVDSELECNDVVLFWRIQRML

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000361150_chr3_193332512_+_1010aa
MWPPRCKDPGRQSAEILQIIQLDLDLKFKTNIRELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVKHSSGIKGSLPLQKLHLVSRSITH
SHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKFSPIKTGYQPRRNFWPARLATRLLKLRTLILGSAVGGGYTAKKTFDQWKDMIPDLSET
KWIVPDIVWEIDETIDFGSPEETAFRATDRGSESDKHFRKGLLGELILLQQQIQEHEEEARRAAGQTSTSTAQQKRKVSDKEKIDQLQEE
LLHTQLKTQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMTSEVLDVLSDTDASTNTQDHLPRVVVVGDQSAGKTSVLEMIAQA
RIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPG
VINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLF
PMKALGTFAVVTGKGNSSESIEAIRETEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNN
TPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVE
VAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAITFMEEALQARLKDTEN
AIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNEEHPATLASDEITTVRKNLESRGVEVDPSLIKDTWHQVTRRHFLKTALN
HCNLCRRGFTYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKK

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000361715_chr3_193332512_+_1028aa
MWPPRCKDPGRQSAEILQIIQLDLDLKFKTNIRELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVKHSSGIKGSLPLQKLHLVSRSITH
SHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKFSPIKTGYQPRRNFWPARLATRLLKLRTLILGSAVGGGYTAKKTFDQWKDMIPDLSET
KWIVPDIVWEIDETIDFGHKLVSEVIGASDLLLLLGSPEETAFRATDRGSESDKHFRKGLLGELILLQQQIQEHEEEARRAAGQTSTSTA
QQKRKVSDKEKIDQLQEELLHTQLKTQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMTSEVLDVLSDTDASTNTQDHLPRVVV
VGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEGCTVSPETIS
LNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAE
KNVASPSRIQQIIEGKLFPMKALGTFAVVTGKGNSSESIEAIRETEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQ
ADSFKATRFNLETEWKNNTPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTV
DIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDA
AITFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNEEHPATLASDEITTVRKNLESRGVEVDPSLI
KDTWHQVTRRHFLKTALNHCNLCRRGFTYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEK

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000361908_chr3_193332512_+_1046aa
MWPPRCKDPGRQSAEILQIIQLDLDLKFKTNIRELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVKHSSGIKGSLPLQKLHLVSRSITH
SHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKFSPIKTGYQPRRNFWPARLATRLLKLRTLILGSAVGGGYTAKKTFDQWKDMIPDLSET
KWIVPDIVWEIDETIDFEKIRKALPSSEDLVKLAPDFDKIVESLSLLKDFFTSGSPEETAFRATDRGSESDKHFRKGLLGELILLQQQIQ
EHEEEARRAAGQTSTSTAQQKRKVSDKEKIDQLQEELLHTQLKTQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMTSEVLDVL
SDTDASTNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIEL
RMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQM
DPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMKALGTFAVVTGKGNSSESIEAIRETEEEFFQNSKLLKTSMLKAHQVTTRNLS
LAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNNTPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIEN
IYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVI
QHNALEDRSISDKQQWDAAITFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNEEHPATLASDEIT
TVRKNLESRGVEVDPSLIKDTWHQVTRRHFLKTALNHCNLCRRGFTYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRR

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000392438_chr3_193332512_+_1009aa
MWPPRCKDPGRQSAEILQIIQLDLDLKFKTNIRELFEEFDSFLPGAIIGIAREMQPVYSEVCQSLVKHSSGIKGSLPLQKLHLVSRSITH
SHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKFSPIKTGYQPRRNFWPARLATRLLKLRTLILGSAVGGGYTAKKTFDQWKDMIPDLSET
KWIVPDIVWEIDETIDFEKIRKALPSSEDLVKLAPDFDKIVESLSLLKDFFTSGSPEETAFRATDRGSESDKHFRKVSDKEKIDQLQEEL
LHTQLKTQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMTSEVLDVLSDTDASTNTQDHLPRVVVVGDQSAGKTSVLEMIAQAR
IFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGV
INTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFP
MKALGTFAVVTGKGNSSESIEAIRETEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNNT
PRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEV
AWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAITFMEEALQARLKDTENA
IENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNEEHPATLASDEITTVRKNLESRGVEVDPSLIKDTWHQVTRRHFLKTALNH
CNLCRRGFTYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000361828_chr3_193332512_+_3690nt
ATGGGCCTCCTCCGAGGCGGGCTCCCATGCGCTCGGGCCATGGCGCGCCTGGGCGCTGTGCGCTCCCACTACTGCGCCCTGCTGCTGGCC
GCGGCGCTGGCCGTCTGCGCCTTCTACTACCTCGGCTCAGGCCGGGAGACCTTCTCCAGCGCCACCAAGAGGCTGAAGGAGGCCCGCGCC
GGGGCTCCCGCCGCGCCCTCGCCGCCCGCGCTGGAGCTAGCGCGGGGCTCCGTGGCGCCAGCCCCCGGCGCGAAGGCCAAGAGCTTGGAG
GGCGGCGGTGCCGGGCCGGTGGACTACCACCTGCTGATGATGTTCACCAAGGCGGAGCACAATGCCGCGCTGCAGGCCAAGGCCCGCGTC
GCGCTGCGCTCACTGCTGCGCCTCGCCAAGTTCGAGGCGCACGAGGTGCTTAACCTTCACTTCGTGAGCGAGGAGGCCAGCCGCGAGGTG
GCCAAGGGCCTGCTGCGGGAGCTCCTGCCGCCCGCCGCTGGCTTCAAGTGCAAGGTCATCTTCCACGATGTTGCTGTGCTGACGGATAAG
CTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTCCTCTCGGTCGCC
ATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGGGAGTTGTTTGAG
GAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAGTCTTTAGTGAAA
CACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCATCCTACCTTAAAG
CTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTCTCTCCAATTAAA
TATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTAGGATCGGCTGTT
GGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATTGTGCCTGACATT
GTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTTGTAAAGTTAGCACCAGACTTT
GACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTCACAAATTGGTTAGTGAAGTCATAGGAGCTTCTGACCTA
CTTCTCTTGTTAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGTGTCAGAC
AAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAA
GAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTT
CTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAG
ACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTG
AGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACAT
GAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTA
CAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATC
AGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTG
GTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGG
ATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGC
ATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACA
AGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGT
TTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATC
CTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCAT
GTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACT
GATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAA
GAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGC
TTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCT
CTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGG
ACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGT
GATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTAT
AGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAG
TTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACT
GAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAA
CGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTTGATGCTTTCATTGAAGCTCTTCATCAGGAGAAATAA

>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000361510_chr3_193332512_+_3801nt
ATGGGCCTCCTCCGAGGCGGGCTCCCATGCGCTCGGGCCATGGCGCGCCTGGGCGCTGTGCGCTCCCACTACTGCGCCCTGCTGCTGGCC
GCGGCGCTGGCCGTCTGCGCCTTCTACTACCTCGGCTCAGGCCGGGAGACCTTCTCCAGCGCCACCAAGAGGCTGAAGGAGGCCCGCGCC
GGGGCTCCCGCCGCGCCCTCGCCGCCCGCGCTGGAGCTAGCGCGGGGCTCCGTGGCGCCAGCCCCCGGCGCGAAGGCCAAGAGCTTGGAG
GGCGGCGGTGCCGGGCCGGTGGACTACCACCTGCTGATGATGTTCACCAAGGCGGAGCACAATGCCGCGCTGCAGGCCAAGGCCCGCGTC
GCGCTGCGCTCACTGCTGCGCCTCGCCAAGTTCGAGGCGCACGAGGTGCTTAACCTTCACTTCGTGAGCGAGGAGGCCAGCCGCGAGGTG
GCCAAGGGCCTGCTGCGGGAGCTCCTGCCGCCCGCCGCTGGCTTCAAGTGCAAGGTCATCTTCCACGATGTTGCTGTGCTGACGGATAAG
CTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTCCTCTCGGTCGCC
ATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGGGAGTTGTTTGAG
GAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAGTCTTTAGTGAAA
CACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCATCCTACCTTAAAG
CTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTCTCTCCAATTAAA
TATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTAGGATCGGCTGTT
GGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATTGTGCCTGACATT
GTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTTGTAAAGTTAGCACCAGACTTT
GACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTCACAAATTGGTTAGTGAAGTCATAGGAGCTTCTGACCTA
CTTCTCTTGTTAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGGTCTGCTT
GGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCGCGCAGAGCCGCTGGCCAATATAGCACGAGCTATGCCCAA
CAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAA
CGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTG
ATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTT
GGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACACGT
TCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAA
GATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTA
AATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTGACACA
AAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGAA
CGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAA
AATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGA
AAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTA
AAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCT
GATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTT
GAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTG
TGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAGTGGAT
ATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTT
ATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGG
AATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATGCAGCT
ATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGG
TGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAG
CACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAG
GATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAA
AGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATACTTTA
AGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAG
ATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTTGATGCTTTCATTGAA

>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000361150_chr3_193332512_+_3639nt
ATGGGCCTCCTCCGAGGCGGGCTCCCATGCGCTCGGGCCATGGCGCGCCTGGGCGCTGTGCGCTCCCACTACTGCGCCCTGCTGCTGGCC
GCGGCGCTGGCCGTCTGCGCCTTCTACTACCTCGGCTCAGGCCGGGAGACCTTCTCCAGCGCCACCAAGAGGCTGAAGGAGGCCCGCGCC
GGGGCTCCCGCCGCGCCCTCGCCGCCCGCGCTGGAGCTAGCGCGGGGCTCCGTGGCGCCAGCCCCCGGCGCGAAGGCCAAGAGCTTGGAG
GGCGGCGGTGCCGGGCCGGTGGACTACCACCTGCTGATGATGTTCACCAAGGCGGAGCACAATGCCGCGCTGCAGGCCAAGGCCCGCGTC
GCGCTGCGCTCACTGCTGCGCCTCGCCAAGTTCGAGGCGCACGAGGTGCTTAACCTTCACTTCGTGAGCGAGGAGGCCAGCCGCGAGGTG
GCCAAGGGCCTGCTGCGGGAGCTCCTGCCGCCCGCCGCTGGCTTCAAGTGCAAGGTCATCTTCCACGATGTTGCTGTGCTGACGGATAAG
CTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTCCTCTCGGTCGCC
ATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGGGAGTTGTTTGAG
GAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAGTCTTTAGTGAAA
CACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCATCCTACCTTAAAG
CTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTCTCTCCAATTAAA
TATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTAGGATCGGCTGTT
GGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATTGTGCCTGACATT
GTGTGGGAAATTGATGAGTATATCGATTTTGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCAT
TTTAGAAAGGGTCTGCTTGGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCGCGCAGAGCCGCTGGCCAATAT
AGCACGAGCTATGCCCAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAG
TATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGA
AAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCTG
CCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCT
GGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTT
GATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGC
CCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCA
GGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGAT
GGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAA
GTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTAT
TTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTC
CTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAG
TCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTT
GACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAA
ATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACT
TTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAA
GAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGT
ATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAAA
CAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGT
CCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATG
TTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTA
GATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGA
GGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCT
ATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCT
GAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAA

>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000361715_chr3_193332512_+_3693nt
ATGGGCCTCCTCCGAGGCGGGCTCCCATGCGCTCGGGCCATGGCGCGCCTGGGCGCTGTGCGCTCCCACTACTGCGCCCTGCTGCTGGCC
GCGGCGCTGGCCGTCTGCGCCTTCTACTACCTCGGCTCAGGCCGGGAGACCTTCTCCAGCGCCACCAAGAGGCTGAAGGAGGCCCGCGCC
GGGGCTCCCGCCGCGCCCTCGCCGCCCGCGCTGGAGCTAGCGCGGGGCTCCGTGGCGCCAGCCCCCGGCGCGAAGGCCAAGAGCTTGGAG
GGCGGCGGTGCCGGGCCGGTGGACTACCACCTGCTGATGATGTTCACCAAGGCGGAGCACAATGCCGCGCTGCAGGCCAAGGCCCGCGTC
GCGCTGCGCTCACTGCTGCGCCTCGCCAAGTTCGAGGCGCACGAGGTGCTTAACCTTCACTTCGTGAGCGAGGAGGCCAGCCGCGAGGTG
GCCAAGGGCCTGCTGCGGGAGCTCCTGCCGCCCGCCGCTGGCTTCAAGTGCAAGGTCATCTTCCACGATGTTGCTGTGCTGACGGATAAG
CTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTCCTCTCGGTCGCC
ATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGGGAGTTGTTTGAG
GAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAGTCTTTAGTGAAA
CACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCATCCTACCTTAAAG
CTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTCTCTCCAATTAAA
TATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTAGGATCGGCTGTT
GGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATTGTGCCTGACATT
GTGTGGGAAATTGATGAGTATATCGATTTTGGTCACAAATTGGTTAGTGAAGTCATAGGAGCTTCTGACCTACTTCTCTTGTTAGGTTCT
CCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGGTCTGCTTGGTGAGCTCATTCTCTTA
CAACAACAAATTCAAGAGCATGAAGAGGAAGCGCGCAGAGCCGCTGGCCAATATAGCACGAGCTATGCCCAACAGAAGCGCAAGGTGTCA
GACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAAC
AAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAA
GTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGA
AAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACT
CTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGA
CATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGA
CTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGT
ATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGAC
TTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGC
AGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAA
AGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACT
ACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACA
CGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAA
ATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACT
CATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGG
ACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGG
AAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGAC
AGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAG
GCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAAT
CGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCA
AGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTT
TATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCT
GAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAAAT
ACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGT
AAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTTGATGCTTTCATTGAAGCTCTTCATCAGGAGAAA

>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000361908_chr3_193332512_+_3747nt
ATGGGCCTCCTCCGAGGCGGGCTCCCATGCGCTCGGGCCATGGCGCGCCTGGGCGCTGTGCGCTCCCACTACTGCGCCCTGCTGCTGGCC
GCGGCGCTGGCCGTCTGCGCCTTCTACTACCTCGGCTCAGGCCGGGAGACCTTCTCCAGCGCCACCAAGAGGCTGAAGGAGGCCCGCGCC
GGGGCTCCCGCCGCGCCCTCGCCGCCCGCGCTGGAGCTAGCGCGGGGCTCCGTGGCGCCAGCCCCCGGCGCGAAGGCCAAGAGCTTGGAG
GGCGGCGGTGCCGGGCCGGTGGACTACCACCTGCTGATGATGTTCACCAAGGCGGAGCACAATGCCGCGCTGCAGGCCAAGGCCCGCGTC
GCGCTGCGCTCACTGCTGCGCCTCGCCAAGTTCGAGGCGCACGAGGTGCTTAACCTTCACTTCGTGAGCGAGGAGGCCAGCCGCGAGGTG
GCCAAGGGCCTGCTGCGGGAGCTCCTGCCGCCCGCCGCTGGCTTCAAGTGCAAGGTCATCTTCCACGATGTTGCTGTGCTGACGGATAAG
CTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTCCTCTCGGTCGCC
ATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGGGAGTTGTTTGAG
GAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAGTCTTTAGTGAAA
CACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCATCCTACCTTAAAG
CTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTCTCTCCAATTAAA
TATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTAGGATCGGCTGTT
GGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATTGTGCCTGACATT
GTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTTGTAAAGTTAGCACCAGACTTT
GACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGA
TCTGAAAGTGACAAGCATTTTAGAAAGGGTCTGCTTGGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCGCGC
AGAGCCGCTGGCCAATATAGCACGAGCTATGCCCAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTT
CTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGAC
AAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTAT
AATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGA
ATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAA
GATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAA
GAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTG
ATTAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATC
ATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACC
ATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCA
ATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTT
TTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTT
TGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTAT
CCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACA
CCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAG
ACCATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTT
GCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAG
GCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGAC
CGATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCA
ATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAG
AATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAA
TCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCAT
TGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGT
ATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAG
GTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTT

>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000392438_chr3_193332512_+_3636nt
ATGGGCCTCCTCCGAGGCGGGCTCCCATGCGCTCGGGCCATGGCGCGCCTGGGCGCTGTGCGCTCCCACTACTGCGCCCTGCTGCTGGCC
GCGGCGCTGGCCGTCTGCGCCTTCTACTACCTCGGCTCAGGCCGGGAGACCTTCTCCAGCGCCACCAAGAGGCTGAAGGAGGCCCGCGCC
GGGGCTCCCGCCGCGCCCTCGCCGCCCGCGCTGGAGCTAGCGCGGGGCTCCGTGGCGCCAGCCCCCGGCGCGAAGGCCAAGAGCTTGGAG
GGCGGCGGTGCCGGGCCGGTGGACTACCACCTGCTGATGATGTTCACCAAGGCGGAGCACAATGCCGCGCTGCAGGCCAAGGCCCGCGTC
GCGCTGCGCTCACTGCTGCGCCTCGCCAAGTTCGAGGCGCACGAGGTGCTTAACCTTCACTTCGTGAGCGAGGAGGCCAGCCGCGAGGTG
GCCAAGGGCCTGCTGCGGGAGCTCCTGCCGCCCGCCGCTGGCTTCAAGTGCAAGGTCATCTTCCACGATGTTGCTGTGCTGACGGATAAG
CTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTCCTCTCGGTCGCC
ATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGGGAGTTGTTTGAG
GAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAGTCTTTAGTGAAA
CACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCATCCTACCTTAAAG
CTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTCTCTCCAATTAAA
TATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTAGGATCGGCTGTT
GGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATTGTGCCTGACATT
GTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTTGTAAAGTTAGCACCAGACTTT
GACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGA
TCTGAAAGTGACAAGCATTTTAGAAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTAT
CAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAG
CTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCA
CGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGG
GAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGAT
CTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCT
GAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGC
ATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGA
TCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTA
GACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTT
GCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTA
AAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCT
GTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGAC
CGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATC
CTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTT
AACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAA
GAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATT
AAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAG
CAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCA
GACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTG
AAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGAT
CCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGT
TTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATC
ACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAA
GATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTT

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000361828_chr3_193332512_+_3252nt
ATGGTGAGATGTGTCCCTTCCGCCGTGATTGTGTGTTTCCTGAGGCCTCCCCAGCCAGGCAGAACTGTCATCTTCCACGATGTTGCTGTG
CTGACGGATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTC
CTCTCGGTCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGG
GAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAG
TCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCAT
CCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTC
TCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTA
GGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATT
GTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTTGTAAAGTTA
GCACCAGACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTCACAAATTGGTTAGTGAAGTCATAGGA
GCTTCTGACCTACTTCTCTTGTTAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGA
AAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAA
AAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATG
TATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAG
AGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTT
AAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCA
GCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAA
GGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACT
ATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATT
GTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCC
AGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAAC
AGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACAC
CAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTC
AAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCT
AAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGA
GTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTT
AAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAA
CCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTT
GCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTT
ATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATAC
TGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCT
TATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGG
CATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTT
GTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAA
CTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTG
CTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTTGATGCTTTCATTGAAGCTCTTCAT

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000361510_chr3_193332512_+_3363nt
ATGGTGAGATGTGTCCCTTCCGCCGTGATTGTGTGTTTCCTGAGGCCTCCCCAGCCAGGCAGAACTGTCATCTTCCACGATGTTGCTGTG
CTGACGGATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTC
CTCTCGGTCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGG
GAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAG
TCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCAT
CCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTC
TCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTA
GGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATT
GTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTTGTAAAGTTA
GCACCAGACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTCACAAATTGGTTAGTGAAGTCATAGGA
GCTTCTGACCTACTTCTCTTGTTAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGA
AAGGGTCTGCTTGGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCGCGCAGAGCCGCTGGCCAATATAGCACG
AGCTATGCCCAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAG
AGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTT
AAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGG
GTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAG
ATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTT
ACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAG
ACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATG
GCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCT
GTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGAC
CTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCT
GTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAG
ACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTT
GAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGG
AATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTT
CAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAAC
ACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAA
TTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAA
CGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAA
TGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGAC
TGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAA
TGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCA
AGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTT
TATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACC
GCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGAT
GGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTTGAT

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000361150_chr3_193332512_+_3201nt
ATGGTGAGATGTGTCCCTTCCGCCGTGATTGTGTGTTTCCTGAGGCCTCCCCAGCCAGGCAGAACTGTCATCTTCCACGATGTTGCTGTG
CTGACGGATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTC
CTCTCGGTCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGG
GAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAG
TCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCAT
CCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTC
TCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTA
GGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATT
GTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAA
AGTGACAAGCATTTTAGAAAGGGTCTGCTTGGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCGCGCAGAGCC
GCTGGCCAATATAGCACGAGCTATGCCCAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCAC
ACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGC
ATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACG
CAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTC
CCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGT
TCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGC
TGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAAT
ACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTG
TGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTC
GTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAA
GCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAG
AATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAA
ATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGC
CTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAA
CATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATG
AATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGG
GAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTT
AAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCC
ATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAA
AACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAA
TTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGA
GGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAAC
CTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAG
CGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTG
GAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAA

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000361715_chr3_193332512_+_3255nt
ATGGTGAGATGTGTCCCTTCCGCCGTGATTGTGTGTTTCCTGAGGCCTCCCCAGCCAGGCAGAACTGTCATCTTCCACGATGTTGCTGTG
CTGACGGATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTC
CTCTCGGTCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGG
GAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAG
TCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCAT
CCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTC
TCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTA
GGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATT
GTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGGTCACAAATTGGTTAGTGAAGTCATAGGAGCTTCTGACCTACTTCTC
TTGTTAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGGTCTGCTTGGTGAG
CTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCGCGCAGAGCCGCTGGCCAATATAGCACGAGCTATGCCCAACAGAAG
CGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTA
GAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGAC
ATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGAT
CAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCA
GTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTT
GCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTA
AAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAA
ACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGT
ATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTA
GCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGG
AACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCA
CACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGT
TTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAA
GCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAA
AGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAG
CTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACA
GAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGAC
TTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTAT
TTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTA
TACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCA
GCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACT
TGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCAT
TTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAA
CAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAA
TTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTTGATGCTTTCATTGAAGCTCTT

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000361908_chr3_193332512_+_3309nt
ATGGTGAGATGTGTCCCTTCCGCCGTGATTGTGTGTTTCCTGAGGCCTCCCCAGCCAGGCAGAACTGTCATCTTCCACGATGTTGCTGTG
CTGACGGATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTC
CTCTCGGTCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGG
GAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAG
TCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCAT
CCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTC
TCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTA
GGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATT
GTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTTGTAAAGTTA
GCACCAGACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTTCTCCGGAAGAAACGGCGTTTAGAGCA
ACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGGTCTGCTTGGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAA
GAGGAAGCGCGCAGAGCCGCTGGCCAATATAGCACGAGCTATGCCCAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTT
CAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTG
CAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTAT
GATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATT
GCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTG
GCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGG
AAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGAC
TTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAAT
CCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCAT
GGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGA
AAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATAT
GAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTA
TCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGG
AAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTG
AGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTT
CCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAA
GCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGAT
AAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAAT
GCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGAT
ACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCAC
AATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGG
AAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACA
GCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTC
TTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAA
AATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGAC

