FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42225

FusionGeneSummary for XRCC6_ARSB

check button Fusion gene summary
Fusion gene informationFusion gene name: XRCC6_ARSB
Fusion gene ID: 42225
HgeneTgene
Gene symbol

XRCC6

ARSB

Gene ID

2547

411

Gene nameX-ray repair cross complementing 6arylsulfatase B
SynonymsCTC75|CTCBF|G22P1|KU70|ML8|TLAAASB|G4S|MPS6
Cytomap

22q13.2

5q14.1

Type of geneprotein-codingprotein-coding
DescriptionX-ray repair cross-complementing protein 65'-dRP lyase Ku705'-deoxyribose-5-phosphate lyase Ku7070 kDa subunit of Ku antigenATP-dependent DNA helicase 2 subunit 1ATP-dependent DNA helicase II, 70 kDa subunitCTC box binding factor 75 kDa subunitDNA arylsulfatase BN-acetylgalactosamine-4-sulfatase
Modification date2018052320180522
UniProtAcc

P12956

P15848

Ensembl transtripts involved in fusion geneENST00000360079, ENST00000402580, 
ENST00000428575, ENST00000359308, 
ENST00000405878, ENST00000405506, 
ENST00000264914, ENST00000396151, 
ENST00000565165, ENST00000521800, 
Fusion gene scores* DoF score7 X 5 X 7=2455 X 3 X 4=60
# samples 74
** MAII scorelog2(7/245*10)=-1.8073549220576
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/60*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: XRCC6 [Title/Abstract] AND ARSB [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneXRCC6

GO:0002218

activation of innate immune response

28712728

HgeneXRCC6

GO:0045860

positive regulation of protein kinase activity

22504299

HgeneXRCC6

GO:0045893

positive regulation of transcription, DNA-templated

12145306

HgeneXRCC6

GO:0051290

protein heterotetramerization

24095731

HgeneXRCC6

GO:0071480

cellular response to gamma radiation

26359349

HgeneXRCC6

GO:0097680

double-strand break repair via classical nonhomologous end joining

24095731


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-XV-AAZY-01AXRCC6chr22

42024234

+ARSBchr5

78265015

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000360079ENST00000264914XRCC6chr22