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000392438_chr3_193332512_+_3198nt
ATGGTGAGATGTGTCCCTTCCGCCGTGATTGTGTGTTTCCTGAGGCCTCCCCAGCCAGGCAGAACTGTCATCTTCCACGATGTTGCTGTG
CTGACGGATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTC
CTCTCGGTCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGG
GAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAG
TCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCAT
CCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTC
TCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTA
GGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATT
GTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTTGTAAAGTTA
GCACCAGACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTTCTCCGGAAGAAACGGCGTTTAGAGCA
ACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACT
CAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATT
CATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAA
GATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCA
AGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCT
CGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGT
ACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACT
GTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGT
ATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTT
TTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCT
TTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAAT
TCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATG
GTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTG
CGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACAT
TGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAAT
TCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAG
ACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAG
GAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATA
TCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAAC
ATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTG
GAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGA
GTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTT
TGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGC
ATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAA
GATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATT

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000361828_chr3_193332512_+_3081nt
ATGTGGCCACCTCGCTGCAAGGATCCAGGAAGGCAGAGTGCGGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACC
AACATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAG
GTCTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCAT
TCACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAA
CTGAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTAT
CTCATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATAT
AAATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTT
GTAAAGTTAGCACCAGACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTCACAAATTGGTTAGTGAA
GTCATAGGAGCTTCTGACCTACTTCTCTTGTTAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAG
CATTTTAGAAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAA
CGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTG
ATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTT
GGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACACGT
TCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAA
GATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTA
AATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTGACACA
AAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGAA
CGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAA
AATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGA
AAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTA
AAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCT
GATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTT
GAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTG
TGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAGTGGAT
ATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTT
ATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGG
AATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATGCAGCT
ATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGG
TGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAG
CACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAG
GATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAA
AGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATACTTTA
AGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAG
ATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTTGATGCTTTCATTGAA

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000361510_chr3_193332512_+_3192nt
ATGTGGCCACCTCGCTGCAAGGATCCAGGAAGGCAGAGTGCGGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACC
AACATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAG
GTCTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCAT
TCACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAA
CTGAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTAT
CTCATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATAT
AAATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTT
GTAAAGTTAGCACCAGACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTCACAAATTGGTTAGTGAA
GTCATAGGAGCTTCTGACCTACTTCTCTTGTTAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAG
CATTTTAGAAAGGGTCTGCTTGGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCGCGCAGAGCCGCTGGCCAA
TATAGCACGAGCTATGCCCAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTG
AAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCAT
AGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCAT
CTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGA
TCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAG
TTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTT
AGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACA
TCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAA
GATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACC
AAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGT
TATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAG
CTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGA
GAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAA
CTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAG
GAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGA
ACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTA
CAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAA
AGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGAT
AAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTG
GGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAG
ATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAA
GTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGA
AGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTT
GCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTT
GCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAA

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000361150_chr3_193332512_+_3030nt
ATGTGGCCACCTCGCTGCAAGGATCCAGGAAGGCAGAGTGCGGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACC
AACATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAG
GTCTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCAT
TCACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAA
CTGAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTAT
CTCATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATAT
AAATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGT
GGATCTGAAAGTGACAAGCATTTTAGAAAGGGTCTGCTTGGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCG
CGCAGAGCCGCTGGCCAATATAGCACGAGCTATGCCCAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAA
CTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGAT
GACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGT
TATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCT
CGAATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTT
AAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTG
AAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGT
GTGATTAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCC
ATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGA
ACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTC
CCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAG
TTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGC
TTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAAC
TATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTT
ACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCG
CAGACCATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAG
GTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAA
GAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAA
GACCGATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAAT
GCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACC
AAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTT
GAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAAC
CATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGG
CGTATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAA
GAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAA

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000361715_chr3_193332512_+_3084nt
ATGTGGCCACCTCGCTGCAAGGATCCAGGAAGGCAGAGTGCGGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACC
AACATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAG
GTCTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCAT
TCACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAA
CTGAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTAT
CTCATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATAT
AAATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGGTCACAAATTGGTTAGTGAAGTCATAGGAGCTTCTGAC
CTACTTCTCTTGTTAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGGTCTG
CTTGGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCGCGCAGAGCCGCTGGCCAATATAGCACGAGCTATGCC
CAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTG
GAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCT
TTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTG
GTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACA
CGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAA
GAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCC
TTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTGAC
ACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATGCT
GAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAG
AAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACA
GGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATG
CTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAG
GCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTA
TTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAATCT
TTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAGTG
GATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGC
TTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAG
TGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATGCA
GCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAG
AGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAG
GAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATT
AAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTAC
CAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATACT
TTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAG
AAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTTGATGCTTTCATT

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000361908_chr3_193332512_+_3138nt
ATGTGGCCACCTCGCTGCAAGGATCCAGGAAGGCAGAGTGCGGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACC
AACATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAG
GTCTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCAT
TCACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAA
CTGAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTAT
CTCATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATAT
AAATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTT
GTAAAGTTAGCACCAGACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTTCTCCGGAAGAAACGGCG
TTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGGTCTGCTTGGTGAGCTCATTCTCTTACAACAACAAATTCAA
GAGCATGAAGAGGAAGCGCGCAGAGCCGCTGGCCAATATAGCACGAGCTATGCCCAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATT
GACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAA
TTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTC
TCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTG
GAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCT
CACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTT
CGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTG
CTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTAC
ATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATG
GACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATA
ATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATA
AGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGC
CTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAA
ACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTT
ATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAAC
ATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTT
CCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGAC
ATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATT
CAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGT
CTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAG
TGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACC
ACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTT
TTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAAT
GATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGA
TTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTG

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000392438_chr3_193332512_+_3027nt
ATGTGGCCACCTCGCTGCAAGGATCCAGGAAGGCAGAGTGCGGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACC
AACATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAG
GTCTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCAT
TCACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAA
CTGAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTAT
CTCATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATAT
AAATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTT
GTAAAGTTAGCACCAGACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTTCTCCGGAAGAAACGGCG
TTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTT
CTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGAC
AAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTAT
AATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGA
ATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAA
GATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAA
GAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTG
ATTAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATC
ATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACC
ATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCA
ATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTT
TTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTT
TGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTAT
CCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACA
CCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAG
ACCATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTT
GCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAG
GCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGAC
CGATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCA
ATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAG
AATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAA
TCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCAT
TGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGT
ATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAG
GTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000361828_chr3_193332512_+_7009nt
CCCCTTTCATGGCCGCCGCCTGGCGCCGGGGCTAAGTGGCCGCCGGCGTCCGGGTACCCGAGGGCTCTCCCGCGTTGCTGGCACCGCTGG
CGCCGCGGTCTCGTAGCGCATGGGCCTCCTCCGAGGCGGGCTCCCATGCGCTCGGGCCATGGCGCGCCTGGGCGCTGTGCGCTCCCACTA
CTGCGCCCTGCTGCTGGCCGCGGCGCTGGCCGTCTGCGCCTTCTACTACCTCGGCTCAGGCCGGGAGACCTTCTCCAGCGCCACCAAGAG
GCTGAAGGAGGCCCGCGCCGGGGCTCCCGCCGCGCCCTCGCCGCCCGCGCTGGAGCTAGCGCGGGGCTCCGTGGCGCCAGCCCCCGGCGC
GAAGGCCAAGAGCTTGGAGGGCGGCGGTGCCGGGCCGGTGGACTACCACCTGCTGATGATGTTCACCAAGGCGGAGCACAATGCCGCGCT
GCAGGCCAAGGCCCGCGTCGCGCTGCGCTCACTGCTGCGCCTCGCCAAGTTCGAGGCGCACGAGGTGCTTAACCTTCACTTCGTGAGCGA
GGAGGCCAGCCGCGAGGTGGCCAAGGGCCTGCTGCGGGAGCTCCTGCCGCCCGCCGCTGGCTTCAAGTGCAAGGTCATCTTCCACGATGT
TGCTGTGCTGACGGATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCAT
CTTCTTCCTCTCGGTCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAA
CATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGT
CTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTC
ACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACT
GAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCT
CATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAA
ATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTTGT
AAAGTTAGCACCAGACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTCACAAATTGGTTAGTGAAGT
CATAGGAGCTTCTGACCTACTTCTCTTGTTAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCA
TTTTAGAAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACG
ATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGAT
TGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGG
AGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTC
TCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGA
TCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAA
TGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTGACACAAA
GGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACG
CAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAA
TGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAA
AGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAA
GGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGA
TAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGA
AAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTG
GGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAGTGGATAT
CAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTAT
GACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAA
TGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATGCAGCTAT
TTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTG
GTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCA
CCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGA
TACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAG
GCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAG
GCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGAT
TAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTTGATGCTTTCATTGAAGC
TCTTCATCAGGAGAAATAAATTAAAATCGTACTCATAATCAGCTCTGCATACATCTGAAGAACAAAAACATCAACGTCTTTTGTCCAGCC
TCTTTTTCTTCTGCTGTTCCACCTTTCTAAACATACAATAAAGTCATGGGATAAAAATAATCGATGTATGTTACGGGCGCTTTAACCATC
AGCTGCCTCTCGAATGGAAGAACAGTGGTAATGGATTAACATCCTATTTTGTTGTACTAAAGTGACAAATCGGAATAATATAATTGGTAT
GGCCATTAGGTTCAGTCCTTGAAGATAAGAAACTTGTTCTCTGTTTGTTGTCTTATTTGTGGTGGCACTCGTTTAATGGATTAACTGAGG
TTGCTCAATGTTCAGTTTCTTTTCCAGAAATACAATGCTAGGTGTTTTGAAATAAAACTTATATAGCAATTGTTTAAAGTTATCAATTGT
ATATAAAATCACAGTAGCCTGCTAAATCATTGTATGTGTCTGTAGTATTCTATTCCCAGAAACTATTTGACCATGATAATTCAGTTTATA
TTCACCACATGAAAGAAAAATGGGTAACAGAAGAACCCTTAAAACAGGTTAATTTGGATTGTAACGTTCAGTGAAAGAAATTTCAACCCT
TCATAGCCAGCGAAGAAATTTGCCTTGGAAGCCAAGTCAGTACCAGCTTACCTATTTGATTCAGTTGCTGTTTTCTCACTCTCTATATCC
ATTTGAAATTGATTTATTTTAGATGTTGTATACTTACGTTAGGCTTTCTGTTAATAGTGGTTTTTCTCCTGTTGACAGAGCCACCGGATT
ATGACACAGGATGAGGAAGATTAAGGATAATCAATTGACTAATTTCATTTAGAATATTATCAAACATTTCAACTAGGTATCAGAAAAAGG
CTTTCTTTCATAAGACTATTTTAAATAGAAATTATTTCAACAATTAAAGTAATGTTGACCATCCCCCTCTCAGCTGAATAAAGAAAAATT
TAGTTCAATTTATTGCAATTTAATTACAATACTACCTTCACAACATTTTCATGTGTTTTAAATAAATATTTTTTAATTGGCTAAAGGACA
TTCAAGCAAAGAAATGCTTTCTTTACTTAAAATGTCTATCTCATTTGCTGCCTTTTCACTAAGCCTTTACTTTGTTAATAAAAGTGTCCA
TTGTGTGATGTTTTTGATTTTACAGTTTGCTAAATCTTATTTTCTTGGAGTTGCTTTTTGGTAACAGCCCCATTGCTACTCCCCATTTTA
TTGTTTTACATCAATGCATGCTTCGTTGTGATCCCTCAAGATGTAACACTTGGTATGCTCGGTTGAGGATATGAAAAAATACTTCCGAAA
CCAGGAATTCAATGTATGTTTGTTTTATACTGTTTGATAAGAAAAGTAGGTCCAGCCTTAAGCAGCACAGATGCGCTGGTAGATGCATAG
TCAGGAACTTTTTTTATTTCTTTTAGGTCTAGGGACAGGAGTGAATAGAAAGGGAGGAGAGCTCTATTATGTTCTATACACAGATTAGGA
GATGACCTTACTGGGTACACCCCTCTAACCAGTGCTTACAGGTTAATGCATGTTAATGAATATTTTTGCAGTTGTAAAGCATAACAATTA
CAACTACACATCTATTTCTAAAGAATAAAACAGGACCATATTTATTTACTTCTGTCAACTATAGAAAGAAAGACCTTCAGCTGTATTTCC
ACAGATTTCTCCCAAGGAAAAGGCTAATATTAGTCACTACTGTTATCACATCCCTTTGTATAAGTTTTAAAAAGAGATGGAGGGAGATCT
TCATTTCTTTGAGGAGATCAGTATTGTAACGTATGTGAATAGATGATAACAATTAATATTACTAAAAGTCCCACATGAGAGTCCTGACGC
CCTCTCCATGCCCCACAGTAATGTGGCTTCTTTCATGGGTTTTTTTTTCTTCTTTTTAGCTGATCTCATCCTAAGCATGCTTTATTTTTC
CTTGAAAGCTAGGTATTTATCAACTGCAGATGTTATTGAAAGAAAATAAAATTCAGTCTCAAGAGTAAACCCTGTGTCTTGTGTCTGTAG
TTCAAAAGTCAGAAATGATTCTAATTTAAACAAAAAGATACTAAATATACAGAAGTTAAATTCGAACTAGCCACAGAATCATTTGTTTTT
ATGTCAGAATTTGCAAAGAGTGGAGTGGACAAAGCTCTGTATGGAAGACTGAACAACTGTAAATAGATGATATCCAAACTTAATTTGGCT
AGGACTTCAATTTTAAAAATCAGTGTACCTAGGCAGTGCACAGCACGAAATAAGTGGCCCTTGCAGCTTCCCCGTTTAACCCACTGTGCT
ATAGTTGCGGGTGGAACAGTCAACCTTTCTAGTAGTTTATGATATTGCCCTCTTTGTATTCCCATTTTCTACAGTTTTTTCCGCAGACTT
CTTTCTGCAAATTATTCAGCCTCCAAATGCAAATGAATGATATAAAAATAAGTAGGGAACATGGCAGAGAGTGGTGCTTCCCAGCCTCAC
AATGTGGGAATTTGACATAGGATGAGAGTCAGAGTATAGGTTTAAAAGATAAAATCTTTAGTTAATAATTTTGTATTTATTTATTCTAGA
TGTATGTATCTGAGGAAAGAAATCTGGTATTTTTGCTTTCCAATAAAGGGGATCAAAGTAATGGTTTTTCTCTCAGTTCTCTAAGCTGGT
CTATGTTATAGCTCTAGCAGTATGGAAATGTGCTTTAAAATATGCTTACCTTTTGAATGATCATGGCTATATGTTGTTGAGATATTTGAA
ACTTACCTTGTTTTCACTTGTGCACTGTGAATGAACTTTGTATTATTTTTTTAAAACCTTCACATTACGTGTAGATATTATTGCAACTTA
TATTTTGCCTGAGCTTGATCAAAGGTCATTTGTGTAGATGAGTAATTAAAAAATATTTAAATCACATTATAATTCTATTATTGGAGAGCA
TCTTTTAAATTTTTTTCTGTTTTAACGAGGGAAAGAGAAACCTGTATACCTAGGGTCATTATTTGACCCCATAGTATAACCAGATTCATG
GTCTAACAAGCTCTCAGTGTGGCTTTTCTCTGAATGCTTGAATTTCACATGCCTTGCATTTCACAGTTGTACTCCATGGTCAACCGGTGC

>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000361510_chr3_193332512_+_7120nt
CCCCTTTCATGGCCGCCGCCTGGCGCCGGGGCTAAGTGGCCGCCGGCGTCCGGGTACCCGAGGGCTCTCCCGCGTTGCTGGCACCGCTGG
CGCCGCGGTCTCGTAGCGCATGGGCCTCCTCCGAGGCGGGCTCCCATGCGCTCGGGCCATGGCGCGCCTGGGCGCTGTGCGCTCCCACTA
CTGCGCCCTGCTGCTGGCCGCGGCGCTGGCCGTCTGCGCCTTCTACTACCTCGGCTCAGGCCGGGAGACCTTCTCCAGCGCCACCAAGAG
GCTGAAGGAGGCCCGCGCCGGGGCTCCCGCCGCGCCCTCGCCGCCCGCGCTGGAGCTAGCGCGGGGCTCCGTGGCGCCAGCCCCCGGCGC
GAAGGCCAAGAGCTTGGAGGGCGGCGGTGCCGGGCCGGTGGACTACCACCTGCTGATGATGTTCACCAAGGCGGAGCACAATGCCGCGCT
GCAGGCCAAGGCCCGCGTCGCGCTGCGCTCACTGCTGCGCCTCGCCAAGTTCGAGGCGCACGAGGTGCTTAACCTTCACTTCGTGAGCGA
GGAGGCCAGCCGCGAGGTGGCCAAGGGCCTGCTGCGGGAGCTCCTGCCGCCCGCCGCTGGCTTCAAGTGCAAGGTCATCTTCCACGATGT
TGCTGTGCTGACGGATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCAT
CTTCTTCCTCTCGGTCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAA
CATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGT
CTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTC
ACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACT
GAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCT
CATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAA
ATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTTGT
AAAGTTAGCACCAGACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTCACAAATTGGTTAGTGAAGT
CATAGGAGCTTCTGACCTACTTCTCTTGTTAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCA
TTTTAGAAAGGGTCTGCTTGGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCGCGCAGAGCCGCTGGCCAATA
TAGCACGAGCTATGCCCAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAA
GTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAG
AAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCT
GCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATC
TGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTT
TGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAG
CCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATC
AGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGA
TGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAA
AGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTA
TTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCT
CCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGA
GTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACT
TGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGA
AATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAAC
TTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACA
AGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAG
TATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAA
ACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGG
TCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGAT
GTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGT
AGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAG
AGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGC
TATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGC
TGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAA
ACTTGATGCTTTCATTGAAGCTCTTCATCAGGAGAAATAAATTAAAATCGTACTCATAATCAGCTCTGCATACATCTGAAGAACAAAAAC
ATCAACGTCTTTTGTCCAGCCTCTTTTTCTTCTGCTGTTCCACCTTTCTAAACATACAATAAAGTCATGGGATAAAAATAATCGATGTAT
GTTACGGGCGCTTTAACCATCAGCTGCCTCTCGAATGGAAGAACAGTGGTAATGGATTAACATCCTATTTTGTTGTACTAAAGTGACAAA
TCGGAATAATATAATTGGTATGGCCATTAGGTTCAGTCCTTGAAGATAAGAAACTTGTTCTCTGTTTGTTGTCTTATTTGTGGTGGCACT
CGTTTAATGGATTAACTGAGGTTGCTCAATGTTCAGTTTCTTTTCCAGAAATACAATGCTAGGTGTTTTGAAATAAAACTTATATAGCAA
TTGTTTAAAGTTATCAATTGTATATAAAATCACAGTAGCCTGCTAAATCATTGTATGTGTCTGTAGTATTCTATTCCCAGAAACTATTTG
ACCATGATAATTCAGTTTATATTCACCACATGAAAGAAAAATGGGTAACAGAAGAACCCTTAAAACAGGTTAATTTGGATTGTAACGTTC
AGTGAAAGAAATTTCAACCCTTCATAGCCAGCGAAGAAATTTGCCTTGGAAGCCAAGTCAGTACCAGCTTACCTATTTGATTCAGTTGCT
GTTTTCTCACTCTCTATATCCATTTGAAATTGATTTATTTTAGATGTTGTATACTTACGTTAGGCTTTCTGTTAATAGTGGTTTTTCTCC
TGTTGACAGAGCCACCGGATTATGACACAGGATGAGGAAGATTAAGGATAATCAATTGACTAATTTCATTTAGAATATTATCAAACATTT
CAACTAGGTATCAGAAAAAGGCTTTCTTTCATAAGACTATTTTAAATAGAAATTATTTCAACAATTAAAGTAATGTTGACCATCCCCCTC
TCAGCTGAATAAAGAAAAATTTAGTTCAATTTATTGCAATTTAATTACAATACTACCTTCACAACATTTTCATGTGTTTTAAATAAATAT
TTTTTAATTGGCTAAAGGACATTCAAGCAAAGAAATGCTTTCTTTACTTAAAATGTCTATCTCATTTGCTGCCTTTTCACTAAGCCTTTA
CTTTGTTAATAAAAGTGTCCATTGTGTGATGTTTTTGATTTTACAGTTTGCTAAATCTTATTTTCTTGGAGTTGCTTTTTGGTAACAGCC
CCATTGCTACTCCCCATTTTATTGTTTTACATCAATGCATGCTTCGTTGTGATCCCTCAAGATGTAACACTTGGTATGCTCGGTTGAGGA
TATGAAAAAATACTTCCGAAACCAGGAATTCAATGTATGTTTGTTTTATACTGTTTGATAAGAAAAGTAGGTCCAGCCTTAAGCAGCACA
GATGCGCTGGTAGATGCATAGTCAGGAACTTTTTTTATTTCTTTTAGGTCTAGGGACAGGAGTGAATAGAAAGGGAGGAGAGCTCTATTA
TGTTCTATACACAGATTAGGAGATGACCTTACTGGGTACACCCCTCTAACCAGTGCTTACAGGTTAATGCATGTTAATGAATATTTTTGC
AGTTGTAAAGCATAACAATTACAACTACACATCTATTTCTAAAGAATAAAACAGGACCATATTTATTTACTTCTGTCAACTATAGAAAGA
AAGACCTTCAGCTGTATTTCCACAGATTTCTCCCAAGGAAAAGGCTAATATTAGTCACTACTGTTATCACATCCCTTTGTATAAGTTTTA
AAAAGAGATGGAGGGAGATCTTCATTTCTTTGAGGAGATCAGTATTGTAACGTATGTGAATAGATGATAACAATTAATATTACTAAAAGT
CCCACATGAGAGTCCTGACGCCCTCTCCATGCCCCACAGTAATGTGGCTTCTTTCATGGGTTTTTTTTTCTTCTTTTTAGCTGATCTCAT
CCTAAGCATGCTTTATTTTTCCTTGAAAGCTAGGTATTTATCAACTGCAGATGTTATTGAAAGAAAATAAAATTCAGTCTCAAGAGTAAA
CCCTGTGTCTTGTGTCTGTAGTTCAAAAGTCAGAAATGATTCTAATTTAAACAAAAAGATACTAAATATACAGAAGTTAAATTCGAACTA
GCCACAGAATCATTTGTTTTTATGTCAGAATTTGCAAAGAGTGGAGTGGACAAAGCTCTGTATGGAAGACTGAACAACTGTAAATAGATG
ATATCCAAACTTAATTTGGCTAGGACTTCAATTTTAAAAATCAGTGTACCTAGGCAGTGCACAGCACGAAATAAGTGGCCCTTGCAGCTT
CCCCGTTTAACCCACTGTGCTATAGTTGCGGGTGGAACAGTCAACCTTTCTAGTAGTTTATGATATTGCCCTCTTTGTATTCCCATTTTC
TACAGTTTTTTCCGCAGACTTCTTTCTGCAAATTATTCAGCCTCCAAATGCAAATGAATGATATAAAAATAAGTAGGGAACATGGCAGAG
AGTGGTGCTTCCCAGCCTCACAATGTGGGAATTTGACATAGGATGAGAGTCAGAGTATAGGTTTAAAAGATAAAATCTTTAGTTAATAAT
TTTGTATTTATTTATTCTAGATGTATGTATCTGAGGAAAGAAATCTGGTATTTTTGCTTTCCAATAAAGGGGATCAAAGTAATGGTTTTT
CTCTCAGTTCTCTAAGCTGGTCTATGTTATAGCTCTAGCAGTATGGAAATGTGCTTTAAAATATGCTTACCTTTTGAATGATCATGGCTA
TATGTTGTTGAGATATTTGAAACTTACCTTGTTTTCACTTGTGCACTGTGAATGAACTTTGTATTATTTTTTTAAAACCTTCACATTACG
TGTAGATATTATTGCAACTTATATTTTGCCTGAGCTTGATCAAAGGTCATTTGTGTAGATGAGTAATTAAAAAATATTTAAATCACATTA
TAATTCTATTATTGGAGAGCATCTTTTAAATTTTTTTCTGTTTTAACGAGGGAAAGAGAAACCTGTATACCTAGGGTCATTATTTGACCC
CATAGTATAACCAGATTCATGGTCTAACAAGCTCTCAGTGTGGCTTTTCTCTGAATGCTTGAATTTCACATGCCTTGCATTTCACAGTTG
TACTCCATGGTCAACCGGTGCTTTTTTTCACATCGTGGTACTTGTCAAAACATTTTGTTATTTTCCTTGGTAAAATATATAAAAAAGGTT

>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000361150_chr3_193332512_+_6958nt
CCCCTTTCATGGCCGCCGCCTGGCGCCGGGGCTAAGTGGCCGCCGGCGTCCGGGTACCCGAGGGCTCTCCCGCGTTGCTGGCACCGCTGG
CGCCGCGGTCTCGTAGCGCATGGGCCTCCTCCGAGGCGGGCTCCCATGCGCTCGGGCCATGGCGCGCCTGGGCGCTGTGCGCTCCCACTA
CTGCGCCCTGCTGCTGGCCGCGGCGCTGGCCGTCTGCGCCTTCTACTACCTCGGCTCAGGCCGGGAGACCTTCTCCAGCGCCACCAAGAG
GCTGAAGGAGGCCCGCGCCGGGGCTCCCGCCGCGCCCTCGCCGCCCGCGCTGGAGCTAGCGCGGGGCTCCGTGGCGCCAGCCCCCGGCGC
GAAGGCCAAGAGCTTGGAGGGCGGCGGTGCCGGGCCGGTGGACTACCACCTGCTGATGATGTTCACCAAGGCGGAGCACAATGCCGCGCT
GCAGGCCAAGGCCCGCGTCGCGCTGCGCTCACTGCTGCGCCTCGCCAAGTTCGAGGCGCACGAGGTGCTTAACCTTCACTTCGTGAGCGA
GGAGGCCAGCCGCGAGGTGGCCAAGGGCCTGCTGCGGGAGCTCCTGCCGCCCGCCGCTGGCTTCAAGTGCAAGGTCATCTTCCACGATGT
TGCTGTGCTGACGGATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCAT
CTTCTTCCTCTCGGTCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAA
CATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGT
CTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTC
ACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACT
GAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCT
CATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAA
ATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGG
ATCTGAAAGTGACAAGCATTTTAGAAAGGGTCTGCTTGGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCGCG
CAGAGCCGCTGGCCAATATAGCACGAGCTATGCCCAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACT
TCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGA
CAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTA
TAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCG
AATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAA
AGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAA
AGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGT
GATTAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCAT
CATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAAC
CATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCC
AATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTT
TTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTT
TTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTA
TCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTAC
ACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCA
GACCATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGT
TGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGA
GGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGA
CCGATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGC
AATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAA
GAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGA
ATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCA
TTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCG
TATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGA
GGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGT
TAGAGAAATTCAAGAAAAACTTGATGCTTTCATTGAAGCTCTTCATCAGGAGAAATAAATTAAAATCGTACTCATAATCAGCTCTGCATA
CATCTGAAGAACAAAAACATCAACGTCTTTTGTCCAGCCTCTTTTTCTTCTGCTGTTCCACCTTTCTAAACATACAATAAAGTCATGGGA
TAAAAATAATCGATGTATGTTACGGGCGCTTTAACCATCAGCTGCCTCTCGAATGGAAGAACAGTGGTAATGGATTAACATCCTATTTTG
TTGTACTAAAGTGACAAATCGGAATAATATAATTGGTATGGCCATTAGGTTCAGTCCTTGAAGATAAGAAACTTGTTCTCTGTTTGTTGT
CTTATTTGTGGTGGCACTCGTTTAATGGATTAACTGAGGTTGCTCAATGTTCAGTTTCTTTTCCAGAAATACAATGCTAGGTGTTTTGAA
ATAAAACTTATATAGCAATTGTTTAAAGTTATCAATTGTATATAAAATCACAGTAGCCTGCTAAATCATTGTATGTGTCTGTAGTATTCT
ATTCCCAGAAACTATTTGACCATGATAATTCAGTTTATATTCACCACATGAAAGAAAAATGGGTAACAGAAGAACCCTTAAAACAGGTTA
ATTTGGATTGTAACGTTCAGTGAAAGAAATTTCAACCCTTCATAGCCAGCGAAGAAATTTGCCTTGGAAGCCAAGTCAGTACCAGCTTAC
CTATTTGATTCAGTTGCTGTTTTCTCACTCTCTATATCCATTTGAAATTGATTTATTTTAGATGTTGTATACTTACGTTAGGCTTTCTGT
TAATAGTGGTTTTTCTCCTGTTGACAGAGCCACCGGATTATGACACAGGATGAGGAAGATTAAGGATAATCAATTGACTAATTTCATTTA
GAATATTATCAAACATTTCAACTAGGTATCAGAAAAAGGCTTTCTTTCATAAGACTATTTTAAATAGAAATTATTTCAACAATTAAAGTA
ATGTTGACCATCCCCCTCTCAGCTGAATAAAGAAAAATTTAGTTCAATTTATTGCAATTTAATTACAATACTACCTTCACAACATTTTCA
TGTGTTTTAAATAAATATTTTTTAATTGGCTAAAGGACATTCAAGCAAAGAAATGCTTTCTTTACTTAAAATGTCTATCTCATTTGCTGC
CTTTTCACTAAGCCTTTACTTTGTTAATAAAAGTGTCCATTGTGTGATGTTTTTGATTTTACAGTTTGCTAAATCTTATTTTCTTGGAGT
TGCTTTTTGGTAACAGCCCCATTGCTACTCCCCATTTTATTGTTTTACATCAATGCATGCTTCGTTGTGATCCCTCAAGATGTAACACTT
GGTATGCTCGGTTGAGGATATGAAAAAATACTTCCGAAACCAGGAATTCAATGTATGTTTGTTTTATACTGTTTGATAAGAAAAGTAGGT
CCAGCCTTAAGCAGCACAGATGCGCTGGTAGATGCATAGTCAGGAACTTTTTTTATTTCTTTTAGGTCTAGGGACAGGAGTGAATAGAAA
GGGAGGAGAGCTCTATTATGTTCTATACACAGATTAGGAGATGACCTTACTGGGTACACCCCTCTAACCAGTGCTTACAGGTTAATGCAT
GTTAATGAATATTTTTGCAGTTGTAAAGCATAACAATTACAACTACACATCTATTTCTAAAGAATAAAACAGGACCATATTTATTTACTT
CTGTCAACTATAGAAAGAAAGACCTTCAGCTGTATTTCCACAGATTTCTCCCAAGGAAAAGGCTAATATTAGTCACTACTGTTATCACAT
CCCTTTGTATAAGTTTTAAAAAGAGATGGAGGGAGATCTTCATTTCTTTGAGGAGATCAGTATTGTAACGTATGTGAATAGATGATAACA
ATTAATATTACTAAAAGTCCCACATGAGAGTCCTGACGCCCTCTCCATGCCCCACAGTAATGTGGCTTCTTTCATGGGTTTTTTTTTCTT
CTTTTTAGCTGATCTCATCCTAAGCATGCTTTATTTTTCCTTGAAAGCTAGGTATTTATCAACTGCAGATGTTATTGAAAGAAAATAAAA
TTCAGTCTCAAGAGTAAACCCTGTGTCTTGTGTCTGTAGTTCAAAAGTCAGAAATGATTCTAATTTAAACAAAAAGATACTAAATATACA
GAAGTTAAATTCGAACTAGCCACAGAATCATTTGTTTTTATGTCAGAATTTGCAAAGAGTGGAGTGGACAAAGCTCTGTATGGAAGACTG
AACAACTGTAAATAGATGATATCCAAACTTAATTTGGCTAGGACTTCAATTTTAAAAATCAGTGTACCTAGGCAGTGCACAGCACGAAAT
AAGTGGCCCTTGCAGCTTCCCCGTTTAACCCACTGTGCTATAGTTGCGGGTGGAACAGTCAACCTTTCTAGTAGTTTATGATATTGCCCT
CTTTGTATTCCCATTTTCTACAGTTTTTTCCGCAGACTTCTTTCTGCAAATTATTCAGCCTCCAAATGCAAATGAATGATATAAAAATAA
GTAGGGAACATGGCAGAGAGTGGTGCTTCCCAGCCTCACAATGTGGGAATTTGACATAGGATGAGAGTCAGAGTATAGGTTTAAAAGATA
AAATCTTTAGTTAATAATTTTGTATTTATTTATTCTAGATGTATGTATCTGAGGAAAGAAATCTGGTATTTTTGCTTTCCAATAAAGGGG
ATCAAAGTAATGGTTTTTCTCTCAGTTCTCTAAGCTGGTCTATGTTATAGCTCTAGCAGTATGGAAATGTGCTTTAAAATATGCTTACCT
TTTGAATGATCATGGCTATATGTTGTTGAGATATTTGAAACTTACCTTGTTTTCACTTGTGCACTGTGAATGAACTTTGTATTATTTTTT
TAAAACCTTCACATTACGTGTAGATATTATTGCAACTTATATTTTGCCTGAGCTTGATCAAAGGTCATTTGTGTAGATGAGTAATTAAAA
AATATTTAAATCACATTATAATTCTATTATTGGAGAGCATCTTTTAAATTTTTTTCTGTTTTAACGAGGGAAAGAGAAACCTGTATACCT
AGGGTCATTATTTGACCCCATAGTATAACCAGATTCATGGTCTAACAAGCTCTCAGTGTGGCTTTTCTCTGAATGCTTGAATTTCACATG
CCTTGCATTTCACAGTTGTACTCCATGGTCAACCGGTGCTTTTTTTCACATCGTGGTACTTGTCAAAACATTTTGTTATTTTCCTTGGTA

>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000361715_chr3_193332512_+_7012nt
CCCCTTTCATGGCCGCCGCCTGGCGCCGGGGCTAAGTGGCCGCCGGCGTCCGGGTACCCGAGGGCTCTCCCGCGTTGCTGGCACCGCTGG
CGCCGCGGTCTCGTAGCGCATGGGCCTCCTCCGAGGCGGGCTCCCATGCGCTCGGGCCATGGCGCGCCTGGGCGCTGTGCGCTCCCACTA
CTGCGCCCTGCTGCTGGCCGCGGCGCTGGCCGTCTGCGCCTTCTACTACCTCGGCTCAGGCCGGGAGACCTTCTCCAGCGCCACCAAGAG
GCTGAAGGAGGCCCGCGCCGGGGCTCCCGCCGCGCCCTCGCCGCCCGCGCTGGAGCTAGCGCGGGGCTCCGTGGCGCCAGCCCCCGGCGC
GAAGGCCAAGAGCTTGGAGGGCGGCGGTGCCGGGCCGGTGGACTACCACCTGCTGATGATGTTCACCAAGGCGGAGCACAATGCCGCGCT
GCAGGCCAAGGCCCGCGTCGCGCTGCGCTCACTGCTGCGCCTCGCCAAGTTCGAGGCGCACGAGGTGCTTAACCTTCACTTCGTGAGCGA
GGAGGCCAGCCGCGAGGTGGCCAAGGGCCTGCTGCGGGAGCTCCTGCCGCCCGCCGCTGGCTTCAAGTGCAAGGTCATCTTCCACGATGT
TGCTGTGCTGACGGATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCAT
CTTCTTCCTCTCGGTCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAA
CATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGT
CTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTC
ACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACT
GAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCT
CATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAA
ATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGGTCACAAATTGGTTAGTGAAGTCATAGGAGCTTCTGACCT
ACTTCTCTTGTTAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGGTCTGCT
TGGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCGCGCAGAGCCGCTGGCCAATATAGCACGAGCTATGCCCA
ACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGA
ACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTT
GATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGT
TGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACACG
TTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGA
AGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTT
AAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTGACAC
AAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGA
ACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAA
AAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGG
AAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCT
AAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGC
TGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATT
TGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTT
GTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAGTGGA
TATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTT
TATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTG
GAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATGCAGC
TATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAG
GTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGA
GCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAA
GGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCA
AAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATACTTT
AAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAA
GATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTTGATGCTTTCATTGA
AGCTCTTCATCAGGAGAAATAAATTAAAATCGTACTCATAATCAGCTCTGCATACATCTGAAGAACAAAAACATCAACGTCTTTTGTCCA
GCCTCTTTTTCTTCTGCTGTTCCACCTTTCTAAACATACAATAAAGTCATGGGATAAAAATAATCGATGTATGTTACGGGCGCTTTAACC
ATCAGCTGCCTCTCGAATGGAAGAACAGTGGTAATGGATTAACATCCTATTTTGTTGTACTAAAGTGACAAATCGGAATAATATAATTGG
TATGGCCATTAGGTTCAGTCCTTGAAGATAAGAAACTTGTTCTCTGTTTGTTGTCTTATTTGTGGTGGCACTCGTTTAATGGATTAACTG
AGGTTGCTCAATGTTCAGTTTCTTTTCCAGAAATACAATGCTAGGTGTTTTGAAATAAAACTTATATAGCAATTGTTTAAAGTTATCAAT
TGTATATAAAATCACAGTAGCCTGCTAAATCATTGTATGTGTCTGTAGTATTCTATTCCCAGAAACTATTTGACCATGATAATTCAGTTT
ATATTCACCACATGAAAGAAAAATGGGTAACAGAAGAACCCTTAAAACAGGTTAATTTGGATTGTAACGTTCAGTGAAAGAAATTTCAAC
CCTTCATAGCCAGCGAAGAAATTTGCCTTGGAAGCCAAGTCAGTACCAGCTTACCTATTTGATTCAGTTGCTGTTTTCTCACTCTCTATA
TCCATTTGAAATTGATTTATTTTAGATGTTGTATACTTACGTTAGGCTTTCTGTTAATAGTGGTTTTTCTCCTGTTGACAGAGCCACCGG
ATTATGACACAGGATGAGGAAGATTAAGGATAATCAATTGACTAATTTCATTTAGAATATTATCAAACATTTCAACTAGGTATCAGAAAA
AGGCTTTCTTTCATAAGACTATTTTAAATAGAAATTATTTCAACAATTAAAGTAATGTTGACCATCCCCCTCTCAGCTGAATAAAGAAAA
ATTTAGTTCAATTTATTGCAATTTAATTACAATACTACCTTCACAACATTTTCATGTGTTTTAAATAAATATTTTTTAATTGGCTAAAGG
ACATTCAAGCAAAGAAATGCTTTCTTTACTTAAAATGTCTATCTCATTTGCTGCCTTTTCACTAAGCCTTTACTTTGTTAATAAAAGTGT
CCATTGTGTGATGTTTTTGATTTTACAGTTTGCTAAATCTTATTTTCTTGGAGTTGCTTTTTGGTAACAGCCCCATTGCTACTCCCCATT
TTATTGTTTTACATCAATGCATGCTTCGTTGTGATCCCTCAAGATGTAACACTTGGTATGCTCGGTTGAGGATATGAAAAAATACTTCCG
AAACCAGGAATTCAATGTATGTTTGTTTTATACTGTTTGATAAGAAAAGTAGGTCCAGCCTTAAGCAGCACAGATGCGCTGGTAGATGCA
TAGTCAGGAACTTTTTTTATTTCTTTTAGGTCTAGGGACAGGAGTGAATAGAAAGGGAGGAGAGCTCTATTATGTTCTATACACAGATTA
GGAGATGACCTTACTGGGTACACCCCTCTAACCAGTGCTTACAGGTTAATGCATGTTAATGAATATTTTTGCAGTTGTAAAGCATAACAA
TTACAACTACACATCTATTTCTAAAGAATAAAACAGGACCATATTTATTTACTTCTGTCAACTATAGAAAGAAAGACCTTCAGCTGTATT
TCCACAGATTTCTCCCAAGGAAAAGGCTAATATTAGTCACTACTGTTATCACATCCCTTTGTATAAGTTTTAAAAAGAGATGGAGGGAGA
TCTTCATTTCTTTGAGGAGATCAGTATTGTAACGTATGTGAATAGATGATAACAATTAATATTACTAAAAGTCCCACATGAGAGTCCTGA
CGCCCTCTCCATGCCCCACAGTAATGTGGCTTCTTTCATGGGTTTTTTTTTCTTCTTTTTAGCTGATCTCATCCTAAGCATGCTTTATTT
TTCCTTGAAAGCTAGGTATTTATCAACTGCAGATGTTATTGAAAGAAAATAAAATTCAGTCTCAAGAGTAAACCCTGTGTCTTGTGTCTG
TAGTTCAAAAGTCAGAAATGATTCTAATTTAAACAAAAAGATACTAAATATACAGAAGTTAAATTCGAACTAGCCACAGAATCATTTGTT
TTTATGTCAGAATTTGCAAAGAGTGGAGTGGACAAAGCTCTGTATGGAAGACTGAACAACTGTAAATAGATGATATCCAAACTTAATTTG
GCTAGGACTTCAATTTTAAAAATCAGTGTACCTAGGCAGTGCACAGCACGAAATAAGTGGCCCTTGCAGCTTCCCCGTTTAACCCACTGT
GCTATAGTTGCGGGTGGAACAGTCAACCTTTCTAGTAGTTTATGATATTGCCCTCTTTGTATTCCCATTTTCTACAGTTTTTTCCGCAGA
CTTCTTTCTGCAAATTATTCAGCCTCCAAATGCAAATGAATGATATAAAAATAAGTAGGGAACATGGCAGAGAGTGGTGCTTCCCAGCCT
CACAATGTGGGAATTTGACATAGGATGAGAGTCAGAGTATAGGTTTAAAAGATAAAATCTTTAGTTAATAATTTTGTATTTATTTATTCT
AGATGTATGTATCTGAGGAAAGAAATCTGGTATTTTTGCTTTCCAATAAAGGGGATCAAAGTAATGGTTTTTCTCTCAGTTCTCTAAGCT
GGTCTATGTTATAGCTCTAGCAGTATGGAAATGTGCTTTAAAATATGCTTACCTTTTGAATGATCATGGCTATATGTTGTTGAGATATTT
GAAACTTACCTTGTTTTCACTTGTGCACTGTGAATGAACTTTGTATTATTTTTTTAAAACCTTCACATTACGTGTAGATATTATTGCAAC
TTATATTTTGCCTGAGCTTGATCAAAGGTCATTTGTGTAGATGAGTAATTAAAAAATATTTAAATCACATTATAATTCTATTATTGGAGA
GCATCTTTTAAATTTTTTTCTGTTTTAACGAGGGAAAGAGAAACCTGTATACCTAGGGTCATTATTTGACCCCATAGTATAACCAGATTC
ATGGTCTAACAAGCTCTCAGTGTGGCTTTTCTCTGAATGCTTGAATTTCACATGCCTTGCATTTCACAGTTGTACTCCATGGTCAACCGG