42024234

+ARSBchr5

78265015

-
In-frameENST00000360079ENST00000396151XRCC6chr22

42024234

+ARSBchr5

78265015

-
In-frameENST00000360079ENST00000565165XRCC6chr22

42024234

+ARSBchr5

78265015

-
5CDS-intronENST00000360079ENST00000521800XRCC6chr22

42024234

+ARSBchr5

78265015

-
In-frameENST00000402580ENST00000264914XRCC6chr22

42024234

+ARSBchr5

78265015

-
In-frameENST00000402580ENST00000396151XRCC6chr22

42024234

+ARSBchr5

78265015

-
In-frameENST00000402580ENST00000565165XRCC6chr22

42024234

+ARSBchr5

78265015

-
5CDS-intronENST00000402580ENST00000521800XRCC6chr22

42024234

+ARSBchr5

78265015

-
intron-3CDSENST00000428575ENST00000264914XRCC6chr22

42024234

+ARSBchr5

78265015

-
intron-3CDSENST00000428575ENST00000396151XRCC6chr22

42024234

+ARSBchr5

78265015

-
intron-3CDSENST00000428575ENST00000565165XRCC6chr22

42024234

+ARSBchr5

78265015

-
intron-intronENST00000428575ENST00000521800XRCC6chr22

42024234

+ARSBchr5

78265015

-
In-frameENST00000359308ENST00000264914XRCC6chr22

42024234

+ARSBchr5

78265015

-
In-frameENST00000359308ENST00000396151XRCC6chr22

42024234

+ARSBchr5

78265015

-
In-frameENST00000359308ENST00000565165XRCC6chr22

42024234

+ARSBchr5

78265015

-
5CDS-intronENST00000359308ENST00000521800XRCC6chr22

42024234

+ARSBchr5

78265015

-
In-frameENST00000405878ENST00000264914XRCC6chr22

42024234

+ARSBchr5

78265015

-
In-frameENST00000405878ENST00000396151XRCC6chr22

42024234

+ARSBchr5

78265015

-
In-frameENST00000405878ENST00000565165XRCC6chr22

42024234

+ARSBchr5

78265015

-
5CDS-intronENST00000405878ENST00000521800XRCC6chr22

42024234

+ARSBchr5

78265015

-
intron-3CDSENST00000405506ENST00000264914XRCC6chr22

42024234

+ARSBchr5

78265015

-
intron-3CDSENST00000405506ENST00000396151XRCC6chr22

42024234

+ARSBchr5

78265015

-
intron-3CDSENST00000405506ENST00000565165XRCC6chr22

42024234

+ARSBchr5

78265015

-
intron-intronENST00000405506ENST00000521800XRCC6chr22

42024234

+ARSBchr5

78265015

-

Top

FusionProtFeatures for XRCC6_ARSB


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
XRCC6

P12956

ARSB

P15848

Single-stranded DNA-dependent ATP-dependent helicase.Has a role in chromosome translocation. The DNA helicase IIcomplex binds preferentially to fork-like ends of double-strandedDNA in a cell cycle-dependent manner. It works in the 3'-5'direction. Binding to DNA may be mediated by XRCC6. Involved inDNA non-homologous end joining (NHEJ) required for double-strandbreak repair and V(D)J recombination. The XRCC5/6 dimer acts asregulatory subunit of the DNA-dependent protein kinase complexDNA-PK by increasing the affinity of the catalytic subunit PRKDCto DNA by 100-fold. The XRCC5/6 dimer is probably involved instabilizing broken DNA ends and bringing them together. Theassembly of the DNA-PK complex to DNA ends is required for theNHEJ ligation step. Required for osteocalcin gene expression.Probably also acts as a 5'-deoxyribose-5-phosphate lyase (5'-dRPlyase), by catalyzing the beta-elimination of the 5' deoxyribose-5-phosphate at an abasic site near double-strand breaks. 5'-dRPlyase activity allows to 'clean' the termini of abasic sites, aclass of nucleotide damage commonly associated with strand breaks,before such broken ends can be joined. The XRCC5/6 dimer togetherwith APEX1 acts as a negative regulator of transcription. Plays arole in the regulation of DNA virus-mediated innate immuneresponse by assembling into the HDP-RNP complex, a complex thatserves as a platform for IRF3 phosphorylation and subsequentinnate immune response activation through the cGAS-STING pathway.{ECO:0000269|PubMed:12145306, ECO:0000269|PubMed:20383123,ECO:0000269|PubMed:20493174, ECO:0000269|PubMed:2466842,ECO:0000269|PubMed:28712728, ECO:0000269|PubMed:7957065,ECO:0000269|PubMed:8621488, ECO:0000269|PubMed:9742108}. Removes sulfate groups from chondroitin-4-sulfate (C4S)and regulates its degradation (PubMed:19306108). Involved in theregulation of cell adhesion, cell migration and invasion incolonic epithelium (PubMed:19306108). In the central nervoussystem, is a regulator of neurite outgrowth and neuronalplasticity, acting through the control of sulfateglycosaminoglycans and neurocan levels (By similarity).{ECO:0000250|UniProtKB:P50430, ECO:0000269|PubMed:19306108}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneXRCC6chr22:42024234chr5:78265015ENST00000359308+21211_2965610Compositional biasNote=Asp/Glu-rich (acidic)
HgeneXRCC6chr22:42024234chr5:78265015ENST00000359308+2122_6165610Compositional biasNote=Ser-rich (potentially targets for phosphorylation)
HgeneXRCC6chr22:42024234chr5:78265015ENST00000360079+31311_2965610Compositional biasNote=Asp/Glu-rich (acidic)
HgeneXRCC6chr22:42024234chr5:78265015ENST00000360079+3132_6165610Compositional biasNote=Ser-rich (potentially targets for phosphorylation)
HgeneXRCC6chr22:42024234chr5:78265015ENST00000405878+31311_2965610Compositional biasNote=Asp/Glu-rich (acidic)
HgeneXRCC6chr22:42024234chr5:78265015ENST00000405878+3132_6165610Compositional biasNote=Ser-rich (potentially targets for phosphorylation)

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneXRCC6chr22:42024234chr5:78265015ENST00000359308+212330_34265610Compositional biasNote=Asp/Glu-rich (acidic)
HgeneXRCC6chr22:42024234chr5:78265015ENST00000360079+313330_34265610Compositional biasNote=Asp/Glu-rich (acidic)
HgeneXRCC6chr22:42024234chr5:78265015ENST00000405878+313330_34265610Compositional biasNote=Asp/Glu-rich (acidic)
HgeneXRCC6chr22:42024234chr5:78265015ENST00000359308+212261_46865610DomainNote=Ku
HgeneXRCC6chr22:42024234chr5:78265015ENST00000359308+212573_60765610DomainSAP
HgeneXRCC6chr22:42024234chr5:78265015ENST00000360079+313261_46865610DomainNote=Ku
HgeneXRCC6chr22:42024234chr5:78265015ENST00000360079+313573_60765610DomainSAP
HgeneXRCC6chr22:42024234chr5:78265015ENST00000405878+313261_46865610DomainNote=Ku
HgeneXRCC6chr22:42024234chr5:78265015ENST00000405878+313573_60765610DomainSAP


Top

FusionGeneSequence for XRCC6_ARSB


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_XRCC6_ENST00000360079_chr22_42024234_+_ARSB_ENST00000264914_chr5_78265015_-_495aa
MSGWESTYKTEGDEEAEEEQEENLEASGDTKTSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQIRTGLQHQIIWPCQPSCVPLDEKLL
PQLLKEAGTTTHMVGKWHLGMYRKECLPTRRGFDTYFGTLLGSEDTTSHERCTLIDALNVTRCALDFRDGEEVATGTKNMTSTNIFTKRA
IALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPTDFIQDKNRHHTAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGG
NNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNF
VDSSPCPRNSMAPAKDDSSLPETSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSR

>In-frame_XRCC6_ENST00000360079_chr22_42024234_+_ARSB_ENST00000396151_chr5_78265015_-_375aa
MSGWESTYKTEGDEEAEEEQEENLEASGDTKTSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQIRTGLQHQIIWPCQPSCVPLDEKLL
PQLLKEAGTTTHMVGKWHLGMYRKECLPTRRGFDTYFGTLLGSEDTTSHERCTLIDALNVTRCALDFRDGEEVATGTKNMTSTNIFTKRA
IALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPTDFIQDKNRHHTAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGG
NNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNF

>In-frame_XRCC6_ENST00000360079_chr22_42024234_+_ARSB_ENST00000565165_chr5_78265015_-_375aa
MSGWESTYKTEGDEEAEEEQEENLEASGDTKTSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQIRTGLQHQIIWPCQPSCVPLDEKLL
PQLLKEAGTTTHMVGKWHLGMYRKECLPTRRGFDTYFGTLLGSEDTTSHERCTLIDALNVTRCALDFRDGEEVATGTKNMTSTNIFTKRA
IALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPTDFIQDKNRHHTAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGG
NNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNF

>In-frame_XRCC6_ENST00000402580_chr22_42024234_+_ARSB_ENST00000264914_chr5_78265015_-_495aa
MSGWESTYKTEGDEEAEEEQEENLEASGDTKTSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQIRTGLQHQIIWPCQPSCVPLDEKLL
PQLLKEAGTTTHMVGKWHLGMYRKECLPTRRGFDTYFGTLLGSEDTTSHERCTLIDALNVTRCALDFRDGEEVATGTKNMTSTNIFTKRA
IALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPTDFIQDKNRHHTAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGG
NNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNF
VDSSPCPRNSMAPAKDDSSLPETSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSR

>In-frame_XRCC6_ENST00000402580_chr22_42024234_+_ARSB_ENST00000396151_chr5_78265015_-_375aa
MSGWESTYKTEGDEEAEEEQEENLEASGDTKTSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQIRTGLQHQIIWPCQPSCVPLDEKLL
PQLLKEAGTTTHMVGKWHLGMYRKECLPTRRGFDTYFGTLLGSEDTTSHERCTLIDALNVTRCALDFRDGEEVATGTKNMTSTNIFTKRA
IALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPTDFIQDKNRHHTAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGG
NNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNF

>In-frame_XRCC6_ENST00000402580_chr22_42024234_+_ARSB_ENST00000565165_chr5_78265015_-_375aa
MSGWESTYKTEGDEEAEEEQEENLEASGDTKTSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQIRTGLQHQIIWPCQPSCVPLDEKLL
PQLLKEAGTTTHMVGKWHLGMYRKECLPTRRGFDTYFGTLLGSEDTTSHERCTLIDALNVTRCALDFRDGEEVATGTKNMTSTNIFTKRA
IALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPTDFIQDKNRHHTAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGG
NNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNF

>In-frame_XRCC6_ENST00000359308_chr22_42024234_+_ARSB_ENST00000264914_chr5_78265015_-_495aa
MSGWESTYKTEGDEEAEEEQEENLEASGDTKTSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQIRTGLQHQIIWPCQPSCVPLDEKLL
PQLLKEAGTTTHMVGKWHLGMYRKECLPTRRGFDTYFGTLLGSEDTTSHERCTLIDALNVTRCALDFRDGEEVATGTKNMTSTNIFTKRA
IALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPTDFIQDKNRHHTAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGG
NNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNF
VDSSPCPRNSMAPAKDDSSLPETSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSR

>In-frame_XRCC6_ENST00000359308_chr22_42024234_+_ARSB_ENST00000396151_chr5_78265015_-_375aa
MSGWESTYKTEGDEEAEEEQEENLEASGDTKTSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQIRTGLQHQIIWPCQPSCVPLDEKLL
PQLLKEAGTTTHMVGKWHLGMYRKECLPTRRGFDTYFGTLLGSEDTTSHERCTLIDALNVTRCALDFRDGEEVATGTKNMTSTNIFTKRA
IALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPTDFIQDKNRHHTAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGG
NNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNF

>In-frame_XRCC6_ENST00000359308_chr22_42024234_+_ARSB_ENST00000565165_chr5_78265015_-_375aa
MSGWESTYKTEGDEEAEEEQEENLEASGDTKTSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQIRTGLQHQIIWPCQPSCVPLDEKLL
PQLLKEAGTTTHMVGKWHLGMYRKECLPTRRGFDTYFGTLLGSEDTTSHERCTLIDALNVTRCALDFRDGEEVATGTKNMTSTNIFTKRA
IALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPTDFIQDKNRHHTAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGG
NNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNF

>In-frame_XRCC6_ENST00000405878_chr22_42024234_+_ARSB_ENST00000264914_chr5_78265015_-_495aa
MSGWESTYKTEGDEEAEEEQEENLEASGDTKTSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQIRTGLQHQIIWPCQPSCVPLDEKLL
PQLLKEAGTTTHMVGKWHLGMYRKECLPTRRGFDTYFGTLLGSEDTTSHERCTLIDALNVTRCALDFRDGEEVATGTKNMTSTNIFTKRA
IALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPTDFIQDKNRHHTAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGG
NNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNF
VDSSPCPRNSMAPAKDDSSLPETSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSR

>In-frame_XRCC6_ENST00000405878_chr22_42024234_+_ARSB_ENST00000396151_chr5_78265015_-_375aa
MSGWESTYKTEGDEEAEEEQEENLEASGDTKTSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQIRTGLQHQIIWPCQPSCVPLDEKLL
PQLLKEAGTTTHMVGKWHLGMYRKECLPTRRGFDTYFGTLLGSEDTTSHERCTLIDALNVTRCALDFRDGEEVATGTKNMTSTNIFTKRA
IALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPTDFIQDKNRHHTAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGG
NNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNF

>In-frame_XRCC6_ENST00000405878_chr22_42024234_+_ARSB_ENST00000565165_chr5_78265015_-_375aa
MSGWESTYKTEGDEEAEEEQEENLEASGDTKTSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQIRTGLQHQIIWPCQPSCVPLDEKLL
PQLLKEAGTTTHMVGKWHLGMYRKECLPTRRGFDTYFGTLLGSEDTTSHERCTLIDALNVTRCALDFRDGEEVATGTKNMTSTNIFTKRA
IALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPTDFIQDKNRHHTAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGG
NNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_XRCC6_ENST00000360079_chr22_42024234_+_ARSB_ENST00000264914_chr5_78265015_-_1485nt
ATGTCAGGGTGGGAGTCATATTACAAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTAT
AAATATTCAGGAAGAGATAGTTTGATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTT
GACATGAGCATCCAGATCCGTACAGGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTG
CCCCAGCTCCTAAAAGAAGCAGGTTATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGC
CGAGGATTTGATACCTACTTTGGATATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTC
ACACGATGTGCTCTTGATTTTCGAGATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCT
ATAGCCCTCATAACTAACCATCCACCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAG
GAATACTTGAAGCCATATGACTTTATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAAT
GTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGT
AATAACTGGCCCCTTCGAGGAAGAAAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAG
AAGGGCGTGAAGAACCGGGAGCTCATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAG
CCTCTGGATGGCTTCGACGTGTGGAAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTC
GTGGACTCTTCACCGTGTCCCAGGAACAGCATGGCTCCAGCAAAGGATGACTCTTCTCTTCCAGAATATTCAGCCTTTAACACATCTGTC
CATGCTGCAATTAGACATGGAAATTGGAAACTCCTCACGGGCTACCCAGGCTGTGGTTACTGGTTCCCTCCACCGTCTCAATACAATGTT
TCTGAGATACCCTCATCAGACCCACCAACCAAGACCCTCTGGCTCTTTGATATTGATCGGGACCCTGAAGAAAGACATGACCTGTCCAGA
GAATATCCTCACATCGTCACAAAGCTCCTGTCCCGCCTACAGTTCTACCATAAACACTCAGTCCCCGTGTACTTCCCTGCACAGGACCCC

>In-frame_XRCC6_ENST00000360079_chr22_42024234_+_ARSB_ENST00000396151_chr5_78265015_-_1125nt
ATGTCAGGGTGGGAGTCATATTACAAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTAT
AAATATTCAGGAAGAGATAGTTTGATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTT
GACATGAGCATCCAGATCCGTACAGGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTG
CCCCAGCTCCTAAAAGAAGCAGGTTATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGC
CGAGGATTTGATACCTACTTTGGATATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTC
ACACGATGTGCTCTTGATTTTCGAGATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCT
ATAGCCCTCATAACTAACCATCCACCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAG
GAATACTTGAAGCCATATGACTTTATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAAT
GTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGT
AATAACTGGCCCCTTCGAGGAAGAAAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAG
AAGGGCGTGAAGAACCGGGAGCTCATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAG
CCTCTGGATGGCTTCGACGTGTGGAAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTC

>In-frame_XRCC6_ENST00000360079_chr22_42024234_+_ARSB_ENST00000565165_chr5_78265015_-_1125nt
ATGTCAGGGTGGGAGTCATATTACAAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTAT
AAATATTCAGGAAGAGATAGTTTGATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTT
GACATGAGCATCCAGATCCGTACAGGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTG
CCCCAGCTCCTAAAAGAAGCAGGTTATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGC
CGAGGATTTGATACCTACTTTGGATATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTC
ACACGATGTGCTCTTGATTTTCGAGATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCT
ATAGCCCTCATAACTAACCATCCACCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAG
GAATACTTGAAGCCATATGACTTTATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAAT
GTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGT
AATAACTGGCCCCTTCGAGGAAGAAAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAG
AAGGGCGTGAAGAACCGGGAGCTCATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAG
CCTCTGGATGGCTTCGACGTGTGGAAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTC

>In-frame_XRCC6_ENST00000402580_chr22_42024234_+_ARSB_ENST00000264914_chr5_78265015_-_1485nt
ATGTCAGGGTGGGAGTCATATTACAAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTAT
AAATATTCAGGAAGAGATAGTTTGATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTT
GACATGAGCATCCAGATCCGTACAGGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTG
CCCCAGCTCCTAAAAGAAGCAGGTTATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGC
CGAGGATTTGATACCTACTTTGGATATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTC
ACACGATGTGCTCTTGATTTTCGAGATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCT
ATAGCCCTCATAACTAACCATCCACCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAG
GAATACTTGAAGCCATATGACTTTATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAAT
GTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGT
AATAACTGGCCCCTTCGAGGAAGAAAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAG
AAGGGCGTGAAGAACCGGGAGCTCATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAG
CCTCTGGATGGCTTCGACGTGTGGAAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTC
GTGGACTCTTCACCGTGTCCCAGGAACAGCATGGCTCCAGCAAAGGATGACTCTTCTCTTCCAGAATATTCAGCCTTTAACACATCTGTC
CATGCTGCAATTAGACATGGAAATTGGAAACTCCTCACGGGCTACCCAGGCTGTGGTTACTGGTTCCCTCCACCGTCTCAATACAATGTT
TCTGAGATACCCTCATCAGACCCACCAACCAAGACCCTCTGGCTCTTTGATATTGATCGGGACCCTGAAGAAAGACATGACCTGTCCAGA
GAATATCCTCACATCGTCACAAAGCTCCTGTCCCGCCTACAGTTCTACCATAAACACTCAGTCCCCGTGTACTTCCCTGCACAGGACCCC

>In-frame_XRCC6_ENST00000402580_chr22_42024234_+_ARSB_ENST00000396151_chr5_78265015_-_1125nt
ATGTCAGGGTGGGAGTCATATTACAAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTAT
AAATATTCAGGAAGAGATAGTTTGATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTT
GACATGAGCATCCAGATCCGTACAGGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTG
CCCCAGCTCCTAAAAGAAGCAGGTTATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGC
CGAGGATTTGATACCTACTTTGGATATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTC
ACACGATGTGCTCTTGATTTTCGAGATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCT
ATAGCCCTCATAACTAACCATCCACCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAG
GAATACTTGAAGCCATATGACTTTATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAAT
GTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGT
AATAACTGGCCCCTTCGAGGAAGAAAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAG
AAGGGCGTGAAGAACCGGGAGCTCATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAG
CCTCTGGATGGCTTCGACGTGTGGAAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTC

>In-frame_XRCC6_ENST00000402580_chr22_42024234_+_ARSB_ENST00000565165_chr5_78265015_-_1125nt
ATGTCAGGGTGGGAGTCATATTACAAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTAT
AAATATTCAGGAAGAGATAGTTTGATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTT
GACATGAGCATCCAGATCCGTACAGGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTG
CCCCAGCTCCTAAAAGAAGCAGGTTATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGC
CGAGGATTTGATACCTACTTTGGATATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTC
ACACGATGTGCTCTTGATTTTCGAGATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCT
ATAGCCCTCATAACTAACCATCCACCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAG
GAATACTTGAAGCCATATGACTTTATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAAT
GTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGT
AATAACTGGCCCCTTCGAGGAAGAAAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAG
AAGGGCGTGAAGAACCGGGAGCTCATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAG
CCTCTGGATGGCTTCGACGTGTGGAAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTC

>In-frame_XRCC6_ENST00000359308_chr22_42024234_+_ARSB_ENST00000264914_chr5_78265015_-_1485nt
ATGTCAGGGTGGGAGTCATATTACAAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTAT
AAATATTCAGGAAGAGATAGTTTGATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTT
GACATGAGCATCCAGATCCGTACAGGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTG
CCCCAGCTCCTAAAAGAAGCAGGTTATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGC
CGAGGATTTGATACCTACTTTGGATATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTC
ACACGATGTGCTCTTGATTTTCGAGATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCT
ATAGCCCTCATAACTAACCATCCACCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAG
GAATACTTGAAGCCATATGACTTTATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAAT
GTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGT
AATAACTGGCCCCTTCGAGGAAGAAAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAG
AAGGGCGTGAAGAACCGGGAGCTCATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAG
CCTCTGGATGGCTTCGACGTGTGGAAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTC
GTGGACTCTTCACCGTGTCCCAGGAACAGCATGGCTCCAGCAAAGGATGACTCTTCTCTTCCAGAATATTCAGCCTTTAACACATCTGTC
CATGCTGCAATTAGACATGGAAATTGGAAACTCCTCACGGGCTACCCAGGCTGTGGTTACTGGTTCCCTCCACCGTCTCAATACAATGTT
TCTGAGATACCCTCATCAGACCCACCAACCAAGACCCTCTGGCTCTTTGATATTGATCGGGACCCTGAAGAAAGACATGACCTGTCCAGA
GAATATCCTCACATCGTCACAAAGCTCCTGTCCCGCCTACAGTTCTACCATAAACACTCAGTCCCCGTGTACTTCCCTGCACAGGACCCC