>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000361908_chr3_193332512_+_7067nt
CCCCTTTCATGGCCGCCGCCTGGCGCCGGGGCTAAGTGGCCGCCGGCGTCCGGGTACCCGAGGGCTCTCCCGCGTTGCTGGCACCGCTGG
CGCCGCGGTCTCGTAGCGCATGGGCCTCCTCCGAGGCGGGCTCCCATGCGCTCGGGCCATGGCGCGCCTGGGCGCTGTGCGCTCCCACTA
CTGCGCCCTGCTGCTGGCCGCGGCGCTGGCCGTCTGCGCCTTCTACTACCTCGGCTCAGGCCGGGAGACCTTCTCCAGCGCCACCAAGAG
GCTGAAGGAGGCCCGCGCCGGGGCTCCCGCCGCGCCCTCGCCGCCCGCGCTGGAGCTAGCGCGGGGCTCCGTGGCGCCAGCCCCCGGCGC
GAAGGCCAAGAGCTTGGAGGGCGGCGGTGCCGGGCCGGTGGACTACCACCTGCTGATGATGTTCACCAAGGCGGAGCACAATGCCGCGCT
GCAGGCCAAGGCCCGCGTCGCGCTGCGCTCACTGCTGCGCCTCGCCAAGTTCGAGGCGCACGAGGTGCTTAACCTTCACTTCGTGAGCGA
GGAGGCCAGCCGCGAGGTGGCCAAGGGCCTGCTGCGGGAGCTCCTGCCGCCCGCCGCTGGCTTCAAGTGCAAGGTCATCTTCCACGATGT
TGCTGTGCTGACGGATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCAT
CTTCTTCCTCTCGGTCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAA
CATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGT
CTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTC
ACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACT
GAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCT
CATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAA
ATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTTGT
AAAGTTAGCACCAGACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTTCTCCGGAAGAAACGGCGTT
TAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGGTCTGCTTGGTGAGCTCATTCTCTTACAACAACAAATTCAAGA
GCATGAAGAGGAAGCGCGCAGAGCCGCTGGCCAATATAGCACGAGCTATGCCCAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGA
CCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATT
AGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTC
TGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGA
AATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCA
CCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCG
AATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCT
TGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACAT
GCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGA
CCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAAT
TGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAG
AGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCT
TGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAAC
TGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTAT
CAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACAT
CTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCC
TAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACAT
ATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCA
ACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCT
CAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTG
TGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCAC
AGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTT
AAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGA
TGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATT
AGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGC
GGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTTGATGCTTTCATTGAAGCTCTTCATCAGGAGAAATAAATTAAAATCGTACT
CATAATCAGCTCTGCATACATCTGAAGAACAAAAACATCAACGTCTTTTGTCCAGCCTCTTTTTCTTCTGCTGTTCCACCTTTCTAAACA
TACAATAAAGTCATGGGATAAAAATAATCGATGTATGTTACGGGCGCTTTAACCATCAGCTGCCTCTCGAATGGAAGAACAGTGGTAATG
GATTAACATCCTATTTTGTTGTACTAAAGTGACAAATCGGAATAATATAATTGGTATGGCCATTAGGTTCAGTCCTTGAAGATAAGAAAC
TTGTTCTCTGTTTGTTGTCTTATTTGTGGTGGCACTCGTTTAATGGATTAACTGAGGTTGCTCAATGTTCAGTTTCTTTTCCAGAAATAC
AATGCTAGGTGTTTTGAAATAAAACTTATATAGCAATTGTTTAAAGTTATCAATTGTATATAAAATCACAGTAGCCTGCTAAATCATTGT
ATGTGTCTGTAGTATTCTATTCCCAGAAACTATTTGACCATGATAATTCAGTTTATATTCACCACATGAAAGAAAAATGGGTAACAGAAG
AACCCTTAAAACAGGTTAATTTGGATTGTAACGTTCAGTGAAAGAAATTTCAACCCTTCATAGCCAGCGAAGAAATTTGCCTTGGAAGCC
AAGTCAGTACCAGCTTACCTATTTGATTCAGTTGCTGTTTTCTCACTCTCTATATCCATTTGAAATTGATTTATTTTAGATGTTGTATAC
TTACGTTAGGCTTTCTGTTAATAGTGGTTTTTCTCCTGTTGACAGAGCCACCGGATTATGACACAGGATGAGGAAGATTAAGGATAATCA
ATTGACTAATTTCATTTAGAATATTATCAAACATTTCAACTAGGTATCAGAAAAAGGCTTTCTTTCATAAGACTATTTTAAATAGAAATT
ATTTCAACAATTAAAGTAATGTTGACCATCCCCCTCTCAGCTGAATAAAGAAAAATTTAGTTCAATTTATTGCAATTTAATTACAATACT
ACCTTCACAACATTTTCATGTGTTTTAAATAAATATTTTTTAATTGGCTAAAGGACATTCAAGCAAAGAAATGCTTTCTTTACTTAAAAT
GTCTATCTCATTTGCTGCCTTTTCACTAAGCCTTTACTTTGTTAATAAAAGTGTCCATTGTGTGATGTTTTTGATTTTACAGTTTGCTAA
ATCTTATTTTCTTGGAGTTGCTTTTTGGTAACAGCCCCATTGCTACTCCCCATTTTATTGTTTTACATCAATGCATGCTTCGTTGTGATC
CCTCAAGATGTAACACTTGGTATGCTCGGTTGAGGATATGAAAAAATACTTCCGAAACCAGGAATTCAATGTATGTTTGTTTTATACTGT
TTGATAAGAAAAGTAGGTCCAGCCTTAAGCAGCACAGATGCGCTGGTAGATGCATAGTCAGGAACTTTTTTTATTTCTTTTAGGTCTAGG
GACAGGAGTGAATAGAAAGGGAGGAGAGCTCTATTATGTTCTATACACAGATTAGGAGATGACCTTACTGGGTACACCCCTCTAACCAGT
GCTTACAGGTTAATGCATGTTAATGAATATTTTTGCAGTTGTAAAGCATAACAATTACAACTACACATCTATTTCTAAAGAATAAAACAG
GACCATATTTATTTACTTCTGTCAACTATAGAAAGAAAGACCTTCAGCTGTATTTCCACAGATTTCTCCCAAGGAAAAGGCTAATATTAG
TCACTACTGTTATCACATCCCTTTGTATAAGTTTTAAAAAGAGATGGAGGGAGATCTTCATTTCTTTGAGGAGATCAGTATTGTAACGTA
TGTGAATAGATGATAACAATTAATATTACTAAAAGTCCCACATGAGAGTCCTGACGCCCTCTCCATGCCCCACAGTAATGTGGCTTCTTT
CATGGGTTTTTTTTTCTTCTTTTTAGCTGATCTCATCCTAAGCATGCTTTATTTTTCCTTGAAAGCTAGGTATTTATCAACTGCAGATGT
TATTGAAAGAAAATAAAATTCAGTCTCAAGAGTAAACCCTGTGTCTTGTGTCTGTAGTTCAAAAGTCAGAAATGATTCTAATTTAAACAA
AAAGATACTAAATATACAGAAGTTAAATTCGAACTAGCCACAGAATCATTTGTTTTTATGTCAGAATTTGCAAAGAGTGGAGTGGACAAA
GCTCTGTATGGAAGACTGAACAACTGTAAATAGATGATATCCAAACTTAATTTGGCTAGGACTTCAATTTTAAAAATCAGTGTACCTAGG
CAGTGCACAGCACGAAATAAGTGGCCCTTGCAGCTTCCCCGTTTAACCCACTGTGCTATAGTTGCGGGTGGAACAGTCAACCTTTCTAGT
AGTTTATGATATTGCCCTCTTTGTATTCCCATTTTCTACAGTTTTTTCCGCAGACTTCTTTCTGCAAATTATTCAGCCTCCAAATGCAAA
TGAATGATATAAAAATAAGTAGGGAACATGGCAGAGAGTGGTGCTTCCCAGCCTCACAATGTGGGAATTTGACATAGGATGAGAGTCAGA
GTATAGGTTTAAAAGATAAAATCTTTAGTTAATAATTTTGTATTTATTTATTCTAGATGTATGTATCTGAGGAAAGAAATCTGGTATTTT
TGCTTTCCAATAAAGGGGATCAAAGTAATGGTTTTTCTCTCAGTTCTCTAAGCTGGTCTATGTTATAGCTCTAGCAGTATGGAAATGTGC
TTTAAAATATGCTTACCTTTTGAATGATCATGGCTATATGTTGTTGAGATATTTGAAACTTACCTTGTTTTCACTTGTGCACTGTGAATG
AACTTTGTATTATTTTTTTAAAACCTTCACATTACGTGTAGATATTATTGCAACTTATATTTTGCCTGAGCTTGATCAAAGGTCATTTGT
GTAGATGAGTAATTAAAAAATATTTAAATCACATTATAATTCTATTATTGGAGAGCATCTTTTAAATTTTTTTCTGTTTTAACGAGGGAA
AGAGAAACCTGTATACCTAGGGTCATTATTTGACCCCATAGTATAACCAGATTCATGGTCTAACAAGCTCTCAGTGTGGCTTTTCTCTGA
ATGCTTGAATTTCACATGCCTTGCATTTCACAGTTGTACTCCATGGTCAACCGGTGCTTTTTTTCACATCGTGGTACTTGTCAAAACATT

>In-frame_XXYLT1_ENST00000310380_chr3_194877178_-_OPA1_ENST00000392438_chr3_193332512_+_6968nt
CCCCTTTCATGGCCGCCGCCTGGCGCCGGGGCTAAGTGGCCGCCGGCGTCCGGGTACCCGAGGGCTCTCCCGCGTTGCTGGCACCGCTGG
CGCCGCGGTCTCGTAGCGCATGGGCCTCCTCCGAGGCGGGCTCCCATGCGCTCGGGCCATGGCGCGCCTGGGCGCTGTGCGCTCCCACTA
CTGCGCCCTGCTGCTGGCCGCGGCGCTGGCCGTCTGCGCCTTCTACTACCTCGGCTCAGGCCGGGAGACCTTCTCCAGCGCCACCAAGAG
GCTGAAGGAGGCCCGCGCCGGGGCTCCCGCCGCGCCCTCGCCGCCCGCGCTGGAGCTAGCGCGGGGCTCCGTGGCGCCAGCCCCCGGCGC
GAAGGCCAAGAGCTTGGAGGGCGGCGGTGCCGGGCCGGTGGACTACCACCTGCTGATGATGTTCACCAAGGCGGAGCACAATGCCGCGCT
GCAGGCCAAGGCCCGCGTCGCGCTGCGCTCACTGCTGCGCCTCGCCAAGTTCGAGGCGCACGAGGTGCTTAACCTTCACTTCGTGAGCGA
GGAGGCCAGCCGCGAGGTGGCCAAGGGCCTGCTGCGGGAGCTCCTGCCGCCCGCCGCTGGCTTCAAGTGCAAGGTCATCTTCCACGATGT
TGCTGTGCTGACGGATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCAT
CTTCTTCCTCTCGGTCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAA
CATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGT
CTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTC
ACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACT
GAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCT
CATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAA
ATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTTGT
AAAGTTAGCACCAGACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTTCTCCGGAAGAAACGGCGTT
TAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCT
GCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAA
AGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAA
TACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAAT
ATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGA
TAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGA
AGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGAT
TAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCAT
ACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCAT
ATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAAT
GAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTT
TCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTG
GAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCC
TCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACC
AAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGAC
CATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGC
TTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGC
TGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCG
ATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAAT
TGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAA
TGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATC
CCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTG
TAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTAT
ACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGT
ATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAG
AGAAATTCAAGAAAAACTTGATGCTTTCATTGAAGCTCTTCATCAGGAGAAATAAATTAAAATCGTACTCATAATCAGCTCTGCATACAT
CTGAAGAACAAAAACATCAACGTCTTTTGTCCAGCCTCTTTTTCTTCTGCTGTTCCACCTTTCTAAACATACAATAAAGTCATGGGATAA
AAATAATCGATGTATGTTACGGGCGCTTTAACCATCAGCTGCCTCTCGAATGGAAGAACAGTGGTAATGGATTAACATCCTATTTTGTTG
TACTAAAGTGACAAATCGGAATAATATAATTGGTATGGCCATTAGGTTCAGTCCTTGAAGATAAGAAACTTGTTCTCTGTTTGTTGTCTT
ATTTGTGGTGGCACTCGTTTAATGGATTAACTGAGGTTGCTCAATGTTCAGTTTCTTTTCCAGAAATACAATGCTAGGTGTTTTGAAATA
AAACTTATATAGCAATTGTTTAAAGTTATCAATTGTATATAAAATCACAGTAGCCTGCTAAATCATTGTATGTGTCTGTAGTATTCTATT
CCCAGAAACTATTTGACCATGATAATTCAGTTTATATTCACCACATGAAAGAAAAATGGGTAACAGAAGAACCCTTAAAACAGGTTAATT
TGGATTGTAACGTTCAGTGAAAGAAATTTCAACCCTTCATAGCCAGCGAAGAAATTTGCCTTGGAAGCCAAGTCAGTACCAGCTTACCTA
TTTGATTCAGTTGCTGTTTTCTCACTCTCTATATCCATTTGAAATTGATTTATTTTAGATGTTGTATACTTACGTTAGGCTTTCTGTTAA
TAGTGGTTTTTCTCCTGTTGACAGAGCCACCGGATTATGACACAGGATGAGGAAGATTAAGGATAATCAATTGACTAATTTCATTTAGAA
TATTATCAAACATTTCAACTAGGTATCAGAAAAAGGCTTTCTTTCATAAGACTATTTTAAATAGAAATTATTTCAACAATTAAAGTAATG
TTGACCATCCCCCTCTCAGCTGAATAAAGAAAAATTTAGTTCAATTTATTGCAATTTAATTACAATACTACCTTCACAACATTTTCATGT
GTTTTAAATAAATATTTTTTAATTGGCTAAAGGACATTCAAGCAAAGAAATGCTTTCTTTACTTAAAATGTCTATCTCATTTGCTGCCTT
TTCACTAAGCCTTTACTTTGTTAATAAAAGTGTCCATTGTGTGATGTTTTTGATTTTACAGTTTGCTAAATCTTATTTTCTTGGAGTTGC
TTTTTGGTAACAGCCCCATTGCTACTCCCCATTTTATTGTTTTACATCAATGCATGCTTCGTTGTGATCCCTCAAGATGTAACACTTGGT
ATGCTCGGTTGAGGATATGAAAAAATACTTCCGAAACCAGGAATTCAATGTATGTTTGTTTTATACTGTTTGATAAGAAAAGTAGGTCCA
GCCTTAAGCAGCACAGATGCGCTGGTAGATGCATAGTCAGGAACTTTTTTTATTTCTTTTAGGTCTAGGGACAGGAGTGAATAGAAAGGG
AGGAGAGCTCTATTATGTTCTATACACAGATTAGGAGATGACCTTACTGGGTACACCCCTCTAACCAGTGCTTACAGGTTAATGCATGTT
AATGAATATTTTTGCAGTTGTAAAGCATAACAATTACAACTACACATCTATTTCTAAAGAATAAAACAGGACCATATTTATTTACTTCTG
TCAACTATAGAAAGAAAGACCTTCAGCTGTATTTCCACAGATTTCTCCCAAGGAAAAGGCTAATATTAGTCACTACTGTTATCACATCCC
TTTGTATAAGTTTTAAAAAGAGATGGAGGGAGATCTTCATTTCTTTGAGGAGATCAGTATTGTAACGTATGTGAATAGATGATAACAATT
AATATTACTAAAAGTCCCACATGAGAGTCCTGACGCCCTCTCCATGCCCCACAGTAATGTGGCTTCTTTCATGGGTTTTTTTTTCTTCTT
TTTAGCTGATCTCATCCTAAGCATGCTTTATTTTTCCTTGAAAGCTAGGTATTTATCAACTGCAGATGTTATTGAAAGAAAATAAAATTC
AGTCTCAAGAGTAAACCCTGTGTCTTGTGTCTGTAGTTCAAAAGTCAGAAATGATTCTAATTTAAACAAAAAGATACTAAATATACAGAA
GTTAAATTCGAACTAGCCACAGAATCATTTGTTTTTATGTCAGAATTTGCAAAGAGTGGAGTGGACAAAGCTCTGTATGGAAGACTGAAC
AACTGTAAATAGATGATATCCAAACTTAATTTGGCTAGGACTTCAATTTTAAAAATCAGTGTACCTAGGCAGTGCACAGCACGAAATAAG
TGGCCCTTGCAGCTTCCCCGTTTAACCCACTGTGCTATAGTTGCGGGTGGAACAGTCAACCTTTCTAGTAGTTTATGATATTGCCCTCTT
TGTATTCCCATTTTCTACAGTTTTTTCCGCAGACTTCTTTCTGCAAATTATTCAGCCTCCAAATGCAAATGAATGATATAAAAATAAGTA
GGGAACATGGCAGAGAGTGGTGCTTCCCAGCCTCACAATGTGGGAATTTGACATAGGATGAGAGTCAGAGTATAGGTTTAAAAGATAAAA
TCTTTAGTTAATAATTTTGTATTTATTTATTCTAGATGTATGTATCTGAGGAAAGAAATCTGGTATTTTTGCTTTCCAATAAAGGGGATC
AAAGTAATGGTTTTTCTCTCAGTTCTCTAAGCTGGTCTATGTTATAGCTCTAGCAGTATGGAAATGTGCTTTAAAATATGCTTACCTTTT
GAATGATCATGGCTATATGTTGTTGAGATATTTGAAACTTACCTTGTTTTCACTTGTGCACTGTGAATGAACTTTGTATTATTTTTTTAA
AACCTTCACATTACGTGTAGATATTATTGCAACTTATATTTTGCCTGAGCTTGATCAAAGGTCATTTGTGTAGATGAGTAATTAAAAAAT
ATTTAAATCACATTATAATTCTATTATTGGAGAGCATCTTTTAAATTTTTTTCTGTTTTAACGAGGGAAAGAGAAACCTGTATACCTAGG
GTCATTATTTGACCCCATAGTATAACCAGATTCATGGTCTAACAAGCTCTCAGTGTGGCTTTTCTCTGAATGCTTGAATTTCACATGCCT
TGCATTTCACAGTTGTACTCCATGGTCAACCGGTGCTTTTTTTCACATCGTGGTACTTGTCAAAACATTTTGTTATTTTCCTTGGTAAAA

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000361828_chr3_193332512_+_6545nt
GTGAGAGTCAGTGAGCTCTCAGGAGATCTGCTGTTTGAAAGTGTGTAGCGCTTCCCCCTTCTCTCTCTCTGTCCTGCTGCACTATGGTGA
GATGTGTCCCTTCCGCCGTGATTGTGTGTTTCCTGAGGCCTCCCCAGCCAGGCAGAACTGTCATCTTCCACGATGTTGCTGTGCTGACGG
ATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTCCTCTCGG
TCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGGGAGTTGT
TTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAGTCTTTAG
TGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCATCCTACCT
TAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTCTCTCCAA
TTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTAGGATCGG
CTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATTGTGCCTG
ACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTTGTAAAGTTAGCACCAG
ACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTCACAAATTGGTTAGTGAAGTCATAGGAGCTTCTG
ACCTACTTCTCTTGTTAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGTGT
CAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGA
ACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTG
AAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTG
GAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGA
CTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAA
GACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTG
GACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCA
GTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAG
ACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAA
GCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTG
AAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGA
CTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAA
CACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATG
AAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAA
CTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGT
GGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAG
GGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGG
ACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAG
AGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGA
ATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTG
CAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAG
TTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATT
CTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAA
ATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTG
GTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTTGATGCTTTCATTGAAGCTCTTCATCAGGAGA
AATAAATTAAAATCGTACTCATAATCAGCTCTGCATACATCTGAAGAACAAAAACATCAACGTCTTTTGTCCAGCCTCTTTTTCTTCTGC
TGTTCCACCTTTCTAAACATACAATAAAGTCATGGGATAAAAATAATCGATGTATGTTACGGGCGCTTTAACCATCAGCTGCCTCTCGAA
TGGAAGAACAGTGGTAATGGATTAACATCCTATTTTGTTGTACTAAAGTGACAAATCGGAATAATATAATTGGTATGGCCATTAGGTTCA
GTCCTTGAAGATAAGAAACTTGTTCTCTGTTTGTTGTCTTATTTGTGGTGGCACTCGTTTAATGGATTAACTGAGGTTGCTCAATGTTCA
GTTTCTTTTCCAGAAATACAATGCTAGGTGTTTTGAAATAAAACTTATATAGCAATTGTTTAAAGTTATCAATTGTATATAAAATCACAG
TAGCCTGCTAAATCATTGTATGTGTCTGTAGTATTCTATTCCCAGAAACTATTTGACCATGATAATTCAGTTTATATTCACCACATGAAA
GAAAAATGGGTAACAGAAGAACCCTTAAAACAGGTTAATTTGGATTGTAACGTTCAGTGAAAGAAATTTCAACCCTTCATAGCCAGCGAA
GAAATTTGCCTTGGAAGCCAAGTCAGTACCAGCTTACCTATTTGATTCAGTTGCTGTTTTCTCACTCTCTATATCCATTTGAAATTGATT
TATTTTAGATGTTGTATACTTACGTTAGGCTTTCTGTTAATAGTGGTTTTTCTCCTGTTGACAGAGCCACCGGATTATGACACAGGATGA
GGAAGATTAAGGATAATCAATTGACTAATTTCATTTAGAATATTATCAAACATTTCAACTAGGTATCAGAAAAAGGCTTTCTTTCATAAG
ACTATTTTAAATAGAAATTATTTCAACAATTAAAGTAATGTTGACCATCCCCCTCTCAGCTGAATAAAGAAAAATTTAGTTCAATTTATT
GCAATTTAATTACAATACTACCTTCACAACATTTTCATGTGTTTTAAATAAATATTTTTTAATTGGCTAAAGGACATTCAAGCAAAGAAA
TGCTTTCTTTACTTAAAATGTCTATCTCATTTGCTGCCTTTTCACTAAGCCTTTACTTTGTTAATAAAAGTGTCCATTGTGTGATGTTTT
TGATTTTACAGTTTGCTAAATCTTATTTTCTTGGAGTTGCTTTTTGGTAACAGCCCCATTGCTACTCCCCATTTTATTGTTTTACATCAA
TGCATGCTTCGTTGTGATCCCTCAAGATGTAACACTTGGTATGCTCGGTTGAGGATATGAAAAAATACTTCCGAAACCAGGAATTCAATG
TATGTTTGTTTTATACTGTTTGATAAGAAAAGTAGGTCCAGCCTTAAGCAGCACAGATGCGCTGGTAGATGCATAGTCAGGAACTTTTTT
TATTTCTTTTAGGTCTAGGGACAGGAGTGAATAGAAAGGGAGGAGAGCTCTATTATGTTCTATACACAGATTAGGAGATGACCTTACTGG
GTACACCCCTCTAACCAGTGCTTACAGGTTAATGCATGTTAATGAATATTTTTGCAGTTGTAAAGCATAACAATTACAACTACACATCTA
TTTCTAAAGAATAAAACAGGACCATATTTATTTACTTCTGTCAACTATAGAAAGAAAGACCTTCAGCTGTATTTCCACAGATTTCTCCCA
AGGAAAAGGCTAATATTAGTCACTACTGTTATCACATCCCTTTGTATAAGTTTTAAAAAGAGATGGAGGGAGATCTTCATTTCTTTGAGG
AGATCAGTATTGTAACGTATGTGAATAGATGATAACAATTAATATTACTAAAAGTCCCACATGAGAGTCCTGACGCCCTCTCCATGCCCC
ACAGTAATGTGGCTTCTTTCATGGGTTTTTTTTTCTTCTTTTTAGCTGATCTCATCCTAAGCATGCTTTATTTTTCCTTGAAAGCTAGGT
ATTTATCAACTGCAGATGTTATTGAAAGAAAATAAAATTCAGTCTCAAGAGTAAACCCTGTGTCTTGTGTCTGTAGTTCAAAAGTCAGAA
ATGATTCTAATTTAAACAAAAAGATACTAAATATACAGAAGTTAAATTCGAACTAGCCACAGAATCATTTGTTTTTATGTCAGAATTTGC
AAAGAGTGGAGTGGACAAAGCTCTGTATGGAAGACTGAACAACTGTAAATAGATGATATCCAAACTTAATTTGGCTAGGACTTCAATTTT
AAAAATCAGTGTACCTAGGCAGTGCACAGCACGAAATAAGTGGCCCTTGCAGCTTCCCCGTTTAACCCACTGTGCTATAGTTGCGGGTGG
AACAGTCAACCTTTCTAGTAGTTTATGATATTGCCCTCTTTGTATTCCCATTTTCTACAGTTTTTTCCGCAGACTTCTTTCTGCAAATTA
TTCAGCCTCCAAATGCAAATGAATGATATAAAAATAAGTAGGGAACATGGCAGAGAGTGGTGCTTCCCAGCCTCACAATGTGGGAATTTG
ACATAGGATGAGAGTCAGAGTATAGGTTTAAAAGATAAAATCTTTAGTTAATAATTTTGTATTTATTTATTCTAGATGTATGTATCTGAG
GAAAGAAATCTGGTATTTTTGCTTTCCAATAAAGGGGATCAAAGTAATGGTTTTTCTCTCAGTTCTCTAAGCTGGTCTATGTTATAGCTC
TAGCAGTATGGAAATGTGCTTTAAAATATGCTTACCTTTTGAATGATCATGGCTATATGTTGTTGAGATATTTGAAACTTACCTTGTTTT
CACTTGTGCACTGTGAATGAACTTTGTATTATTTTTTTAAAACCTTCACATTACGTGTAGATATTATTGCAACTTATATTTTGCCTGAGC
TTGATCAAAGGTCATTTGTGTAGATGAGTAATTAAAAAATATTTAAATCACATTATAATTCTATTATTGGAGAGCATCTTTTAAATTTTT
TTCTGTTTTAACGAGGGAAAGAGAAACCTGTATACCTAGGGTCATTATTTGACCCCATAGTATAACCAGATTCATGGTCTAACAAGCTCT
CAGTGTGGCTTTTCTCTGAATGCTTGAATTTCACATGCCTTGCATTTCACAGTTGTACTCCATGGTCAACCGGTGCTTTTTTTCACATCG