>In-frame_XRCC6_ENST00000359308_chr22_42024234_+_ARSB_ENST00000396151_chr5_78265015_-_1125nt
ATGTCAGGGTGGGAGTCATATTACAAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTAT
AAATATTCAGGAAGAGATAGTTTGATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTT
GACATGAGCATCCAGATCCGTACAGGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTG
CCCCAGCTCCTAAAAGAAGCAGGTTATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGC
CGAGGATTTGATACCTACTTTGGATATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTC
ACACGATGTGCTCTTGATTTTCGAGATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCT
ATAGCCCTCATAACTAACCATCCACCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAG
GAATACTTGAAGCCATATGACTTTATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAAT
GTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGT
AATAACTGGCCCCTTCGAGGAAGAAAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAG
AAGGGCGTGAAGAACCGGGAGCTCATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAG
CCTCTGGATGGCTTCGACGTGTGGAAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTC

>In-frame_XRCC6_ENST00000359308_chr22_42024234_+_ARSB_ENST00000565165_chr5_78265015_-_1125nt
ATGTCAGGGTGGGAGTCATATTACAAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTAT
AAATATTCAGGAAGAGATAGTTTGATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTT
GACATGAGCATCCAGATCCGTACAGGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTG
CCCCAGCTCCTAAAAGAAGCAGGTTATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGC
CGAGGATTTGATACCTACTTTGGATATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTC
ACACGATGTGCTCTTGATTTTCGAGATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCT
ATAGCCCTCATAACTAACCATCCACCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAG
GAATACTTGAAGCCATATGACTTTATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAAT
GTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGT
AATAACTGGCCCCTTCGAGGAAGAAAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAG
AAGGGCGTGAAGAACCGGGAGCTCATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAG
CCTCTGGATGGCTTCGACGTGTGGAAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTC

>In-frame_XRCC6_ENST00000405878_chr22_42024234_+_ARSB_ENST00000264914_chr5_78265015_-_1485nt
ATGTCAGGGTGGGAGTCATATTACAAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTAT
AAATATTCAGGAAGAGATAGTTTGATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTT
GACATGAGCATCCAGATCCGTACAGGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTG
CCCCAGCTCCTAAAAGAAGCAGGTTATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGC
CGAGGATTTGATACCTACTTTGGATATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTC
ACACGATGTGCTCTTGATTTTCGAGATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCT
ATAGCCCTCATAACTAACCATCCACCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAG
GAATACTTGAAGCCATATGACTTTATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAAT
GTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGT
AATAACTGGCCCCTTCGAGGAAGAAAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAG
AAGGGCGTGAAGAACCGGGAGCTCATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAG
CCTCTGGATGGCTTCGACGTGTGGAAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTC
GTGGACTCTTCACCGTGTCCCAGGAACAGCATGGCTCCAGCAAAGGATGACTCTTCTCTTCCAGAATATTCAGCCTTTAACACATCTGTC
CATGCTGCAATTAGACATGGAAATTGGAAACTCCTCACGGGCTACCCAGGCTGTGGTTACTGGTTCCCTCCACCGTCTCAATACAATGTT
TCTGAGATACCCTCATCAGACCCACCAACCAAGACCCTCTGGCTCTTTGATATTGATCGGGACCCTGAAGAAAGACATGACCTGTCCAGA
GAATATCCTCACATCGTCACAAAGCTCCTGTCCCGCCTACAGTTCTACCATAAACACTCAGTCCCCGTGTACTTCCCTGCACAGGACCCC

>In-frame_XRCC6_ENST00000405878_chr22_42024234_+_ARSB_ENST00000396151_chr5_78265015_-_1125nt
ATGTCAGGGTGGGAGTCATATTACAAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTAT
AAATATTCAGGAAGAGATAGTTTGATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTT
GACATGAGCATCCAGATCCGTACAGGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTG
CCCCAGCTCCTAAAAGAAGCAGGTTATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGC
CGAGGATTTGATACCTACTTTGGATATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTC
ACACGATGTGCTCTTGATTTTCGAGATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCT
ATAGCCCTCATAACTAACCATCCACCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAG
GAATACTTGAAGCCATATGACTTTATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAAT
GTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGT
AATAACTGGCCCCTTCGAGGAAGAAAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAG
AAGGGCGTGAAGAACCGGGAGCTCATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAG
CCTCTGGATGGCTTCGACGTGTGGAAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTC