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000361510_chr3_193332512_+_6656nt
GTGAGAGTCAGTGAGCTCTCAGGAGATCTGCTGTTTGAAAGTGTGTAGCGCTTCCCCCTTCTCTCTCTCTGTCCTGCTGCACTATGGTGA
GATGTGTCCCTTCCGCCGTGATTGTGTGTTTCCTGAGGCCTCCCCAGCCAGGCAGAACTGTCATCTTCCACGATGTTGCTGTGCTGACGG
ATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTCCTCTCGG
TCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGGGAGTTGT
TTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAGTCTTTAG
TGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCATCCTACCT
TAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTCTCTCCAA
TTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTAGGATCGG
CTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATTGTGCCTG
ACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTTGTAAAGTTAGCACCAG
ACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTCACAAATTGGTTAGTGAAGTCATAGGAGCTTCTG
ACCTACTTCTCTTGTTAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGGTC
TGCTTGGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCGCGCAGAGCCGCTGGCCAATATAGCACGAGCTATG
CCCAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCT
TGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAAT
CTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTG
TGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGA
CACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAG
AAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATAT
CCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTG
ACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATG
CTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAG
AGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAA
CAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCA
TGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAAC
AGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAAC
TATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAAT
CTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAG
TGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCC
GCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACA
AGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATG
CAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAA
AGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATG
AGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGA
TTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACT
ACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATA
CTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGA
AGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTTGATGCTTTCA
TTGAAGCTCTTCATCAGGAGAAATAAATTAAAATCGTACTCATAATCAGCTCTGCATACATCTGAAGAACAAAAACATCAACGTCTTTTG
TCCAGCCTCTTTTTCTTCTGCTGTTCCACCTTTCTAAACATACAATAAAGTCATGGGATAAAAATAATCGATGTATGTTACGGGCGCTTT
AACCATCAGCTGCCTCTCGAATGGAAGAACAGTGGTAATGGATTAACATCCTATTTTGTTGTACTAAAGTGACAAATCGGAATAATATAA
TTGGTATGGCCATTAGGTTCAGTCCTTGAAGATAAGAAACTTGTTCTCTGTTTGTTGTCTTATTTGTGGTGGCACTCGTTTAATGGATTA
ACTGAGGTTGCTCAATGTTCAGTTTCTTTTCCAGAAATACAATGCTAGGTGTTTTGAAATAAAACTTATATAGCAATTGTTTAAAGTTAT
CAATTGTATATAAAATCACAGTAGCCTGCTAAATCATTGTATGTGTCTGTAGTATTCTATTCCCAGAAACTATTTGACCATGATAATTCA
GTTTATATTCACCACATGAAAGAAAAATGGGTAACAGAAGAACCCTTAAAACAGGTTAATTTGGATTGTAACGTTCAGTGAAAGAAATTT
CAACCCTTCATAGCCAGCGAAGAAATTTGCCTTGGAAGCCAAGTCAGTACCAGCTTACCTATTTGATTCAGTTGCTGTTTTCTCACTCTC
TATATCCATTTGAAATTGATTTATTTTAGATGTTGTATACTTACGTTAGGCTTTCTGTTAATAGTGGTTTTTCTCCTGTTGACAGAGCCA
CCGGATTATGACACAGGATGAGGAAGATTAAGGATAATCAATTGACTAATTTCATTTAGAATATTATCAAACATTTCAACTAGGTATCAG
AAAAAGGCTTTCTTTCATAAGACTATTTTAAATAGAAATTATTTCAACAATTAAAGTAATGTTGACCATCCCCCTCTCAGCTGAATAAAG
AAAAATTTAGTTCAATTTATTGCAATTTAATTACAATACTACCTTCACAACATTTTCATGTGTTTTAAATAAATATTTTTTAATTGGCTA
AAGGACATTCAAGCAAAGAAATGCTTTCTTTACTTAAAATGTCTATCTCATTTGCTGCCTTTTCACTAAGCCTTTACTTTGTTAATAAAA
GTGTCCATTGTGTGATGTTTTTGATTTTACAGTTTGCTAAATCTTATTTTCTTGGAGTTGCTTTTTGGTAACAGCCCCATTGCTACTCCC
CATTTTATTGTTTTACATCAATGCATGCTTCGTTGTGATCCCTCAAGATGTAACACTTGGTATGCTCGGTTGAGGATATGAAAAAATACT
TCCGAAACCAGGAATTCAATGTATGTTTGTTTTATACTGTTTGATAAGAAAAGTAGGTCCAGCCTTAAGCAGCACAGATGCGCTGGTAGA
TGCATAGTCAGGAACTTTTTTTATTTCTTTTAGGTCTAGGGACAGGAGTGAATAGAAAGGGAGGAGAGCTCTATTATGTTCTATACACAG
ATTAGGAGATGACCTTACTGGGTACACCCCTCTAACCAGTGCTTACAGGTTAATGCATGTTAATGAATATTTTTGCAGTTGTAAAGCATA
ACAATTACAACTACACATCTATTTCTAAAGAATAAAACAGGACCATATTTATTTACTTCTGTCAACTATAGAAAGAAAGACCTTCAGCTG
TATTTCCACAGATTTCTCCCAAGGAAAAGGCTAATATTAGTCACTACTGTTATCACATCCCTTTGTATAAGTTTTAAAAAGAGATGGAGG
GAGATCTTCATTTCTTTGAGGAGATCAGTATTGTAACGTATGTGAATAGATGATAACAATTAATATTACTAAAAGTCCCACATGAGAGTC
CTGACGCCCTCTCCATGCCCCACAGTAATGTGGCTTCTTTCATGGGTTTTTTTTTCTTCTTTTTAGCTGATCTCATCCTAAGCATGCTTT
ATTTTTCCTTGAAAGCTAGGTATTTATCAACTGCAGATGTTATTGAAAGAAAATAAAATTCAGTCTCAAGAGTAAACCCTGTGTCTTGTG
TCTGTAGTTCAAAAGTCAGAAATGATTCTAATTTAAACAAAAAGATACTAAATATACAGAAGTTAAATTCGAACTAGCCACAGAATCATT
TGTTTTTATGTCAGAATTTGCAAAGAGTGGAGTGGACAAAGCTCTGTATGGAAGACTGAACAACTGTAAATAGATGATATCCAAACTTAA
TTTGGCTAGGACTTCAATTTTAAAAATCAGTGTACCTAGGCAGTGCACAGCACGAAATAAGTGGCCCTTGCAGCTTCCCCGTTTAACCCA
CTGTGCTATAGTTGCGGGTGGAACAGTCAACCTTTCTAGTAGTTTATGATATTGCCCTCTTTGTATTCCCATTTTCTACAGTTTTTTCCG
CAGACTTCTTTCTGCAAATTATTCAGCCTCCAAATGCAAATGAATGATATAAAAATAAGTAGGGAACATGGCAGAGAGTGGTGCTTCCCA
GCCTCACAATGTGGGAATTTGACATAGGATGAGAGTCAGAGTATAGGTTTAAAAGATAAAATCTTTAGTTAATAATTTTGTATTTATTTA
TTCTAGATGTATGTATCTGAGGAAAGAAATCTGGTATTTTTGCTTTCCAATAAAGGGGATCAAAGTAATGGTTTTTCTCTCAGTTCTCTA
AGCTGGTCTATGTTATAGCTCTAGCAGTATGGAAATGTGCTTTAAAATATGCTTACCTTTTGAATGATCATGGCTATATGTTGTTGAGAT
ATTTGAAACTTACCTTGTTTTCACTTGTGCACTGTGAATGAACTTTGTATTATTTTTTTAAAACCTTCACATTACGTGTAGATATTATTG
CAACTTATATTTTGCCTGAGCTTGATCAAAGGTCATTTGTGTAGATGAGTAATTAAAAAATATTTAAATCACATTATAATTCTATTATTG
GAGAGCATCTTTTAAATTTTTTTCTGTTTTAACGAGGGAAAGAGAAACCTGTATACCTAGGGTCATTATTTGACCCCATAGTATAACCAG
ATTCATGGTCTAACAAGCTCTCAGTGTGGCTTTTCTCTGAATGCTTGAATTTCACATGCCTTGCATTTCACAGTTGTACTCCATGGTCAA

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000361150_chr3_193332512_+_6494nt
GTGAGAGTCAGTGAGCTCTCAGGAGATCTGCTGTTTGAAAGTGTGTAGCGCTTCCCCCTTCTCTCTCTCTGTCCTGCTGCACTATGGTGA
GATGTGTCCCTTCCGCCGTGATTGTGTGTTTCCTGAGGCCTCCCCAGCCAGGCAGAACTGTCATCTTCCACGATGTTGCTGTGCTGACGG
ATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTCCTCTCGG
TCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGGGAGTTGT
TTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAGTCTTTAG
TGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCATCCTACCT
TAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTCTCTCCAA
TTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTAGGATCGG
CTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATTGTGCCTG
ACATTGTGTGGGAAATTGATGAGTATATCGATTTTGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACA
AGCATTTTAGAAAGGGTCTGCTTGGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCGCGCAGAGCCGCTGGCC
AATATAGCACGAGCTATGCCCAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGT
TGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATC
ATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATC
ATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAG
GATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGG
AGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCG
TTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGA
CATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTC
AAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGA
CCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAG
GTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAA
AGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTAC
GAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGG
AACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGG
AGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAG
GAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCC
TACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAG
AAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTG
ATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGG
TGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGA
AGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAG
AAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTC
GAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGC
TTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATT
TTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAG
AAAAACTTGATGCTTTCATTGAAGCTCTTCATCAGGAGAAATAAATTAAAATCGTACTCATAATCAGCTCTGCATACATCTGAAGAACAA
AAACATCAACGTCTTTTGTCCAGCCTCTTTTTCTTCTGCTGTTCCACCTTTCTAAACATACAATAAAGTCATGGGATAAAAATAATCGAT
GTATGTTACGGGCGCTTTAACCATCAGCTGCCTCTCGAATGGAAGAACAGTGGTAATGGATTAACATCCTATTTTGTTGTACTAAAGTGA
CAAATCGGAATAATATAATTGGTATGGCCATTAGGTTCAGTCCTTGAAGATAAGAAACTTGTTCTCTGTTTGTTGTCTTATTTGTGGTGG
CACTCGTTTAATGGATTAACTGAGGTTGCTCAATGTTCAGTTTCTTTTCCAGAAATACAATGCTAGGTGTTTTGAAATAAAACTTATATA
GCAATTGTTTAAAGTTATCAATTGTATATAAAATCACAGTAGCCTGCTAAATCATTGTATGTGTCTGTAGTATTCTATTCCCAGAAACTA
TTTGACCATGATAATTCAGTTTATATTCACCACATGAAAGAAAAATGGGTAACAGAAGAACCCTTAAAACAGGTTAATTTGGATTGTAAC
GTTCAGTGAAAGAAATTTCAACCCTTCATAGCCAGCGAAGAAATTTGCCTTGGAAGCCAAGTCAGTACCAGCTTACCTATTTGATTCAGT
TGCTGTTTTCTCACTCTCTATATCCATTTGAAATTGATTTATTTTAGATGTTGTATACTTACGTTAGGCTTTCTGTTAATAGTGGTTTTT
CTCCTGTTGACAGAGCCACCGGATTATGACACAGGATGAGGAAGATTAAGGATAATCAATTGACTAATTTCATTTAGAATATTATCAAAC
ATTTCAACTAGGTATCAGAAAAAGGCTTTCTTTCATAAGACTATTTTAAATAGAAATTATTTCAACAATTAAAGTAATGTTGACCATCCC
CCTCTCAGCTGAATAAAGAAAAATTTAGTTCAATTTATTGCAATTTAATTACAATACTACCTTCACAACATTTTCATGTGTTTTAAATAA
ATATTTTTTAATTGGCTAAAGGACATTCAAGCAAAGAAATGCTTTCTTTACTTAAAATGTCTATCTCATTTGCTGCCTTTTCACTAAGCC
TTTACTTTGTTAATAAAAGTGTCCATTGTGTGATGTTTTTGATTTTACAGTTTGCTAAATCTTATTTTCTTGGAGTTGCTTTTTGGTAAC
AGCCCCATTGCTACTCCCCATTTTATTGTTTTACATCAATGCATGCTTCGTTGTGATCCCTCAAGATGTAACACTTGGTATGCTCGGTTG
AGGATATGAAAAAATACTTCCGAAACCAGGAATTCAATGTATGTTTGTTTTATACTGTTTGATAAGAAAAGTAGGTCCAGCCTTAAGCAG
CACAGATGCGCTGGTAGATGCATAGTCAGGAACTTTTTTTATTTCTTTTAGGTCTAGGGACAGGAGTGAATAGAAAGGGAGGAGAGCTCT
ATTATGTTCTATACACAGATTAGGAGATGACCTTACTGGGTACACCCCTCTAACCAGTGCTTACAGGTTAATGCATGTTAATGAATATTT
TTGCAGTTGTAAAGCATAACAATTACAACTACACATCTATTTCTAAAGAATAAAACAGGACCATATTTATTTACTTCTGTCAACTATAGA
AAGAAAGACCTTCAGCTGTATTTCCACAGATTTCTCCCAAGGAAAAGGCTAATATTAGTCACTACTGTTATCACATCCCTTTGTATAAGT
TTTAAAAAGAGATGGAGGGAGATCTTCATTTCTTTGAGGAGATCAGTATTGTAACGTATGTGAATAGATGATAACAATTAATATTACTAA
AAGTCCCACATGAGAGTCCTGACGCCCTCTCCATGCCCCACAGTAATGTGGCTTCTTTCATGGGTTTTTTTTTCTTCTTTTTAGCTGATC
TCATCCTAAGCATGCTTTATTTTTCCTTGAAAGCTAGGTATTTATCAACTGCAGATGTTATTGAAAGAAAATAAAATTCAGTCTCAAGAG
TAAACCCTGTGTCTTGTGTCTGTAGTTCAAAAGTCAGAAATGATTCTAATTTAAACAAAAAGATACTAAATATACAGAAGTTAAATTCGA
ACTAGCCACAGAATCATTTGTTTTTATGTCAGAATTTGCAAAGAGTGGAGTGGACAAAGCTCTGTATGGAAGACTGAACAACTGTAAATA
GATGATATCCAAACTTAATTTGGCTAGGACTTCAATTTTAAAAATCAGTGTACCTAGGCAGTGCACAGCACGAAATAAGTGGCCCTTGCA
GCTTCCCCGTTTAACCCACTGTGCTATAGTTGCGGGTGGAACAGTCAACCTTTCTAGTAGTTTATGATATTGCCCTCTTTGTATTCCCAT
TTTCTACAGTTTTTTCCGCAGACTTCTTTCTGCAAATTATTCAGCCTCCAAATGCAAATGAATGATATAAAAATAAGTAGGGAACATGGC
AGAGAGTGGTGCTTCCCAGCCTCACAATGTGGGAATTTGACATAGGATGAGAGTCAGAGTATAGGTTTAAAAGATAAAATCTTTAGTTAA
TAATTTTGTATTTATTTATTCTAGATGTATGTATCTGAGGAAAGAAATCTGGTATTTTTGCTTTCCAATAAAGGGGATCAAAGTAATGGT
TTTTCTCTCAGTTCTCTAAGCTGGTCTATGTTATAGCTCTAGCAGTATGGAAATGTGCTTTAAAATATGCTTACCTTTTGAATGATCATG
GCTATATGTTGTTGAGATATTTGAAACTTACCTTGTTTTCACTTGTGCACTGTGAATGAACTTTGTATTATTTTTTTAAAACCTTCACAT
TACGTGTAGATATTATTGCAACTTATATTTTGCCTGAGCTTGATCAAAGGTCATTTGTGTAGATGAGTAATTAAAAAATATTTAAATCAC
ATTATAATTCTATTATTGGAGAGCATCTTTTAAATTTTTTTCTGTTTTAACGAGGGAAAGAGAAACCTGTATACCTAGGGTCATTATTTG
ACCCCATAGTATAACCAGATTCATGGTCTAACAAGCTCTCAGTGTGGCTTTTCTCTGAATGCTTGAATTTCACATGCCTTGCATTTCACA
GTTGTACTCCATGGTCAACCGGTGCTTTTTTTCACATCGTGGTACTTGTCAAAACATTTTGTTATTTTCCTTGGTAAAATATATAAAAAA

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000361715_chr3_193332512_+_6548nt
GTGAGAGTCAGTGAGCTCTCAGGAGATCTGCTGTTTGAAAGTGTGTAGCGCTTCCCCCTTCTCTCTCTCTGTCCTGCTGCACTATGGTGA
GATGTGTCCCTTCCGCCGTGATTGTGTGTTTCCTGAGGCCTCCCCAGCCAGGCAGAACTGTCATCTTCCACGATGTTGCTGTGCTGACGG
ATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTCCTCTCGG
TCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGGGAGTTGT
TTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAGTCTTTAG
TGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCATCCTACCT
TAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTCTCTCCAA
TTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTAGGATCGG
CTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATTGTGCCTG
ACATTGTGTGGGAAATTGATGAGTATATCGATTTTGGTCACAAATTGGTTAGTGAAGTCATAGGAGCTTCTGACCTACTTCTCTTGTTAG
GTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGGTCTGCTTGGTGAGCTCATTC
TCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCGCGCAGAGCCGCTGGCCAATATAGCACGAGCTATGCCCAACAGAAGCGCAAGG
TGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGG
AGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATT
CTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTG
CTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGG
TGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCAT
TAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCC
CTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTT
TCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTA
CAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTC
CAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCT
CTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAG
TGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAG
CAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAA
ATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTAT
CAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAAC
AGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGA
AAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGG
AGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGG
AAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGA
AGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATC
TTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATC
AAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAG
ATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTA
CAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTA
CTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTTGATGCTTTCATTGAAGCTCTTCATCAGG
AGAAATAAATTAAAATCGTACTCATAATCAGCTCTGCATACATCTGAAGAACAAAAACATCAACGTCTTTTGTCCAGCCTCTTTTTCTTC
TGCTGTTCCACCTTTCTAAACATACAATAAAGTCATGGGATAAAAATAATCGATGTATGTTACGGGCGCTTTAACCATCAGCTGCCTCTC
GAATGGAAGAACAGTGGTAATGGATTAACATCCTATTTTGTTGTACTAAAGTGACAAATCGGAATAATATAATTGGTATGGCCATTAGGT
TCAGTCCTTGAAGATAAGAAACTTGTTCTCTGTTTGTTGTCTTATTTGTGGTGGCACTCGTTTAATGGATTAACTGAGGTTGCTCAATGT
TCAGTTTCTTTTCCAGAAATACAATGCTAGGTGTTTTGAAATAAAACTTATATAGCAATTGTTTAAAGTTATCAATTGTATATAAAATCA
CAGTAGCCTGCTAAATCATTGTATGTGTCTGTAGTATTCTATTCCCAGAAACTATTTGACCATGATAATTCAGTTTATATTCACCACATG
AAAGAAAAATGGGTAACAGAAGAACCCTTAAAACAGGTTAATTTGGATTGTAACGTTCAGTGAAAGAAATTTCAACCCTTCATAGCCAGC
GAAGAAATTTGCCTTGGAAGCCAAGTCAGTACCAGCTTACCTATTTGATTCAGTTGCTGTTTTCTCACTCTCTATATCCATTTGAAATTG
ATTTATTTTAGATGTTGTATACTTACGTTAGGCTTTCTGTTAATAGTGGTTTTTCTCCTGTTGACAGAGCCACCGGATTATGACACAGGA
TGAGGAAGATTAAGGATAATCAATTGACTAATTTCATTTAGAATATTATCAAACATTTCAACTAGGTATCAGAAAAAGGCTTTCTTTCAT
AAGACTATTTTAAATAGAAATTATTTCAACAATTAAAGTAATGTTGACCATCCCCCTCTCAGCTGAATAAAGAAAAATTTAGTTCAATTT
ATTGCAATTTAATTACAATACTACCTTCACAACATTTTCATGTGTTTTAAATAAATATTTTTTAATTGGCTAAAGGACATTCAAGCAAAG
AAATGCTTTCTTTACTTAAAATGTCTATCTCATTTGCTGCCTTTTCACTAAGCCTTTACTTTGTTAATAAAAGTGTCCATTGTGTGATGT
TTTTGATTTTACAGTTTGCTAAATCTTATTTTCTTGGAGTTGCTTTTTGGTAACAGCCCCATTGCTACTCCCCATTTTATTGTTTTACAT
CAATGCATGCTTCGTTGTGATCCCTCAAGATGTAACACTTGGTATGCTCGGTTGAGGATATGAAAAAATACTTCCGAAACCAGGAATTCA
ATGTATGTTTGTTTTATACTGTTTGATAAGAAAAGTAGGTCCAGCCTTAAGCAGCACAGATGCGCTGGTAGATGCATAGTCAGGAACTTT
TTTTATTTCTTTTAGGTCTAGGGACAGGAGTGAATAGAAAGGGAGGAGAGCTCTATTATGTTCTATACACAGATTAGGAGATGACCTTAC
TGGGTACACCCCTCTAACCAGTGCTTACAGGTTAATGCATGTTAATGAATATTTTTGCAGTTGTAAAGCATAACAATTACAACTACACAT
CTATTTCTAAAGAATAAAACAGGACCATATTTATTTACTTCTGTCAACTATAGAAAGAAAGACCTTCAGCTGTATTTCCACAGATTTCTC
CCAAGGAAAAGGCTAATATTAGTCACTACTGTTATCACATCCCTTTGTATAAGTTTTAAAAAGAGATGGAGGGAGATCTTCATTTCTTTG
AGGAGATCAGTATTGTAACGTATGTGAATAGATGATAACAATTAATATTACTAAAAGTCCCACATGAGAGTCCTGACGCCCTCTCCATGC
CCCACAGTAATGTGGCTTCTTTCATGGGTTTTTTTTTCTTCTTTTTAGCTGATCTCATCCTAAGCATGCTTTATTTTTCCTTGAAAGCTA
GGTATTTATCAACTGCAGATGTTATTGAAAGAAAATAAAATTCAGTCTCAAGAGTAAACCCTGTGTCTTGTGTCTGTAGTTCAAAAGTCA
GAAATGATTCTAATTTAAACAAAAAGATACTAAATATACAGAAGTTAAATTCGAACTAGCCACAGAATCATTTGTTTTTATGTCAGAATT
TGCAAAGAGTGGAGTGGACAAAGCTCTGTATGGAAGACTGAACAACTGTAAATAGATGATATCCAAACTTAATTTGGCTAGGACTTCAAT
TTTAAAAATCAGTGTACCTAGGCAGTGCACAGCACGAAATAAGTGGCCCTTGCAGCTTCCCCGTTTAACCCACTGTGCTATAGTTGCGGG
TGGAACAGTCAACCTTTCTAGTAGTTTATGATATTGCCCTCTTTGTATTCCCATTTTCTACAGTTTTTTCCGCAGACTTCTTTCTGCAAA
TTATTCAGCCTCCAAATGCAAATGAATGATATAAAAATAAGTAGGGAACATGGCAGAGAGTGGTGCTTCCCAGCCTCACAATGTGGGAAT
TTGACATAGGATGAGAGTCAGAGTATAGGTTTAAAAGATAAAATCTTTAGTTAATAATTTTGTATTTATTTATTCTAGATGTATGTATCT
GAGGAAAGAAATCTGGTATTTTTGCTTTCCAATAAAGGGGATCAAAGTAATGGTTTTTCTCTCAGTTCTCTAAGCTGGTCTATGTTATAG
CTCTAGCAGTATGGAAATGTGCTTTAAAATATGCTTACCTTTTGAATGATCATGGCTATATGTTGTTGAGATATTTGAAACTTACCTTGT
TTTCACTTGTGCACTGTGAATGAACTTTGTATTATTTTTTTAAAACCTTCACATTACGTGTAGATATTATTGCAACTTATATTTTGCCTG
AGCTTGATCAAAGGTCATTTGTGTAGATGAGTAATTAAAAAATATTTAAATCACATTATAATTCTATTATTGGAGAGCATCTTTTAAATT
TTTTTCTGTTTTAACGAGGGAAAGAGAAACCTGTATACCTAGGGTCATTATTTGACCCCATAGTATAACCAGATTCATGGTCTAACAAGC
TCTCAGTGTGGCTTTTCTCTGAATGCTTGAATTTCACATGCCTTGCATTTCACAGTTGTACTCCATGGTCAACCGGTGCTTTTTTTCACA