>In-frame_XRCC6_ENST00000405878_chr22_42024234_+_ARSB_ENST00000565165_chr5_78265015_-_1125nt
ATGTCAGGGTGGGAGTCATATTACAAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTAT
AAATATTCAGGAAGAGATAGTTTGATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTT
GACATGAGCATCCAGATCCGTACAGGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTG
CCCCAGCTCCTAAAAGAAGCAGGTTATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGC
CGAGGATTTGATACCTACTTTGGATATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTC
ACACGATGTGCTCTTGATTTTCGAGATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCT
ATAGCCCTCATAACTAACCATCCACCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAG
GAATACTTGAAGCCATATGACTTTATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAAT
GTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGT
AATAACTGGCCCCTTCGAGGAAGAAAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAG
AAGGGCGTGAAGAACCGGGAGCTCATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAG
CCTCTGGATGGCTTCGACGTGTGGAAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_XRCC6_ENST00000360079_chr22_42024234_+_ARSB_ENST00000264914_chr5_78265015_-_4915nt
GTAGGAAGGGGCGGGGCTTTGCCGAAGGGGGCGGGGCTCTCGCTGATGGGTTGGCTTTCGTCAGGGACATAGGTAGAAGCTGGTTGGGGA
GTGTGCGTGCCAGCCTGACGCGATATAGTGCGCACATGCGTGATGACGTAGAGGGCGTTGATTGGGACCGAGTACAGGGCCCGCGCATGC
GTGGATTGTCGTCTTCTGTCCAAGTTGGTCGCTTCCCTGCGCCAAAGTGAGCAGTAGCCAACATGTCAGGGTGGGAGTCATATTACAAAA
CCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTATAAATATTCAGGAAGAGATAGTTTGATTT
TTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTTGACATGAGCATCCAGATCCGTACAGGTT
TACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTGCCCCAGCTCCTAAAAGAAGCAGGTTATA
CTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGCCGAGGATTTGATACCTACTTTGGATATC
TCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTCACACGATGTGCTCTTGATTTTCGAGATG
GCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCTATAGCCCTCATAACTAACCATCCACCAG
AGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAGGAATACTTGAAGCCATATGACTTTATCC
AAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAATGTCACTGCAGCTTTAAAAAGCAGTGGGC
TCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGTAATAACTGGCCCCTTCGAGGAAGAAAAT
GGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAGAAGGGCGTGAAGAACCGGGAGCTCATCC
ACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAGCCTCTGGATGGCTTCGACGTGTGGAAAA
CCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTCGTGGACTCTTCACCGTGTCCCAGGAACA
GCATGGCTCCAGCAAAGGATGACTCTTCTCTTCCAGAATATTCAGCCTTTAACACATCTGTCCATGCTGCAATTAGACATGGAAATTGGA
AACTCCTCACGGGCTACCCAGGCTGTGGTTACTGGTTCCCTCCACCGTCTCAATACAATGTTTCTGAGATACCCTCATCAGACCCACCAA
CCAAGACCCTCTGGCTCTTTGATATTGATCGGGACCCTGAAGAAAGACATGACCTGTCCAGAGAATATCCTCACATCGTCACAAAGCTCC
TGTCCCGCCTACAGTTCTACCATAAACACTCAGTCCCCGTGTACTTCCCTGCACAGGACCCCCGCTGTGATCCCAAGGCCACTGGGGTGT
GGGGCCCTTGGATGTAGGATTTCAGGGAGGCTAGAAAACCTTTCAATTGGAAGTTGGACCTCAGGCCTTTTCTCACGACTCTTGTCTCAT
TTGTTATCCCAACCTGGGTTCACTTGGCCCTTCTCTTGCTCTTAAACCACACCGAGGTGTCTAATTTCAACCCCTAATGCATTTAAGAAG
CTGATAAAATCTGCAACACTCCTGCTGTTGGCTGGAGCATGTGTCTAGAGGTGGGGGTGGCTGGGTTTATCCCCCTTTCCTAAGCCTTGG
GACAGCTGGGAACTTAACTTGAAATAGGAAGTTCTCACTGAATCCTGGAGGCTGGAACAGCTGGCTCTTTTAGACTCACAAGTCAGACGT
TCGATTCCCCTCTGCCAATAGCCAGTTTTATTGGAGTGAATCACATTTCTTACGCAAATGAAGGGAGCAGACAGTGATTAATGGTTCTGT
TGGCCAAGGCTTCTCCCTGTCGGTGAAGGATCATGTTCAGGCACTCCAAGTGAACCACCCCTCTTGGTTCACCCCTTACTCACTTATCTC
ATCACAGAGCATAAGGCCCATTTTGTTGTTCAGGTCAACAGCAAAATGCCTGCACCATGACTGTGGCTTTTAAAATAAAGAAATGTGTTT
TTATCGTAATTTATTTCCCCCCAGCCATTGCTCACTCTGTCTAGACTTCCTGCCACTTCCAATTCTTCTGTGGCTTTTCCTGCCTTTCCT
TTTGACCTCAGTAGTCCTATCCCTGGGAAGGCCACTTTGCTTCTCTACCTGAGCACCCCTGATTTCTGGAACGCTGCTGAGCCCTGCCTT
ACTTTTGCCCCTAGGGCTGAAGCTAGAGGCCTCCCCGTAATAGGCGGTGGAGTTGCTCTGTGAGGATGTTCATGGTAGACACTAAGAGGG
CTGGGTGGGAGATGCTTGGCTCTGTGGCATCTGTTCAGCGAGGCTTTTCCTATATTGCATGGAGTTAGTCATTGTGATTGTAGCTTTATT
TCATAATATATTAAGACTTGCACTGCTATTTACTAGCAGTGAGAAGAAACCTCAGGAAAGGATATGAAAAAGCAAGTGGCCAGTGTCTGG
GATACTGGGCCTTGGTAAAGCAGAGGAGGGCACACCCACAGTCCTCTTATTCTCTGTTTTACTGCTTGTTTTGAGGTTCTGGGGTCTGGC
AAAGAGGATGCAGTTTGACACCTGCAGCCCTTTCTCAATCCCACTAATGTCTTACTAATGTGGAACAGTCCATATTAGCTCCAGAGAGTG
TCAAACCCAGAGAAATGTGTGCAAAAATGATACTCTTTTCTGCATTAGCCCCACCATTGTGTTCACCAATGCTTGGAACACTGCCTGAAG
GCACTCATTTTTTAATTTTTATTTTATTTTTAATTTTTTATATCTTTATGAGACGATCTCACTCTGTCACCAGGTTGGAGTACAGTGGTA
CAATCACAACTCACCGTAGCCTCAAACTCCTGGGCTCAAGTGATTCTCCCACCTCAGGCACCCAAATAGCTGGAACTACAGGCATATACC
GCCACACCCAGCTAATTTTATTTTTTGAAAAGACAAGGTTCCCTATGTTGCCCAGCTGGTCTTAAACTCCTGGGCTCCAGCAATTATCCC
AGCTTGGGCTCCAAAAGTGCTGGGATTACAGGCATGAGTCACCATGCCTGGCCTCATTTTTTAAAACAAATGAATAAATGGACAAATGAG
TAAATGAGAAAGTCTCACACCATGAAAGATGCTAGTCCAATGAGCTGAATACAGAGGTAATATAAATGTCTTCCAGCTGTTGCTTTTCTG
TTCTCAAGCTGCCCCTCCTGGGGTAGGAGCATAATCTACATCACTGGGCAGTCACAGGACACTCTATAGCAAGGTTGTAGCGTCCTCTCC
AGTGGGGGGAGAAAAGGAACTGTGCCTACCAAAGGTACTCTCTTGTCAGCAATTTCCATTTCTATACTTTATGGGACACTAGAAACTAAA
AGCAACAAATAATCTGATATAAGTCCTTGTATAGTCATCCTTCAATTCAGTAGCAATATTTTCTGGTCACTACTAACCTGTATTGTATTA
AAATGAGACTATTGGAAGGAAATGGTGCTAAAACTAATAACATCTCTTACCAACCTTTACCCAACTCCTGGGTTGGCAAACAGCTGACCA
AACTGCCATCACCTCCCACTTGGAAGTGTATGGCCGACAGCATGAAATAGCTGAGCCCAGATGTTCCTTCTGCATCCTCCGAATCCCAGG
GCTGGGTGTAGGTAGCCGTTGGAGGCCATCGCTACAGGGCACCTATCTGTTATCGCTGCTGTCCTCCCAACAGCTGTCTCCAGTTCTAGT
TCCTTGGTTTTCAGGCACAGTGGGGGATGTTCTGCACCCAGTGGACTTCAAAAGAGTTTTGAAGACTTAATTTTTTGTAAAACAAGTACT
TGAGATTTTGGTTTATCCATAATAGAATGTATTTCATTAGATTCTCTGATTCTATATAAGAATGTGAAAAGATTGATATATTGTTGTTAG
AAATAATGTTATTTCTTTCCAATTTTTTTTTTTTTTTTTTTTGAGATGGAGTCTCGCTCTGTCACCCAGGCTGGAGTGCAGTGGTGTGAT
CTCGGCTCACTGCAGCCTCTAACTCCCAGGTTCAAGCTATTCTCCTGCCTCAGCCTCCCAAGTAGCTGGATTACAGGCATACACCACCAC
GCCTGGCTATGTTTTGTATTTTTCGTAGAGATAGGGTTTCACCATGTTGGCCAGGCTGGTCTCAAACTCCTGACCTCAAGTGATCCACCC
ACTTCAGCTTCCCAAAGCACTGGGATTACAGGTGTGAGCCACTGTGCCCGGCAAATTTTTTTACCTTTACAGAAGGTTTTGCTTATTTAA
TTGTGAGCTCATTTTTCTTTGTTACTTTTGTCCCCCCAGATTTGGGGGACAAAATAAAATTAATCTTTTAAAATGTGTCAGCCATATGTA
TGGGGCTTCCATTTGGGGTGAGGAGAAAGTTCTGGAACTAGATAGTGGTCATGGTTATACAACATCATAAATGCAATTACTGCCACTGAA
TTGTATGTTTTAAAGTGGTTAAAATGTTAAGTTTTATGTTTTATTACAATTTTTAAATGTGTCAACCAACTTTATAGTACATAAATTATA

>In-frame_XRCC6_ENST00000360079_chr22_42024234_+_ARSB_ENST00000396151_chr5_78265015_-_1942nt
GTAGGAAGGGGCGGGGCTTTGCCGAAGGGGGCGGGGCTCTCGCTGATGGGTTGGCTTTCGTCAGGGACATAGGTAGAAGCTGGTTGGGGA
GTGTGCGTGCCAGCCTGACGCGATATAGTGCGCACATGCGTGATGACGTAGAGGGCGTTGATTGGGACCGAGTACAGGGCCCGCGCATGC
GTGGATTGTCGTCTTCTGTCCAAGTTGGTCGCTTCCCTGCGCCAAAGTGAGCAGTAGCCAACATGTCAGGGTGGGAGTCATATTACAAAA
CCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTATAAATATTCAGGAAGAGATAGTTTGATTT
TTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTTGACATGAGCATCCAGATCCGTACAGGTT
TACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTGCCCCAGCTCCTAAAAGAAGCAGGTTATA
CTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGCCGAGGATTTGATACCTACTTTGGATATC
TCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTCACACGATGTGCTCTTGATTTTCGAGATG
GCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCTATAGCCCTCATAACTAACCATCCACCAG
AGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAGGAATACTTGAAGCCATATGACTTTATCC
AAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAATGTCACTGCAGCTTTAAAAAGCAGTGGGC
TCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGTAATAACTGGCCCCTTCGAGGAAGAAAAT
GGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAGAAGGGCGTGAAGAACCGGGAGCTCATCC
ACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAGCCTCTGGATGGCTTCGACGTGTGGAAAA
CCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTCGTGGACTCTTCACCGTACTGGCCTGAGT
GCTCGCTGCTGTTGTAGCTACCACCAACTTTCTACTGAAGATGATAACCCAGGGCATAAGAAATGACTTCAGACCCAAGGTTCTGAAAGG
GCCCCTCAAGGCCTCGGGTGGCTCCTGCAGAAGTGGCAGAAGAGGCGGGAACTAGGAACCTGGCATCATAGGAAAAGTGCCTTCTCCAAG
AAAGAAGGGGCCCCAGGAGGCTGTCTTACTTAGATCAACCATAAACTACCACAGATGGGTCATTTCTTATATTATTTCAAAATATCTTTG
AAGATGAGAATTCATTTGTGTCCTTCATAGACCAAAGTTCTTTGTGTTACCTTTTCCCAAAAGTAAATTCCTTTCCCTTTATTCATTCCT
TGTGGAAATAAAATGCAAGCCCTTTATACTTGTCTTACAGTAATATGGCACATGTAGCTTACTTTTGAGCATCCCAGTGAATAATGTTTG
GAACTTTTCTTATTACCTAATAGCATATAGAGAAGAGTGAAGTCAGCTAAAAACAGAAATTTTGAAAAGCCATCTTCAGGAAAATGTAGG