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000361908_chr3_193332512_+_6603nt
GTGAGAGTCAGTGAGCTCTCAGGAGATCTGCTGTTTGAAAGTGTGTAGCGCTTCCCCCTTCTCTCTCTCTGTCCTGCTGCACTATGGTGA
GATGTGTCCCTTCCGCCGTGATTGTGTGTTTCCTGAGGCCTCCCCAGCCAGGCAGAACTGTCATCTTCCACGATGTTGCTGTGCTGACGG
ATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTCCTCTCGG
TCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGGGAGTTGT
TTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAGTCTTTAG
TGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCATCCTACCT
TAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTCTCTCCAA
TTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTAGGATCGG
CTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATTGTGCCTG
ACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTTGTAAAGTTAGCACCAG
ACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATC
GTGGATCTGAAAGTGACAAGCATTTTAGAAAGGGTCTGCTTGGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAG
CGCGCAGAGCCGCTGGCCAATATAGCACGAGCTATGCCCAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAG
AACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAG
ATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCA
GTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAG
CTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTAT
TTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATG
TGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAG
GTGTGATTAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATG
CCATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGA
GAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCT
TCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAG
AGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACT
GCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATA
ACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGG
TTACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTG
CGCAGACCATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAG
AGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTA
AAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGG
AAGACCGATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAA
ATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAA
CCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACC
TTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAA
ACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTT
GGCGTATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTA
AAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGA
AAGTTAGAGAAATTCAAGAAAAACTTGATGCTTTCATTGAAGCTCTTCATCAGGAGAAATAAATTAAAATCGTACTCATAATCAGCTCTG
CATACATCTGAAGAACAAAAACATCAACGTCTTTTGTCCAGCCTCTTTTTCTTCTGCTGTTCCACCTTTCTAAACATACAATAAAGTCAT
GGGATAAAAATAATCGATGTATGTTACGGGCGCTTTAACCATCAGCTGCCTCTCGAATGGAAGAACAGTGGTAATGGATTAACATCCTAT
TTTGTTGTACTAAAGTGACAAATCGGAATAATATAATTGGTATGGCCATTAGGTTCAGTCCTTGAAGATAAGAAACTTGTTCTCTGTTTG
TTGTCTTATTTGTGGTGGCACTCGTTTAATGGATTAACTGAGGTTGCTCAATGTTCAGTTTCTTTTCCAGAAATACAATGCTAGGTGTTT
TGAAATAAAACTTATATAGCAATTGTTTAAAGTTATCAATTGTATATAAAATCACAGTAGCCTGCTAAATCATTGTATGTGTCTGTAGTA
TTCTATTCCCAGAAACTATTTGACCATGATAATTCAGTTTATATTCACCACATGAAAGAAAAATGGGTAACAGAAGAACCCTTAAAACAG
GTTAATTTGGATTGTAACGTTCAGTGAAAGAAATTTCAACCCTTCATAGCCAGCGAAGAAATTTGCCTTGGAAGCCAAGTCAGTACCAGC
TTACCTATTTGATTCAGTTGCTGTTTTCTCACTCTCTATATCCATTTGAAATTGATTTATTTTAGATGTTGTATACTTACGTTAGGCTTT
CTGTTAATAGTGGTTTTTCTCCTGTTGACAGAGCCACCGGATTATGACACAGGATGAGGAAGATTAAGGATAATCAATTGACTAATTTCA
TTTAGAATATTATCAAACATTTCAACTAGGTATCAGAAAAAGGCTTTCTTTCATAAGACTATTTTAAATAGAAATTATTTCAACAATTAA
AGTAATGTTGACCATCCCCCTCTCAGCTGAATAAAGAAAAATTTAGTTCAATTTATTGCAATTTAATTACAATACTACCTTCACAACATT
TTCATGTGTTTTAAATAAATATTTTTTAATTGGCTAAAGGACATTCAAGCAAAGAAATGCTTTCTTTACTTAAAATGTCTATCTCATTTG
CTGCCTTTTCACTAAGCCTTTACTTTGTTAATAAAAGTGTCCATTGTGTGATGTTTTTGATTTTACAGTTTGCTAAATCTTATTTTCTTG
GAGTTGCTTTTTGGTAACAGCCCCATTGCTACTCCCCATTTTATTGTTTTACATCAATGCATGCTTCGTTGTGATCCCTCAAGATGTAAC
ACTTGGTATGCTCGGTTGAGGATATGAAAAAATACTTCCGAAACCAGGAATTCAATGTATGTTTGTTTTATACTGTTTGATAAGAAAAGT
AGGTCCAGCCTTAAGCAGCACAGATGCGCTGGTAGATGCATAGTCAGGAACTTTTTTTATTTCTTTTAGGTCTAGGGACAGGAGTGAATA
GAAAGGGAGGAGAGCTCTATTATGTTCTATACACAGATTAGGAGATGACCTTACTGGGTACACCCCTCTAACCAGTGCTTACAGGTTAAT
GCATGTTAATGAATATTTTTGCAGTTGTAAAGCATAACAATTACAACTACACATCTATTTCTAAAGAATAAAACAGGACCATATTTATTT
ACTTCTGTCAACTATAGAAAGAAAGACCTTCAGCTGTATTTCCACAGATTTCTCCCAAGGAAAAGGCTAATATTAGTCACTACTGTTATC
ACATCCCTTTGTATAAGTTTTAAAAAGAGATGGAGGGAGATCTTCATTTCTTTGAGGAGATCAGTATTGTAACGTATGTGAATAGATGAT
AACAATTAATATTACTAAAAGTCCCACATGAGAGTCCTGACGCCCTCTCCATGCCCCACAGTAATGTGGCTTCTTTCATGGGTTTTTTTT
TCTTCTTTTTAGCTGATCTCATCCTAAGCATGCTTTATTTTTCCTTGAAAGCTAGGTATTTATCAACTGCAGATGTTATTGAAAGAAAAT
AAAATTCAGTCTCAAGAGTAAACCCTGTGTCTTGTGTCTGTAGTTCAAAAGTCAGAAATGATTCTAATTTAAACAAAAAGATACTAAATA
TACAGAAGTTAAATTCGAACTAGCCACAGAATCATTTGTTTTTATGTCAGAATTTGCAAAGAGTGGAGTGGACAAAGCTCTGTATGGAAG
ACTGAACAACTGTAAATAGATGATATCCAAACTTAATTTGGCTAGGACTTCAATTTTAAAAATCAGTGTACCTAGGCAGTGCACAGCACG
AAATAAGTGGCCCTTGCAGCTTCCCCGTTTAACCCACTGTGCTATAGTTGCGGGTGGAACAGTCAACCTTTCTAGTAGTTTATGATATTG
CCCTCTTTGTATTCCCATTTTCTACAGTTTTTTCCGCAGACTTCTTTCTGCAAATTATTCAGCCTCCAAATGCAAATGAATGATATAAAA
ATAAGTAGGGAACATGGCAGAGAGTGGTGCTTCCCAGCCTCACAATGTGGGAATTTGACATAGGATGAGAGTCAGAGTATAGGTTTAAAA
GATAAAATCTTTAGTTAATAATTTTGTATTTATTTATTCTAGATGTATGTATCTGAGGAAAGAAATCTGGTATTTTTGCTTTCCAATAAA
GGGGATCAAAGTAATGGTTTTTCTCTCAGTTCTCTAAGCTGGTCTATGTTATAGCTCTAGCAGTATGGAAATGTGCTTTAAAATATGCTT
ACCTTTTGAATGATCATGGCTATATGTTGTTGAGATATTTGAAACTTACCTTGTTTTCACTTGTGCACTGTGAATGAACTTTGTATTATT
TTTTTAAAACCTTCACATTACGTGTAGATATTATTGCAACTTATATTTTGCCTGAGCTTGATCAAAGGTCATTTGTGTAGATGAGTAATT
AAAAAATATTTAAATCACATTATAATTCTATTATTGGAGAGCATCTTTTAAATTTTTTTCTGTTTTAACGAGGGAAAGAGAAACCTGTAT
ACCTAGGGTCATTATTTGACCCCATAGTATAACCAGATTCATGGTCTAACAAGCTCTCAGTGTGGCTTTTCTCTGAATGCTTGAATTTCA
CATGCCTTGCATTTCACAGTTGTACTCCATGGTCAACCGGTGCTTTTTTTCACATCGTGGTACTTGTCAAAACATTTTGTTATTTTCCTT

>In-frame_XXYLT1_ENST00000429994_chr3_194877178_-_OPA1_ENST00000392438_chr3_193332512_+_6504nt
GTGAGAGTCAGTGAGCTCTCAGGAGATCTGCTGTTTGAAAGTGTGTAGCGCTTCCCCCTTCTCTCTCTCTGTCCTGCTGCACTATGGTGA
GATGTGTCCCTTCCGCCGTGATTGTGTGTTTCCTGAGGCCTCCCCAGCCAGGCAGAACTGTCATCTTCCACGATGTTGCTGTGCTGACGG
ATAAGCTCTTCCCCATCGTGGAGGCCATGCAGAAGCACTTCAGTGCTGGCTTGGGAACCTACTACAGTGACTCCATCTTCTTCCTCTCGG
TCGCCATGCATCAGATCATGCCCAAAGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACCAACATCCGGGAGTTGT
TTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAGGTCTGCCAGTCTTTAG
TGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCATTCACATCATCCTACCT
TAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAACTGAAATTCTCTCCAA
TTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTATCTCATACTAGGATCGG
CTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATATAAATGGATTGTGCCTG
ACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTTGTAAAGTTAGCACCAG
ACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATC
GTGGATCTGAAAGTGACAAGCATTTTAGAAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGA
AGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATA
GAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATC
TGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGAT
CTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGT
TTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTA
GCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACAT
CAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAG
ATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCA
AAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTT
ATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGC
TCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAG
AGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAAC
TTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGG
AAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAA
CTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTAC
AAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAA
GTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATA
AACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGG
GTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGA
TGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAG
TAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAA
GAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTG
CTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTG
CTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAA
AACTTGATGCTTTCATTGAAGCTCTTCATCAGGAGAAATAAATTAAAATCGTACTCATAATCAGCTCTGCATACATCTGAAGAACAAAAA
CATCAACGTCTTTTGTCCAGCCTCTTTTTCTTCTGCTGTTCCACCTTTCTAAACATACAATAAAGTCATGGGATAAAAATAATCGATGTA
TGTTACGGGCGCTTTAACCATCAGCTGCCTCTCGAATGGAAGAACAGTGGTAATGGATTAACATCCTATTTTGTTGTACTAAAGTGACAA
ATCGGAATAATATAATTGGTATGGCCATTAGGTTCAGTCCTTGAAGATAAGAAACTTGTTCTCTGTTTGTTGTCTTATTTGTGGTGGCAC
TCGTTTAATGGATTAACTGAGGTTGCTCAATGTTCAGTTTCTTTTCCAGAAATACAATGCTAGGTGTTTTGAAATAAAACTTATATAGCA
ATTGTTTAAAGTTATCAATTGTATATAAAATCACAGTAGCCTGCTAAATCATTGTATGTGTCTGTAGTATTCTATTCCCAGAAACTATTT
GACCATGATAATTCAGTTTATATTCACCACATGAAAGAAAAATGGGTAACAGAAGAACCCTTAAAACAGGTTAATTTGGATTGTAACGTT
CAGTGAAAGAAATTTCAACCCTTCATAGCCAGCGAAGAAATTTGCCTTGGAAGCCAAGTCAGTACCAGCTTACCTATTTGATTCAGTTGC
TGTTTTCTCACTCTCTATATCCATTTGAAATTGATTTATTTTAGATGTTGTATACTTACGTTAGGCTTTCTGTTAATAGTGGTTTTTCTC
CTGTTGACAGAGCCACCGGATTATGACACAGGATGAGGAAGATTAAGGATAATCAATTGACTAATTTCATTTAGAATATTATCAAACATT
TCAACTAGGTATCAGAAAAAGGCTTTCTTTCATAAGACTATTTTAAATAGAAATTATTTCAACAATTAAAGTAATGTTGACCATCCCCCT
CTCAGCTGAATAAAGAAAAATTTAGTTCAATTTATTGCAATTTAATTACAATACTACCTTCACAACATTTTCATGTGTTTTAAATAAATA
TTTTTTAATTGGCTAAAGGACATTCAAGCAAAGAAATGCTTTCTTTACTTAAAATGTCTATCTCATTTGCTGCCTTTTCACTAAGCCTTT
ACTTTGTTAATAAAAGTGTCCATTGTGTGATGTTTTTGATTTTACAGTTTGCTAAATCTTATTTTCTTGGAGTTGCTTTTTGGTAACAGC
CCCATTGCTACTCCCCATTTTATTGTTTTACATCAATGCATGCTTCGTTGTGATCCCTCAAGATGTAACACTTGGTATGCTCGGTTGAGG
ATATGAAAAAATACTTCCGAAACCAGGAATTCAATGTATGTTTGTTTTATACTGTTTGATAAGAAAAGTAGGTCCAGCCTTAAGCAGCAC
AGATGCGCTGGTAGATGCATAGTCAGGAACTTTTTTTATTTCTTTTAGGTCTAGGGACAGGAGTGAATAGAAAGGGAGGAGAGCTCTATT
ATGTTCTATACACAGATTAGGAGATGACCTTACTGGGTACACCCCTCTAACCAGTGCTTACAGGTTAATGCATGTTAATGAATATTTTTG
CAGTTGTAAAGCATAACAATTACAACTACACATCTATTTCTAAAGAATAAAACAGGACCATATTTATTTACTTCTGTCAACTATAGAAAG
AAAGACCTTCAGCTGTATTTCCACAGATTTCTCCCAAGGAAAAGGCTAATATTAGTCACTACTGTTATCACATCCCTTTGTATAAGTTTT
AAAAAGAGATGGAGGGAGATCTTCATTTCTTTGAGGAGATCAGTATTGTAACGTATGTGAATAGATGATAACAATTAATATTACTAAAAG
TCCCACATGAGAGTCCTGACGCCCTCTCCATGCCCCACAGTAATGTGGCTTCTTTCATGGGTTTTTTTTTCTTCTTTTTAGCTGATCTCA
TCCTAAGCATGCTTTATTTTTCCTTGAAAGCTAGGTATTTATCAACTGCAGATGTTATTGAAAGAAAATAAAATTCAGTCTCAAGAGTAA
ACCCTGTGTCTTGTGTCTGTAGTTCAAAAGTCAGAAATGATTCTAATTTAAACAAAAAGATACTAAATATACAGAAGTTAAATTCGAACT
AGCCACAGAATCATTTGTTTTTATGTCAGAATTTGCAAAGAGTGGAGTGGACAAAGCTCTGTATGGAAGACTGAACAACTGTAAATAGAT
GATATCCAAACTTAATTTGGCTAGGACTTCAATTTTAAAAATCAGTGTACCTAGGCAGTGCACAGCACGAAATAAGTGGCCCTTGCAGCT
TCCCCGTTTAACCCACTGTGCTATAGTTGCGGGTGGAACAGTCAACCTTTCTAGTAGTTTATGATATTGCCCTCTTTGTATTCCCATTTT
CTACAGTTTTTTCCGCAGACTTCTTTCTGCAAATTATTCAGCCTCCAAATGCAAATGAATGATATAAAAATAAGTAGGGAACATGGCAGA
GAGTGGTGCTTCCCAGCCTCACAATGTGGGAATTTGACATAGGATGAGAGTCAGAGTATAGGTTTAAAAGATAAAATCTTTAGTTAATAA
TTTTGTATTTATTTATTCTAGATGTATGTATCTGAGGAAAGAAATCTGGTATTTTTGCTTTCCAATAAAGGGGATCAAAGTAATGGTTTT
TCTCTCAGTTCTCTAAGCTGGTCTATGTTATAGCTCTAGCAGTATGGAAATGTGCTTTAAAATATGCTTACCTTTTGAATGATCATGGCT
ATATGTTGTTGAGATATTTGAAACTTACCTTGTTTTCACTTGTGCACTGTGAATGAACTTTGTATTATTTTTTTAAAACCTTCACATTAC
GTGTAGATATTATTGCAACTTATATTTTGCCTGAGCTTGATCAAAGGTCATTTGTGTAGATGAGTAATTAAAAAATATTTAAATCACATT
ATAATTCTATTATTGGAGAGCATCTTTTAAATTTTTTTCTGTTTTAACGAGGGAAAGAGAAACCTGTATACCTAGGGTCATTATTTGACC
CCATAGTATAACCAGATTCATGGTCTAACAAGCTCTCAGTGTGGCTTTTCTCTGAATGCTTGAATTTCACATGCCTTGCATTTCACAGTT
GTACTCCATGGTCAACCGGTGCTTTTTTTCACATCGTGGTACTTGTCAAAACATTTTGTTATTTTCCTTGGTAAAATATATAAAAAAGGT

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000361828_chr3_193332512_+_6291nt
ATGTGGCCACCTCGCTGCAAGGATCCAGGAAGGCAGAGTGCGGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACC
AACATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAG
GTCTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCAT
TCACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAA
CTGAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTAT
CTCATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATAT
AAATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTT
GTAAAGTTAGCACCAGACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTCACAAATTGGTTAGTGAA
GTCATAGGAGCTTCTGACCTACTTCTCTTGTTAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAG
CATTTTAGAAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAA
CGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTG
ATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTT
GGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACACGT
TCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAA
GATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTA
AATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTGACACA
AAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGAA
CGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAA
AATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGA
AAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTA
AAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCT
GATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTT
GAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTG
TGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAGTGGAT
ATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTT
ATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGG
AATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATGCAGCT
ATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGG
TGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAG
CACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAG
GATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAA
AGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATACTTTA
AGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAG
ATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTTGATGCTTTCATTGAA
GCTCTTCATCAGGAGAAATAAATTAAAATCGTACTCATAATCAGCTCTGCATACATCTGAAGAACAAAAACATCAACGTCTTTTGTCCAG
CCTCTTTTTCTTCTGCTGTTCCACCTTTCTAAACATACAATAAAGTCATGGGATAAAAATAATCGATGTATGTTACGGGCGCTTTAACCA
TCAGCTGCCTCTCGAATGGAAGAACAGTGGTAATGGATTAACATCCTATTTTGTTGTACTAAAGTGACAAATCGGAATAATATAATTGGT
ATGGCCATTAGGTTCAGTCCTTGAAGATAAGAAACTTGTTCTCTGTTTGTTGTCTTATTTGTGGTGGCACTCGTTTAATGGATTAACTGA
GGTTGCTCAATGTTCAGTTTCTTTTCCAGAAATACAATGCTAGGTGTTTTGAAATAAAACTTATATAGCAATTGTTTAAAGTTATCAATT
GTATATAAAATCACAGTAGCCTGCTAAATCATTGTATGTGTCTGTAGTATTCTATTCCCAGAAACTATTTGACCATGATAATTCAGTTTA
TATTCACCACATGAAAGAAAAATGGGTAACAGAAGAACCCTTAAAACAGGTTAATTTGGATTGTAACGTTCAGTGAAAGAAATTTCAACC
CTTCATAGCCAGCGAAGAAATTTGCCTTGGAAGCCAAGTCAGTACCAGCTTACCTATTTGATTCAGTTGCTGTTTTCTCACTCTCTATAT
CCATTTGAAATTGATTTATTTTAGATGTTGTATACTTACGTTAGGCTTTCTGTTAATAGTGGTTTTTCTCCTGTTGACAGAGCCACCGGA
TTATGACACAGGATGAGGAAGATTAAGGATAATCAATTGACTAATTTCATTTAGAATATTATCAAACATTTCAACTAGGTATCAGAAAAA
GGCTTTCTTTCATAAGACTATTTTAAATAGAAATTATTTCAACAATTAAAGTAATGTTGACCATCCCCCTCTCAGCTGAATAAAGAAAAA
TTTAGTTCAATTTATTGCAATTTAATTACAATACTACCTTCACAACATTTTCATGTGTTTTAAATAAATATTTTTTAATTGGCTAAAGGA
CATTCAAGCAAAGAAATGCTTTCTTTACTTAAAATGTCTATCTCATTTGCTGCCTTTTCACTAAGCCTTTACTTTGTTAATAAAAGTGTC
CATTGTGTGATGTTTTTGATTTTACAGTTTGCTAAATCTTATTTTCTTGGAGTTGCTTTTTGGTAACAGCCCCATTGCTACTCCCCATTT
TATTGTTTTACATCAATGCATGCTTCGTTGTGATCCCTCAAGATGTAACACTTGGTATGCTCGGTTGAGGATATGAAAAAATACTTCCGA
AACCAGGAATTCAATGTATGTTTGTTTTATACTGTTTGATAAGAAAAGTAGGTCCAGCCTTAAGCAGCACAGATGCGCTGGTAGATGCAT
AGTCAGGAACTTTTTTTATTTCTTTTAGGTCTAGGGACAGGAGTGAATAGAAAGGGAGGAGAGCTCTATTATGTTCTATACACAGATTAG
GAGATGACCTTACTGGGTACACCCCTCTAACCAGTGCTTACAGGTTAATGCATGTTAATGAATATTTTTGCAGTTGTAAAGCATAACAAT
TACAACTACACATCTATTTCTAAAGAATAAAACAGGACCATATTTATTTACTTCTGTCAACTATAGAAAGAAAGACCTTCAGCTGTATTT
CCACAGATTTCTCCCAAGGAAAAGGCTAATATTAGTCACTACTGTTATCACATCCCTTTGTATAAGTTTTAAAAAGAGATGGAGGGAGAT
CTTCATTTCTTTGAGGAGATCAGTATTGTAACGTATGTGAATAGATGATAACAATTAATATTACTAAAAGTCCCACATGAGAGTCCTGAC
GCCCTCTCCATGCCCCACAGTAATGTGGCTTCTTTCATGGGTTTTTTTTTCTTCTTTTTAGCTGATCTCATCCTAAGCATGCTTTATTTT
TCCTTGAAAGCTAGGTATTTATCAACTGCAGATGTTATTGAAAGAAAATAAAATTCAGTCTCAAGAGTAAACCCTGTGTCTTGTGTCTGT
AGTTCAAAAGTCAGAAATGATTCTAATTTAAACAAAAAGATACTAAATATACAGAAGTTAAATTCGAACTAGCCACAGAATCATTTGTTT
TTATGTCAGAATTTGCAAAGAGTGGAGTGGACAAAGCTCTGTATGGAAGACTGAACAACTGTAAATAGATGATATCCAAACTTAATTTGG
CTAGGACTTCAATTTTAAAAATCAGTGTACCTAGGCAGTGCACAGCACGAAATAAGTGGCCCTTGCAGCTTCCCCGTTTAACCCACTGTG
CTATAGTTGCGGGTGGAACAGTCAACCTTTCTAGTAGTTTATGATATTGCCCTCTTTGTATTCCCATTTTCTACAGTTTTTTCCGCAGAC
TTCTTTCTGCAAATTATTCAGCCTCCAAATGCAAATGAATGATATAAAAATAAGTAGGGAACATGGCAGAGAGTGGTGCTTCCCAGCCTC
ACAATGTGGGAATTTGACATAGGATGAGAGTCAGAGTATAGGTTTAAAAGATAAAATCTTTAGTTAATAATTTTGTATTTATTTATTCTA
GATGTATGTATCTGAGGAAAGAAATCTGGTATTTTTGCTTTCCAATAAAGGGGATCAAAGTAATGGTTTTTCTCTCAGTTCTCTAAGCTG
GTCTATGTTATAGCTCTAGCAGTATGGAAATGTGCTTTAAAATATGCTTACCTTTTGAATGATCATGGCTATATGTTGTTGAGATATTTG
AAACTTACCTTGTTTTCACTTGTGCACTGTGAATGAACTTTGTATTATTTTTTTAAAACCTTCACATTACGTGTAGATATTATTGCAACT
TATATTTTGCCTGAGCTTGATCAAAGGTCATTTGTGTAGATGAGTAATTAAAAAATATTTAAATCACATTATAATTCTATTATTGGAGAG
CATCTTTTAAATTTTTTTCTGTTTTAACGAGGGAAAGAGAAACCTGTATACCTAGGGTCATTATTTGACCCCATAGTATAACCAGATTCA
TGGTCTAACAAGCTCTCAGTGTGGCTTTTCTCTGAATGCTTGAATTTCACATGCCTTGCATTTCACAGTTGTACTCCATGGTCAACCGGT

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000361510_chr3_193332512_+_6402nt
ATGTGGCCACCTCGCTGCAAGGATCCAGGAAGGCAGAGTGCGGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACC
AACATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAG
GTCTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCAT
TCACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAA
CTGAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTAT
CTCATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATAT
AAATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTT
GTAAAGTTAGCACCAGACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTCACAAATTGGTTAGTGAA
GTCATAGGAGCTTCTGACCTACTTCTCTTGTTAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAG
CATTTTAGAAAGGGTCTGCTTGGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCGCGCAGAGCCGCTGGCCAA
TATAGCACGAGCTATGCCCAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTG
AAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCAT
AGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCAT
CTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGA
TCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAG
TTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTT
AGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACA
TCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAA
GATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACC
AAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGT
TATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAG
CTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGA
GAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAA
CTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAG
GAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGA
ACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTA
CAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAA
AGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGAT
AAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTG
GGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAG
ATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAA
GTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGA
AGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTT
GCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTT
GCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAA
AAACTTGATGCTTTCATTGAAGCTCTTCATCAGGAGAAATAAATTAAAATCGTACTCATAATCAGCTCTGCATACATCTGAAGAACAAAA
ACATCAACGTCTTTTGTCCAGCCTCTTTTTCTTCTGCTGTTCCACCTTTCTAAACATACAATAAAGTCATGGGATAAAAATAATCGATGT
ATGTTACGGGCGCTTTAACCATCAGCTGCCTCTCGAATGGAAGAACAGTGGTAATGGATTAACATCCTATTTTGTTGTACTAAAGTGACA
AATCGGAATAATATAATTGGTATGGCCATTAGGTTCAGTCCTTGAAGATAAGAAACTTGTTCTCTGTTTGTTGTCTTATTTGTGGTGGCA
CTCGTTTAATGGATTAACTGAGGTTGCTCAATGTTCAGTTTCTTTTCCAGAAATACAATGCTAGGTGTTTTGAAATAAAACTTATATAGC
AATTGTTTAAAGTTATCAATTGTATATAAAATCACAGTAGCCTGCTAAATCATTGTATGTGTCTGTAGTATTCTATTCCCAGAAACTATT
TGACCATGATAATTCAGTTTATATTCACCACATGAAAGAAAAATGGGTAACAGAAGAACCCTTAAAACAGGTTAATTTGGATTGTAACGT
TCAGTGAAAGAAATTTCAACCCTTCATAGCCAGCGAAGAAATTTGCCTTGGAAGCCAAGTCAGTACCAGCTTACCTATTTGATTCAGTTG
CTGTTTTCTCACTCTCTATATCCATTTGAAATTGATTTATTTTAGATGTTGTATACTTACGTTAGGCTTTCTGTTAATAGTGGTTTTTCT
CCTGTTGACAGAGCCACCGGATTATGACACAGGATGAGGAAGATTAAGGATAATCAATTGACTAATTTCATTTAGAATATTATCAAACAT
TTCAACTAGGTATCAGAAAAAGGCTTTCTTTCATAAGACTATTTTAAATAGAAATTATTTCAACAATTAAAGTAATGTTGACCATCCCCC
TCTCAGCTGAATAAAGAAAAATTTAGTTCAATTTATTGCAATTTAATTACAATACTACCTTCACAACATTTTCATGTGTTTTAAATAAAT
ATTTTTTAATTGGCTAAAGGACATTCAAGCAAAGAAATGCTTTCTTTACTTAAAATGTCTATCTCATTTGCTGCCTTTTCACTAAGCCTT
TACTTTGTTAATAAAAGTGTCCATTGTGTGATGTTTTTGATTTTACAGTTTGCTAAATCTTATTTTCTTGGAGTTGCTTTTTGGTAACAG
CCCCATTGCTACTCCCCATTTTATTGTTTTACATCAATGCATGCTTCGTTGTGATCCCTCAAGATGTAACACTTGGTATGCTCGGTTGAG
GATATGAAAAAATACTTCCGAAACCAGGAATTCAATGTATGTTTGTTTTATACTGTTTGATAAGAAAAGTAGGTCCAGCCTTAAGCAGCA
CAGATGCGCTGGTAGATGCATAGTCAGGAACTTTTTTTATTTCTTTTAGGTCTAGGGACAGGAGTGAATAGAAAGGGAGGAGAGCTCTAT
TATGTTCTATACACAGATTAGGAGATGACCTTACTGGGTACACCCCTCTAACCAGTGCTTACAGGTTAATGCATGTTAATGAATATTTTT
GCAGTTGTAAAGCATAACAATTACAACTACACATCTATTTCTAAAGAATAAAACAGGACCATATTTATTTACTTCTGTCAACTATAGAAA
GAAAGACCTTCAGCTGTATTTCCACAGATTTCTCCCAAGGAAAAGGCTAATATTAGTCACTACTGTTATCACATCCCTTTGTATAAGTTT
TAAAAAGAGATGGAGGGAGATCTTCATTTCTTTGAGGAGATCAGTATTGTAACGTATGTGAATAGATGATAACAATTAATATTACTAAAA
GTCCCACATGAGAGTCCTGACGCCCTCTCCATGCCCCACAGTAATGTGGCTTCTTTCATGGGTTTTTTTTTCTTCTTTTTAGCTGATCTC
ATCCTAAGCATGCTTTATTTTTCCTTGAAAGCTAGGTATTTATCAACTGCAGATGTTATTGAAAGAAAATAAAATTCAGTCTCAAGAGTA
AACCCTGTGTCTTGTGTCTGTAGTTCAAAAGTCAGAAATGATTCTAATTTAAACAAAAAGATACTAAATATACAGAAGTTAAATTCGAAC
TAGCCACAGAATCATTTGTTTTTATGTCAGAATTTGCAAAGAGTGGAGTGGACAAAGCTCTGTATGGAAGACTGAACAACTGTAAATAGA
TGATATCCAAACTTAATTTGGCTAGGACTTCAATTTTAAAAATCAGTGTACCTAGGCAGTGCACAGCACGAAATAAGTGGCCCTTGCAGC
TTCCCCGTTTAACCCACTGTGCTATAGTTGCGGGTGGAACAGTCAACCTTTCTAGTAGTTTATGATATTGCCCTCTTTGTATTCCCATTT
TCTACAGTTTTTTCCGCAGACTTCTTTCTGCAAATTATTCAGCCTCCAAATGCAAATGAATGATATAAAAATAAGTAGGGAACATGGCAG
AGAGTGGTGCTTCCCAGCCTCACAATGTGGGAATTTGACATAGGATGAGAGTCAGAGTATAGGTTTAAAAGATAAAATCTTTAGTTAATA
ATTTTGTATTTATTTATTCTAGATGTATGTATCTGAGGAAAGAAATCTGGTATTTTTGCTTTCCAATAAAGGGGATCAAAGTAATGGTTT
TTCTCTCAGTTCTCTAAGCTGGTCTATGTTATAGCTCTAGCAGTATGGAAATGTGCTTTAAAATATGCTTACCTTTTGAATGATCATGGC
TATATGTTGTTGAGATATTTGAAACTTACCTTGTTTTCACTTGTGCACTGTGAATGAACTTTGTATTATTTTTTTAAAACCTTCACATTA
CGTGTAGATATTATTGCAACTTATATTTTGCCTGAGCTTGATCAAAGGTCATTTGTGTAGATGAGTAATTAAAAAATATTTAAATCACAT
TATAATTCTATTATTGGAGAGCATCTTTTAAATTTTTTTCTGTTTTAACGAGGGAAAGAGAAACCTGTATACCTAGGGTCATTATTTGAC
CCCATAGTATAACCAGATTCATGGTCTAACAAGCTCTCAGTGTGGCTTTTCTCTGAATGCTTGAATTTCACATGCCTTGCATTTCACAGT
TGTACTCCATGGTCAACCGGTGCTTTTTTTCACATCGTGGTACTTGTCAAAACATTTTGTTATTTTCCTTGGTAAAATATATAAAAAAGG

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000361150_chr3_193332512_+_6240nt
ATGTGGCCACCTCGCTGCAAGGATCCAGGAAGGCAGAGTGCGGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACC
AACATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAG
GTCTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCAT
TCACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAA
CTGAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTAT
CTCATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATAT
AAATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGT
GGATCTGAAAGTGACAAGCATTTTAGAAAGGGTCTGCTTGGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCG
CGCAGAGCCGCTGGCCAATATAGCACGAGCTATGCCCAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAA
CTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGAT
GACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGT
TATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCT
CGAATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTT
AAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTG
AAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGT
GTGATTAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCC
ATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGA
ACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTC
CCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAG
TTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGC
TTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAAC
TATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTT
ACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCG
CAGACCATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAG
GTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAA
GAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAA
GACCGATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAAT
GCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACC
AAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTT
GAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAAC
CATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGG
CGTATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAA
GAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAA
GTTAGAGAAATTCAAGAAAAACTTGATGCTTTCATTGAAGCTCTTCATCAGGAGAAATAAATTAAAATCGTACTCATAATCAGCTCTGCA
TACATCTGAAGAACAAAAACATCAACGTCTTTTGTCCAGCCTCTTTTTCTTCTGCTGTTCCACCTTTCTAAACATACAATAAAGTCATGG
GATAAAAATAATCGATGTATGTTACGGGCGCTTTAACCATCAGCTGCCTCTCGAATGGAAGAACAGTGGTAATGGATTAACATCCTATTT
TGTTGTACTAAAGTGACAAATCGGAATAATATAATTGGTATGGCCATTAGGTTCAGTCCTTGAAGATAAGAAACTTGTTCTCTGTTTGTT
GTCTTATTTGTGGTGGCACTCGTTTAATGGATTAACTGAGGTTGCTCAATGTTCAGTTTCTTTTCCAGAAATACAATGCTAGGTGTTTTG
AAATAAAACTTATATAGCAATTGTTTAAAGTTATCAATTGTATATAAAATCACAGTAGCCTGCTAAATCATTGTATGTGTCTGTAGTATT
CTATTCCCAGAAACTATTTGACCATGATAATTCAGTTTATATTCACCACATGAAAGAAAAATGGGTAACAGAAGAACCCTTAAAACAGGT
TAATTTGGATTGTAACGTTCAGTGAAAGAAATTTCAACCCTTCATAGCCAGCGAAGAAATTTGCCTTGGAAGCCAAGTCAGTACCAGCTT
ACCTATTTGATTCAGTTGCTGTTTTCTCACTCTCTATATCCATTTGAAATTGATTTATTTTAGATGTTGTATACTTACGTTAGGCTTTCT
GTTAATAGTGGTTTTTCTCCTGTTGACAGAGCCACCGGATTATGACACAGGATGAGGAAGATTAAGGATAATCAATTGACTAATTTCATT
TAGAATATTATCAAACATTTCAACTAGGTATCAGAAAAAGGCTTTCTTTCATAAGACTATTTTAAATAGAAATTATTTCAACAATTAAAG
TAATGTTGACCATCCCCCTCTCAGCTGAATAAAGAAAAATTTAGTTCAATTTATTGCAATTTAATTACAATACTACCTTCACAACATTTT
CATGTGTTTTAAATAAATATTTTTTAATTGGCTAAAGGACATTCAAGCAAAGAAATGCTTTCTTTACTTAAAATGTCTATCTCATTTGCT
GCCTTTTCACTAAGCCTTTACTTTGTTAATAAAAGTGTCCATTGTGTGATGTTTTTGATTTTACAGTTTGCTAAATCTTATTTTCTTGGA
GTTGCTTTTTGGTAACAGCCCCATTGCTACTCCCCATTTTATTGTTTTACATCAATGCATGCTTCGTTGTGATCCCTCAAGATGTAACAC
TTGGTATGCTCGGTTGAGGATATGAAAAAATACTTCCGAAACCAGGAATTCAATGTATGTTTGTTTTATACTGTTTGATAAGAAAAGTAG
GTCCAGCCTTAAGCAGCACAGATGCGCTGGTAGATGCATAGTCAGGAACTTTTTTTATTTCTTTTAGGTCTAGGGACAGGAGTGAATAGA
AAGGGAGGAGAGCTCTATTATGTTCTATACACAGATTAGGAGATGACCTTACTGGGTACACCCCTCTAACCAGTGCTTACAGGTTAATGC
ATGTTAATGAATATTTTTGCAGTTGTAAAGCATAACAATTACAACTACACATCTATTTCTAAAGAATAAAACAGGACCATATTTATTTAC
TTCTGTCAACTATAGAAAGAAAGACCTTCAGCTGTATTTCCACAGATTTCTCCCAAGGAAAAGGCTAATATTAGTCACTACTGTTATCAC
ATCCCTTTGTATAAGTTTTAAAAAGAGATGGAGGGAGATCTTCATTTCTTTGAGGAGATCAGTATTGTAACGTATGTGAATAGATGATAA
CAATTAATATTACTAAAAGTCCCACATGAGAGTCCTGACGCCCTCTCCATGCCCCACAGTAATGTGGCTTCTTTCATGGGTTTTTTTTTC
TTCTTTTTAGCTGATCTCATCCTAAGCATGCTTTATTTTTCCTTGAAAGCTAGGTATTTATCAACTGCAGATGTTATTGAAAGAAAATAA
AATTCAGTCTCAAGAGTAAACCCTGTGTCTTGTGTCTGTAGTTCAAAAGTCAGAAATGATTCTAATTTAAACAAAAAGATACTAAATATA
CAGAAGTTAAATTCGAACTAGCCACAGAATCATTTGTTTTTATGTCAGAATTTGCAAAGAGTGGAGTGGACAAAGCTCTGTATGGAAGAC
TGAACAACTGTAAATAGATGATATCCAAACTTAATTTGGCTAGGACTTCAATTTTAAAAATCAGTGTACCTAGGCAGTGCACAGCACGAA
ATAAGTGGCCCTTGCAGCTTCCCCGTTTAACCCACTGTGCTATAGTTGCGGGTGGAACAGTCAACCTTTCTAGTAGTTTATGATATTGCC
CTCTTTGTATTCCCATTTTCTACAGTTTTTTCCGCAGACTTCTTTCTGCAAATTATTCAGCCTCCAAATGCAAATGAATGATATAAAAAT
AAGTAGGGAACATGGCAGAGAGTGGTGCTTCCCAGCCTCACAATGTGGGAATTTGACATAGGATGAGAGTCAGAGTATAGGTTTAAAAGA
TAAAATCTTTAGTTAATAATTTTGTATTTATTTATTCTAGATGTATGTATCTGAGGAAAGAAATCTGGTATTTTTGCTTTCCAATAAAGG
GGATCAAAGTAATGGTTTTTCTCTCAGTTCTCTAAGCTGGTCTATGTTATAGCTCTAGCAGTATGGAAATGTGCTTTAAAATATGCTTAC
CTTTTGAATGATCATGGCTATATGTTGTTGAGATATTTGAAACTTACCTTGTTTTCACTTGTGCACTGTGAATGAACTTTGTATTATTTT
TTTAAAACCTTCACATTACGTGTAGATATTATTGCAACTTATATTTTGCCTGAGCTTGATCAAAGGTCATTTGTGTAGATGAGTAATTAA
AAAATATTTAAATCACATTATAATTCTATTATTGGAGAGCATCTTTTAAATTTTTTTCTGTTTTAACGAGGGAAAGAGAAACCTGTATAC
CTAGGGTCATTATTTGACCCCATAGTATAACCAGATTCATGGTCTAACAAGCTCTCAGTGTGGCTTTTCTCTGAATGCTTGAATTTCACA
TGCCTTGCATTTCACAGTTGTACTCCATGGTCAACCGGTGCTTTTTTTCACATCGTGGTACTTGTCAAAACATTTTGTTATTTTCCTTGG

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000361715_chr3_193332512_+_6294nt
ATGTGGCCACCTCGCTGCAAGGATCCAGGAAGGCAGAGTGCGGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACC
AACATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAG
GTCTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCAT
TCACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAA
CTGAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTAT
CTCATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATAT
AAATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGGTCACAAATTGGTTAGTGAAGTCATAGGAGCTTCTGAC
CTACTTCTCTTGTTAGGTTCTCCGGAAGAAACGGCGTTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGGTCTG
CTTGGTGAGCTCATTCTCTTACAACAACAAATTCAAGAGCATGAAGAGGAAGCGCGCAGAGCCGCTGGCCAATATAGCACGAGCTATGCC
CAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTG
GAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCT
TTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTG
GTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACA
CGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAA
GAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCC
TTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTGAC
ACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATGCT
GAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAG
AAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACA
GGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATG
CTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAG
GCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTA
TTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAATCT
TTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAGTG
GATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGC
TTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAG
TGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATGCA
GCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAG
AGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAG
GAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATT
AAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTAC
CAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATACT
TTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAG
AAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTTGATGCTTTCATT
GAAGCTCTTCATCAGGAGAAATAAATTAAAATCGTACTCATAATCAGCTCTGCATACATCTGAAGAACAAAAACATCAACGTCTTTTGTC
CAGCCTCTTTTTCTTCTGCTGTTCCACCTTTCTAAACATACAATAAAGTCATGGGATAAAAATAATCGATGTATGTTACGGGCGCTTTAA
CCATCAGCTGCCTCTCGAATGGAAGAACAGTGGTAATGGATTAACATCCTATTTTGTTGTACTAAAGTGACAAATCGGAATAATATAATT
GGTATGGCCATTAGGTTCAGTCCTTGAAGATAAGAAACTTGTTCTCTGTTTGTTGTCTTATTTGTGGTGGCACTCGTTTAATGGATTAAC
TGAGGTTGCTCAATGTTCAGTTTCTTTTCCAGAAATACAATGCTAGGTGTTTTGAAATAAAACTTATATAGCAATTGTTTAAAGTTATCA
ATTGTATATAAAATCACAGTAGCCTGCTAAATCATTGTATGTGTCTGTAGTATTCTATTCCCAGAAACTATTTGACCATGATAATTCAGT
TTATATTCACCACATGAAAGAAAAATGGGTAACAGAAGAACCCTTAAAACAGGTTAATTTGGATTGTAACGTTCAGTGAAAGAAATTTCA
ACCCTTCATAGCCAGCGAAGAAATTTGCCTTGGAAGCCAAGTCAGTACCAGCTTACCTATTTGATTCAGTTGCTGTTTTCTCACTCTCTA
TATCCATTTGAAATTGATTTATTTTAGATGTTGTATACTTACGTTAGGCTTTCTGTTAATAGTGGTTTTTCTCCTGTTGACAGAGCCACC
GGATTATGACACAGGATGAGGAAGATTAAGGATAATCAATTGACTAATTTCATTTAGAATATTATCAAACATTTCAACTAGGTATCAGAA
AAAGGCTTTCTTTCATAAGACTATTTTAAATAGAAATTATTTCAACAATTAAAGTAATGTTGACCATCCCCCTCTCAGCTGAATAAAGAA
AAATTTAGTTCAATTTATTGCAATTTAATTACAATACTACCTTCACAACATTTTCATGTGTTTTAAATAAATATTTTTTAATTGGCTAAA
GGACATTCAAGCAAAGAAATGCTTTCTTTACTTAAAATGTCTATCTCATTTGCTGCCTTTTCACTAAGCCTTTACTTTGTTAATAAAAGT
GTCCATTGTGTGATGTTTTTGATTTTACAGTTTGCTAAATCTTATTTTCTTGGAGTTGCTTTTTGGTAACAGCCCCATTGCTACTCCCCA
TTTTATTGTTTTACATCAATGCATGCTTCGTTGTGATCCCTCAAGATGTAACACTTGGTATGCTCGGTTGAGGATATGAAAAAATACTTC
CGAAACCAGGAATTCAATGTATGTTTGTTTTATACTGTTTGATAAGAAAAGTAGGTCCAGCCTTAAGCAGCACAGATGCGCTGGTAGATG
CATAGTCAGGAACTTTTTTTATTTCTTTTAGGTCTAGGGACAGGAGTGAATAGAAAGGGAGGAGAGCTCTATTATGTTCTATACACAGAT
TAGGAGATGACCTTACTGGGTACACCCCTCTAACCAGTGCTTACAGGTTAATGCATGTTAATGAATATTTTTGCAGTTGTAAAGCATAAC
AATTACAACTACACATCTATTTCTAAAGAATAAAACAGGACCATATTTATTTACTTCTGTCAACTATAGAAAGAAAGACCTTCAGCTGTA
TTTCCACAGATTTCTCCCAAGGAAAAGGCTAATATTAGTCACTACTGTTATCACATCCCTTTGTATAAGTTTTAAAAAGAGATGGAGGGA
GATCTTCATTTCTTTGAGGAGATCAGTATTGTAACGTATGTGAATAGATGATAACAATTAATATTACTAAAAGTCCCACATGAGAGTCCT
GACGCCCTCTCCATGCCCCACAGTAATGTGGCTTCTTTCATGGGTTTTTTTTTCTTCTTTTTAGCTGATCTCATCCTAAGCATGCTTTAT
TTTTCCTTGAAAGCTAGGTATTTATCAACTGCAGATGTTATTGAAAGAAAATAAAATTCAGTCTCAAGAGTAAACCCTGTGTCTTGTGTC
TGTAGTTCAAAAGTCAGAAATGATTCTAATTTAAACAAAAAGATACTAAATATACAGAAGTTAAATTCGAACTAGCCACAGAATCATTTG
TTTTTATGTCAGAATTTGCAAAGAGTGGAGTGGACAAAGCTCTGTATGGAAGACTGAACAACTGTAAATAGATGATATCCAAACTTAATT
TGGCTAGGACTTCAATTTTAAAAATCAGTGTACCTAGGCAGTGCACAGCACGAAATAAGTGGCCCTTGCAGCTTCCCCGTTTAACCCACT
GTGCTATAGTTGCGGGTGGAACAGTCAACCTTTCTAGTAGTTTATGATATTGCCCTCTTTGTATTCCCATTTTCTACAGTTTTTTCCGCA
GACTTCTTTCTGCAAATTATTCAGCCTCCAAATGCAAATGAATGATATAAAAATAAGTAGGGAACATGGCAGAGAGTGGTGCTTCCCAGC
CTCACAATGTGGGAATTTGACATAGGATGAGAGTCAGAGTATAGGTTTAAAAGATAAAATCTTTAGTTAATAATTTTGTATTTATTTATT
CTAGATGTATGTATCTGAGGAAAGAAATCTGGTATTTTTGCTTTCCAATAAAGGGGATCAAAGTAATGGTTTTTCTCTCAGTTCTCTAAG
CTGGTCTATGTTATAGCTCTAGCAGTATGGAAATGTGCTTTAAAATATGCTTACCTTTTGAATGATCATGGCTATATGTTGTTGAGATAT
TTGAAACTTACCTTGTTTTCACTTGTGCACTGTGAATGAACTTTGTATTATTTTTTTAAAACCTTCACATTACGTGTAGATATTATTGCA
ACTTATATTTTGCCTGAGCTTGATCAAAGGTCATTTGTGTAGATGAGTAATTAAAAAATATTTAAATCACATTATAATTCTATTATTGGA
GAGCATCTTTTAAATTTTTTTCTGTTTTAACGAGGGAAAGAGAAACCTGTATACCTAGGGTCATTATTTGACCCCATAGTATAACCAGAT
TCATGGTCTAACAAGCTCTCAGTGTGGCTTTTCTCTGAATGCTTGAATTTCACATGCCTTGCATTTCACAGTTGTACTCCATGGTCAACC

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000361908_chr3_193332512_+_6349nt
ATGTGGCCACCTCGCTGCAAGGATCCAGGAAGGCAGAGTGCGGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACC
AACATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAG
GTCTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCAT
TCACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAA
CTGAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTAT
CTCATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATAT
AAATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTT
GTAAAGTTAGCACCAGACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTTCTCCGGAAGAAACGGCG
TTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGGTCTGCTTGGTGAGCTCATTCTCTTACAACAACAAATTCAA
GAGCATGAAGAGGAAGCGCGCAGAGCCGCTGGCCAATATAGCACGAGCTATGCCCAACAGAAGCGCAAGGTGTCAGACAAAGAGAAAATT
GACCAACTTCAGGAAGAACTTCTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAA
TTAGTATTGCAGAAAGATGACAAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTC
TCTGATTATGATGCCAGTTATAATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTG
GAAATGATTGCCCAAGCTCGAATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCT
CACCATGTGGCCCTATTTAAAGATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTT
CGAATGAGGAAAAATGTGAAAGAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTG
CTTGTTGACTTACCAGGTGTGATTAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTAC
ATGCAGAATCCTAATGCCATCATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATG
GACCCTCATGGAAGGAGAACCATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATA
ATTGAAGGAAAGCTCTTCCCAATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATA
AGAGAATATGAAGAAGAGTTTTTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGC
CTTGCAGTATCAGACTGCTTTTGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAA
ACTGAATGGAAGAATAACTATCCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTT
ATCAGTCTGAGCCAGGTTACACCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAAC
ATCTACCTTCCAGCTGCGCAGACCATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTT
CCTAATAAAGCAGTAGAGGTTGCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGAC
ATATTTGATAAACTTAAAGAGGCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATT
CAACACAATGCTTTGGAAGACCGATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGT
CTCAAGGATACTGAAAATGCAATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAG
TGTGTTCACAATGAAACCAAGAATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACC
ACAGTCCGGAAGAACCTTGAATCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTT
TTAAAAACAGCTCTAAACCATTGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAAT
GATGTGGTCTTGTTTTGGCGTATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGA
TTAGAGAAAAATGTTAAAGAGGTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTG
GCGGAAGACCTCAAGAAAGTTAGAGAAATTCAAGAAAAACTTGATGCTTTCATTGAAGCTCTTCATCAGGAGAAATAAATTAAAATCGTA
CTCATAATCAGCTCTGCATACATCTGAAGAACAAAAACATCAACGTCTTTTGTCCAGCCTCTTTTTCTTCTGCTGTTCCACCTTTCTAAA
CATACAATAAAGTCATGGGATAAAAATAATCGATGTATGTTACGGGCGCTTTAACCATCAGCTGCCTCTCGAATGGAAGAACAGTGGTAA
TGGATTAACATCCTATTTTGTTGTACTAAAGTGACAAATCGGAATAATATAATTGGTATGGCCATTAGGTTCAGTCCTTGAAGATAAGAA
ACTTGTTCTCTGTTTGTTGTCTTATTTGTGGTGGCACTCGTTTAATGGATTAACTGAGGTTGCTCAATGTTCAGTTTCTTTTCCAGAAAT
ACAATGCTAGGTGTTTTGAAATAAAACTTATATAGCAATTGTTTAAAGTTATCAATTGTATATAAAATCACAGTAGCCTGCTAAATCATT
GTATGTGTCTGTAGTATTCTATTCCCAGAAACTATTTGACCATGATAATTCAGTTTATATTCACCACATGAAAGAAAAATGGGTAACAGA
AGAACCCTTAAAACAGGTTAATTTGGATTGTAACGTTCAGTGAAAGAAATTTCAACCCTTCATAGCCAGCGAAGAAATTTGCCTTGGAAG
CCAAGTCAGTACCAGCTTACCTATTTGATTCAGTTGCTGTTTTCTCACTCTCTATATCCATTTGAAATTGATTTATTTTAGATGTTGTAT
ACTTACGTTAGGCTTTCTGTTAATAGTGGTTTTTCTCCTGTTGACAGAGCCACCGGATTATGACACAGGATGAGGAAGATTAAGGATAAT
CAATTGACTAATTTCATTTAGAATATTATCAAACATTTCAACTAGGTATCAGAAAAAGGCTTTCTTTCATAAGACTATTTTAAATAGAAA
TTATTTCAACAATTAAAGTAATGTTGACCATCCCCCTCTCAGCTGAATAAAGAAAAATTTAGTTCAATTTATTGCAATTTAATTACAATA
CTACCTTCACAACATTTTCATGTGTTTTAAATAAATATTTTTTAATTGGCTAAAGGACATTCAAGCAAAGAAATGCTTTCTTTACTTAAA
ATGTCTATCTCATTTGCTGCCTTTTCACTAAGCCTTTACTTTGTTAATAAAAGTGTCCATTGTGTGATGTTTTTGATTTTACAGTTTGCT
AAATCTTATTTTCTTGGAGTTGCTTTTTGGTAACAGCCCCATTGCTACTCCCCATTTTATTGTTTTACATCAATGCATGCTTCGTTGTGA
TCCCTCAAGATGTAACACTTGGTATGCTCGGTTGAGGATATGAAAAAATACTTCCGAAACCAGGAATTCAATGTATGTTTGTTTTATACT
GTTTGATAAGAAAAGTAGGTCCAGCCTTAAGCAGCACAGATGCGCTGGTAGATGCATAGTCAGGAACTTTTTTTATTTCTTTTAGGTCTA
GGGACAGGAGTGAATAGAAAGGGAGGAGAGCTCTATTATGTTCTATACACAGATTAGGAGATGACCTTACTGGGTACACCCCTCTAACCA
GTGCTTACAGGTTAATGCATGTTAATGAATATTTTTGCAGTTGTAAAGCATAACAATTACAACTACACATCTATTTCTAAAGAATAAAAC
AGGACCATATTTATTTACTTCTGTCAACTATAGAAAGAAAGACCTTCAGCTGTATTTCCACAGATTTCTCCCAAGGAAAAGGCTAATATT
AGTCACTACTGTTATCACATCCCTTTGTATAAGTTTTAAAAAGAGATGGAGGGAGATCTTCATTTCTTTGAGGAGATCAGTATTGTAACG
TATGTGAATAGATGATAACAATTAATATTACTAAAAGTCCCACATGAGAGTCCTGACGCCCTCTCCATGCCCCACAGTAATGTGGCTTCT
TTCATGGGTTTTTTTTTCTTCTTTTTAGCTGATCTCATCCTAAGCATGCTTTATTTTTCCTTGAAAGCTAGGTATTTATCAACTGCAGAT
GTTATTGAAAGAAAATAAAATTCAGTCTCAAGAGTAAACCCTGTGTCTTGTGTCTGTAGTTCAAAAGTCAGAAATGATTCTAATTTAAAC
AAAAAGATACTAAATATACAGAAGTTAAATTCGAACTAGCCACAGAATCATTTGTTTTTATGTCAGAATTTGCAAAGAGTGGAGTGGACA
AAGCTCTGTATGGAAGACTGAACAACTGTAAATAGATGATATCCAAACTTAATTTGGCTAGGACTTCAATTTTAAAAATCAGTGTACCTA
GGCAGTGCACAGCACGAAATAAGTGGCCCTTGCAGCTTCCCCGTTTAACCCACTGTGCTATAGTTGCGGGTGGAACAGTCAACCTTTCTA
GTAGTTTATGATATTGCCCTCTTTGTATTCCCATTTTCTACAGTTTTTTCCGCAGACTTCTTTCTGCAAATTATTCAGCCTCCAAATGCA
AATGAATGATATAAAAATAAGTAGGGAACATGGCAGAGAGTGGTGCTTCCCAGCCTCACAATGTGGGAATTTGACATAGGATGAGAGTCA
GAGTATAGGTTTAAAAGATAAAATCTTTAGTTAATAATTTTGTATTTATTTATTCTAGATGTATGTATCTGAGGAAAGAAATCTGGTATT
TTTGCTTTCCAATAAAGGGGATCAAAGTAATGGTTTTTCTCTCAGTTCTCTAAGCTGGTCTATGTTATAGCTCTAGCAGTATGGAAATGT
GCTTTAAAATATGCTTACCTTTTGAATGATCATGGCTATATGTTGTTGAGATATTTGAAACTTACCTTGTTTTCACTTGTGCACTGTGAA
TGAACTTTGTATTATTTTTTTAAAACCTTCACATTACGTGTAGATATTATTGCAACTTATATTTTGCCTGAGCTTGATCAAAGGTCATTT
GTGTAGATGAGTAATTAAAAAATATTTAAATCACATTATAATTCTATTATTGGAGAGCATCTTTTAAATTTTTTTCTGTTTTAACGAGGG
AAAGAGAAACCTGTATACCTAGGGTCATTATTTGACCCCATAGTATAACCAGATTCATGGTCTAACAAGCTCTCAGTGTGGCTTTTCTCT
GAATGCTTGAATTTCACATGCCTTGCATTTCACAGTTGTACTCCATGGTCAACCGGTGCTTTTTTTCACATCGTGGTACTTGTCAAAACA

>In-frame_XXYLT1_ENST00000355729_chr3_194877178_-_OPA1_ENST00000392438_chr3_193332512_+_6250nt
ATGTGGCCACCTCGCTGCAAGGATCCAGGAAGGCAGAGTGCGGAGATCCTGCAGATCATTCAGCTGGACCTAGACCTGAAGTTTAAGACC
AACATCCGGGAGTTGTTTGAGGAATTTGACAGTTTCCTGCCAGGCGCCATCATCGGCATAGCCCGGGAGATGCAGCCAGTTTACAGTGAG
GTCTGCCAGTCTTTAGTGAAACACAGCTCTGGAATAAAAGGAAGTTTACCACTACAAAAACTACATCTGGTTTCACGAAGCATTTATCAT
TCACATCATCCTACCTTAAAGCTTCAACGACCCCAATTAAGGACATCCTTTCAGCAGTTCTCTTCTCTGACAAACCTTCCTTTACGTAAA
CTGAAATTCTCTCCAATTAAATATGGCTACCAGCCTCGCAGGAATTTTTGGCCAGCAAGATTAGCTACGAGACTCTTAAAACTTCGCTAT
CTCATACTAGGATCGGCTGTTGGGGGTGGCTACACAGCCAAAAAGACTTTTGATCAGTGGAAAGATATGATACCGGACCTTAGTGAATAT
AAATGGATTGTGCCTGACATTGTGTGGGAAATTGATGAGTATATCGATTTTGAGAAAATTAGAAAAGCCCTTCCTAGTTCAGAAGACCTT
GTAAAGTTAGCACCAGACTTTGACAAGATTGTTGAAAGCCTTAGCTTATTGAAGGACTTTTTTACCTCAGGTTCTCCGGAAGAAACGGCG
TTTAGAGCAACAGATCGTGGATCTGAAAGTGACAAGCATTTTAGAAAGGTGTCAGACAAAGAGAAAATTGACCAACTTCAGGAAGAACTT
CTGCACACTCAGTTGAAGTATCAGAGAATCTTGGAACGATTAGAAAAGGAGAACAAAGAATTGAGAAAATTAGTATTGCAGAAAGATGAC
AAAGGCATTCATCATAGAAAGCTTAAGAAATCTTTGATTGACATGTATTCTGAAGTTCTTGATGTTCTCTCTGATTATGATGCCAGTTAT
AATACGCAAGATCATCTGCCACGGGTTGTTGTGGTTGGAGATCAGAGTGCTGGAAAGACTAGTGTGTTGGAAATGATTGCCCAAGCTCGA
ATATTCCCAAGAGGATCTGGGGAGATGATGACACGTTCTCCAGTTAAGGTGACTCTGAGTGAAGGTCCTCACCATGTGGCCCTATTTAAA
GATAGTTCTCGGGAGTTTGATCTTACCAAAGAAGAAGATCTTGCAGCATTAAGACATGAAATAGAACTTCGAATGAGGAAAAATGTGAAA
GAAGGCTGTACCGTTAGCCCTGAGACCATATCCTTAAATGTAAAAGGCCCTGGACTACAGAGGATGGTGCTTGTTGACTTACCAGGTGTG
ATTAATACTGTGACATCAGGCATGGCTCCTGACACAAAGGAAACTATTTTCAGTATCAGCAAAGCTTACATGCAGAATCCTAATGCCATC
ATACTGTGTATTCAAGATGGATCTGTGGATGCTGAACGCAGTATTGTTACAGACTTGGTCAGTCAAATGGACCCTCATGGAAGGAGAACC
ATATTCGTTTTGACCAAAGTAGACCTGGCAGAGAAAAATGTAGCCAGTCCAAGCAGGATTCAGCAGATAATTGAAGGAAAGCTCTTCCCA
ATGAAAGCTTTAGGTTATTTTGCTGTTGTAACAGGAAAAGGGAACAGCTCTGAAAGCATTGAAGCTATAAGAGAATATGAAGAAGAGTTT
TTTCAGAATTCAAAGCTCCTAAAGACAAGCATGCTAAAGGCACACCAAGTGACTACAAGAAATTTAAGCCTTGCAGTATCAGACTGCTTT
TGGAAAATGGTACGAGAGTCTGTTGAACAACAGGCTGATAGTTTCAAAGCAACACGTTTTAACCTTGAAACTGAATGGAAGAATAACTAT
CCTCGCCTGCGGGAACTTGACCGGAATGAACTATTTGAAAAAGCTAAAAATGAAATCCTTGATGAAGTTATCAGTCTGAGCCAGGTTACA
CCAAAACATTGGGAGGAAATCCTTCAACAATCTTTGTGGGAAAGAGTATCAACTCATGTGATTGAAAACATCTACCTTCCAGCTGCGCAG
ACCATGAATTCAGGAACTTTTAACACCACAGTGGATATCAAGCTTAAACAGTGGACTGATAAACAACTTCCTAATAAAGCAGTAGAGGTT
GCTTGGGAGACCCTACAAGAAGAATTTTCCCGCTTTATGACAGAACCGAAAGGGAAAGAGCATGATGACATATTTGATAAACTTAAAGAG
GCTGTTAAGGAAGAAAGTATTAAACGACACAAGTGGAATGACTTTGCGGAGGACAGCTTGAGGGTTATTCAACACAATGCTTTGGAAGAC
CGATCCATATCTGATAAACAGCAATGGGATGCAGCTATTTATTTTATGGAAGAGGCTCTGCAGGCTCGTCTCAAGGATACTGAAAATGCA
ATTGAAAACATGGTGGGTCCAGACTGGAAAAAGAGGTGGTTATACTGGAAGAATCGGACCCAAGAACAGTGTGTTCACAATGAAACCAAG
AATGAATTGGAGAAGATGTTGAAATGTAATGAGGAGCACCCAGCTTATCTTGCAAGTGATGAAATAACCACAGTCCGGAAGAACCTTGAA
TCCCGAGGAGTAGAAGTAGATCCAAGCTTGATTAAGGATACTTGGCATCAAGTTTATAGAAGACATTTTTTAAAAACAGCTCTAAACCAT
TGTAACCTTTGTCGAAGAGGTTTTTATTACTACCAAAGGCATTTTGTAGATTCTGAGTTGGAATGCAATGATGTGGTCTTGTTTTGGCGT
ATACAGCGCATGCTTGCTATCACCGCAAATACTTTAAGGCAACAACTTACAAATACTGAAGTTAGGCGATTAGAGAAAAATGTTAAAGAG
GTATTGGAAGATTTTGCTGAAGATGGTGAGAAGAAGATTAAATTGCTTACTGGTAAACGCGTTCAACTGGCGGAAGACCTCAAGAAAGTT
AGAGAAATTCAAGAAAAACTTGATGCTTTCATTGAAGCTCTTCATCAGGAGAAATAAATTAAAATCGTACTCATAATCAGCTCTGCATAC
ATCTGAAGAACAAAAACATCAACGTCTTTTGTCCAGCCTCTTTTTCTTCTGCTGTTCCACCTTTCTAAACATACAATAAAGTCATGGGAT
AAAAATAATCGATGTATGTTACGGGCGCTTTAACCATCAGCTGCCTCTCGAATGGAAGAACAGTGGTAATGGATTAACATCCTATTTTGT
TGTACTAAAGTGACAAATCGGAATAATATAATTGGTATGGCCATTAGGTTCAGTCCTTGAAGATAAGAAACTTGTTCTCTGTTTGTTGTC
TTATTTGTGGTGGCACTCGTTTAATGGATTAACTGAGGTTGCTCAATGTTCAGTTTCTTTTCCAGAAATACAATGCTAGGTGTTTTGAAA
TAAAACTTATATAGCAATTGTTTAAAGTTATCAATTGTATATAAAATCACAGTAGCCTGCTAAATCATTGTATGTGTCTGTAGTATTCTA
TTCCCAGAAACTATTTGACCATGATAATTCAGTTTATATTCACCACATGAAAGAAAAATGGGTAACAGAAGAACCCTTAAAACAGGTTAA
TTTGGATTGTAACGTTCAGTGAAAGAAATTTCAACCCTTCATAGCCAGCGAAGAAATTTGCCTTGGAAGCCAAGTCAGTACCAGCTTACC
TATTTGATTCAGTTGCTGTTTTCTCACTCTCTATATCCATTTGAAATTGATTTATTTTAGATGTTGTATACTTACGTTAGGCTTTCTGTT
AATAGTGGTTTTTCTCCTGTTGACAGAGCCACCGGATTATGACACAGGATGAGGAAGATTAAGGATAATCAATTGACTAATTTCATTTAG
AATATTATCAAACATTTCAACTAGGTATCAGAAAAAGGCTTTCTTTCATAAGACTATTTTAAATAGAAATTATTTCAACAATTAAAGTAA
TGTTGACCATCCCCCTCTCAGCTGAATAAAGAAAAATTTAGTTCAATTTATTGCAATTTAATTACAATACTACCTTCACAACATTTTCAT
GTGTTTTAAATAAATATTTTTTAATTGGCTAAAGGACATTCAAGCAAAGAAATGCTTTCTTTACTTAAAATGTCTATCTCATTTGCTGCC
TTTTCACTAAGCCTTTACTTTGTTAATAAAAGTGTCCATTGTGTGATGTTTTTGATTTTACAGTTTGCTAAATCTTATTTTCTTGGAGTT
GCTTTTTGGTAACAGCCCCATTGCTACTCCCCATTTTATTGTTTTACATCAATGCATGCTTCGTTGTGATCCCTCAAGATGTAACACTTG
GTATGCTCGGTTGAGGATATGAAAAAATACTTCCGAAACCAGGAATTCAATGTATGTTTGTTTTATACTGTTTGATAAGAAAAGTAGGTC
CAGCCTTAAGCAGCACAGATGCGCTGGTAGATGCATAGTCAGGAACTTTTTTTATTTCTTTTAGGTCTAGGGACAGGAGTGAATAGAAAG
GGAGGAGAGCTCTATTATGTTCTATACACAGATTAGGAGATGACCTTACTGGGTACACCCCTCTAACCAGTGCTTACAGGTTAATGCATG
TTAATGAATATTTTTGCAGTTGTAAAGCATAACAATTACAACTACACATCTATTTCTAAAGAATAAAACAGGACCATATTTATTTACTTC
TGTCAACTATAGAAAGAAAGACCTTCAGCTGTATTTCCACAGATTTCTCCCAAGGAAAAGGCTAATATTAGTCACTACTGTTATCACATC
CCTTTGTATAAGTTTTAAAAAGAGATGGAGGGAGATCTTCATTTCTTTGAGGAGATCAGTATTGTAACGTATGTGAATAGATGATAACAA
TTAATATTACTAAAAGTCCCACATGAGAGTCCTGACGCCCTCTCCATGCCCCACAGTAATGTGGCTTCTTTCATGGGTTTTTTTTTCTTC
TTTTTAGCTGATCTCATCCTAAGCATGCTTTATTTTTCCTTGAAAGCTAGGTATTTATCAACTGCAGATGTTATTGAAAGAAAATAAAAT
TCAGTCTCAAGAGTAAACCCTGTGTCTTGTGTCTGTAGTTCAAAAGTCAGAAATGATTCTAATTTAAACAAAAAGATACTAAATATACAG
AAGTTAAATTCGAACTAGCCACAGAATCATTTGTTTTTATGTCAGAATTTGCAAAGAGTGGAGTGGACAAAGCTCTGTATGGAAGACTGA
ACAACTGTAAATAGATGATATCCAAACTTAATTTGGCTAGGACTTCAATTTTAAAAATCAGTGTACCTAGGCAGTGCACAGCACGAAATA
AGTGGCCCTTGCAGCTTCCCCGTTTAACCCACTGTGCTATAGTTGCGGGTGGAACAGTCAACCTTTCTAGTAGTTTATGATATTGCCCTC
TTTGTATTCCCATTTTCTACAGTTTTTTCCGCAGACTTCTTTCTGCAAATTATTCAGCCTCCAAATGCAAATGAATGATATAAAAATAAG
TAGGGAACATGGCAGAGAGTGGTGCTTCCCAGCCTCACAATGTGGGAATTTGACATAGGATGAGAGTCAGAGTATAGGTTTAAAAGATAA
AATCTTTAGTTAATAATTTTGTATTTATTTATTCTAGATGTATGTATCTGAGGAAAGAAATCTGGTATTTTTGCTTTCCAATAAAGGGGA
TCAAAGTAATGGTTTTTCTCTCAGTTCTCTAAGCTGGTCTATGTTATAGCTCTAGCAGTATGGAAATGTGCTTTAAAATATGCTTACCTT
TTGAATGATCATGGCTATATGTTGTTGAGATATTTGAAACTTACCTTGTTTTCACTTGTGCACTGTGAATGAACTTTGTATTATTTTTTT
AAAACCTTCACATTACGTGTAGATATTATTGCAACTTATATTTTGCCTGAGCTTGATCAAAGGTCATTTGTGTAGATGAGTAATTAAAAA
ATATTTAAATCACATTATAATTCTATTATTGGAGAGCATCTTTTAAATTTTTTTCTGTTTTAACGAGGGAAAGAGAAACCTGTATACCTA
GGGTCATTATTTGACCCCATAGTATAACCAGATTCATGGTCTAACAAGCTCTCAGTGTGGCTTTTCTCTGAATGCTTGAATTTCACATGC
CTTGCATTTCACAGTTGTACTCCATGGTCAACCGGTGCTTTTTTTCACATCGTGGTACTTGTCAAAACATTTTGTTATTTTCCTTGGTAA


Top

FusionGenePPI for XXYLT1_OPA1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
XXYLT1ELAVL1, CUL4A, SHMT2, MOV10, NXF1, FAM63B, SCN3B, IZUMO1, HAUS7OPA1MME, ELAVL1, CUL3, CAND1, SMAD2, SMAD3, APP, ILF3, NDUFS8, DNASE2, ECH1, NDUFS1, NIT2, HSP90AA5P, NDUFA9, HADHB, NPTX1, HTRA2, MYC, PARK2, EGFR, BNIP3, PRDX3, SCGN, SCN2B, UNK, ARHGAP17, EEF2, EHD1, NTRK1, XRCC3, MCM2, COQ9, PTPN7, VIPR2, FAM196A, NPY2R, PTH1R, FAM174A, EPHA1, GID8


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000310380-34263_266261394target proteins
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000355729-23263_26658191target proteins
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000356740-12263_2660188target proteins
HgeneXXYLT1chr3:194877178chr3:193332512ENST00000437101-45263_26658191target proteins


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for XXYLT1_OPA1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for XXYLT1_OPA1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneOPA1C0338508Optic Atrophy, Autosomal Dominant21CTD_human;ORPHANET;UNIPROT
TgeneOPA1C3276549OPTIC ATROPHY WITH OR WITHOUT DEAFNESS, OPHTHALMOPLEGIA, MYOPATHY, ATAXIA, AND NEUROPATHY10UNIPROT
TgeneOPA1C0036341Schizophrenia2PSYGENET
TgeneOPA1C0029408Degenerative polyarthritis1CTD_human
TgeneOPA1C0221061Behr syndrome1ORPHANET;UNIPROT
TgeneOPA1C4225163MITOCHONDRIAL DNA DEPLETION SYNDROME 14 (CARDIOENCEPHALOMYOPATHIC TYPE)1UNIPROT