>In-frame_XRCC6_ENST00000360079_chr22_42024234_+_ARSB_ENST00000565165_chr5_78265015_-_1398nt
GTAGGAAGGGGCGGGGCTTTGCCGAAGGGGGCGGGGCTCTCGCTGATGGGTTGGCTTTCGTCAGGGACATAGGTAGAAGCTGGTTGGGGA
GTGTGCGTGCCAGCCTGACGCGATATAGTGCGCACATGCGTGATGACGTAGAGGGCGTTGATTGGGACCGAGTACAGGGCCCGCGCATGC
GTGGATTGTCGTCTTCTGTCCAAGTTGGTCGCTTCCCTGCGCCAAAGTGAGCAGTAGCCAACATGTCAGGGTGGGAGTCATATTACAAAA
CCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTATAAATATTCAGGAAGAGATAGTTTGATTT
TTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTTGACATGAGCATCCAGATCCGTACAGGTT
TACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTGCCCCAGCTCCTAAAAGAAGCAGGTTATA
CTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGCCGAGGATTTGATACCTACTTTGGATATC
TCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTCACACGATGTGCTCTTGATTTTCGAGATG
GCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCTATAGCCCTCATAACTAACCATCCACCAG
AGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAGGAATACTTGAAGCCATATGACTTTATCC
AAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAATGTCACTGCAGCTTTAAAAAGCAGTGGGC
TCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGTAATAACTGGCCCCTTCGAGGAAGAAAAT
GGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAGAAGGGCGTGAAGAACCGGGAGCTCATCC
ACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAGCCTCTGGATGGCTTCGACGTGTGGAAAA
CCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTCGTGGACTCTTCACCGTACTGGCCTGAGT

>In-frame_XRCC6_ENST00000402580_chr22_42024234_+_ARSB_ENST00000264914_chr5_78265015_-_4739nt
ATGCGTGGATTGTCGTCTTCTGTCCAAGTTGGTCGCTTCCCTGCGCCAAAGTGAGCAGTAGCCAACATGTCAGGGTGGGAGTCATATTAC
AAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTATAAATATTCAGGAAGAGATAGTTTG
ATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTTGACATGAGCATCCAGATCCGTACA
GGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTGCCCCAGCTCCTAAAAGAAGCAGGT
TATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGCCGAGGATTTGATACCTACTTTGGA
TATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTCACACGATGTGCTCTTGATTTTCGA
GATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCTATAGCCCTCATAACTAACCATCCA
CCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAGGAATACTTGAAGCCATATGACTTT
ATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAATGTCACTGCAGCTTTAAAAAGCAGT
GGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGTAATAACTGGCCCCTTCGAGGAAGA
AAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAGAAGGGCGTGAAGAACCGGGAGCTC
ATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAGCCTCTGGATGGCTTCGACGTGTGG
AAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTCGTGGACTCTTCACCGTGTCCCAGG
AACAGCATGGCTCCAGCAAAGGATGACTCTTCTCTTCCAGAATATTCAGCCTTTAACACATCTGTCCATGCTGCAATTAGACATGGAAAT
TGGAAACTCCTCACGGGCTACCCAGGCTGTGGTTACTGGTTCCCTCCACCGTCTCAATACAATGTTTCTGAGATACCCTCATCAGACCCA
CCAACCAAGACCCTCTGGCTCTTTGATATTGATCGGGACCCTGAAGAAAGACATGACCTGTCCAGAGAATATCCTCACATCGTCACAAAG
CTCCTGTCCCGCCTACAGTTCTACCATAAACACTCAGTCCCCGTGTACTTCCCTGCACAGGACCCCCGCTGTGATCCCAAGGCCACTGGG
GTGTGGGGCCCTTGGATGTAGGATTTCAGGGAGGCTAGAAAACCTTTCAATTGGAAGTTGGACCTCAGGCCTTTTCTCACGACTCTTGTC
TCATTTGTTATCCCAACCTGGGTTCACTTGGCCCTTCTCTTGCTCTTAAACCACACCGAGGTGTCTAATTTCAACCCCTAATGCATTTAA
GAAGCTGATAAAATCTGCAACACTCCTGCTGTTGGCTGGAGCATGTGTCTAGAGGTGGGGGTGGCTGGGTTTATCCCCCTTTCCTAAGCC
TTGGGACAGCTGGGAACTTAACTTGAAATAGGAAGTTCTCACTGAATCCTGGAGGCTGGAACAGCTGGCTCTTTTAGACTCACAAGTCAG
ACGTTCGATTCCCCTCTGCCAATAGCCAGTTTTATTGGAGTGAATCACATTTCTTACGCAAATGAAGGGAGCAGACAGTGATTAATGGTT
CTGTTGGCCAAGGCTTCTCCCTGTCGGTGAAGGATCATGTTCAGGCACTCCAAGTGAACCACCCCTCTTGGTTCACCCCTTACTCACTTA
TCTCATCACAGAGCATAAGGCCCATTTTGTTGTTCAGGTCAACAGCAAAATGCCTGCACCATGACTGTGGCTTTTAAAATAAAGAAATGT
GTTTTTATCGTAATTTATTTCCCCCCAGCCATTGCTCACTCTGTCTAGACTTCCTGCCACTTCCAATTCTTCTGTGGCTTTTCCTGCCTT
TCCTTTTGACCTCAGTAGTCCTATCCCTGGGAAGGCCACTTTGCTTCTCTACCTGAGCACCCCTGATTTCTGGAACGCTGCTGAGCCCTG
CCTTACTTTTGCCCCTAGGGCTGAAGCTAGAGGCCTCCCCGTAATAGGCGGTGGAGTTGCTCTGTGAGGATGTTCATGGTAGACACTAAG
AGGGCTGGGTGGGAGATGCTTGGCTCTGTGGCATCTGTTCAGCGAGGCTTTTCCTATATTGCATGGAGTTAGTCATTGTGATTGTAGCTT
TATTTCATAATATATTAAGACTTGCACTGCTATTTACTAGCAGTGAGAAGAAACCTCAGGAAAGGATATGAAAAAGCAAGTGGCCAGTGT
CTGGGATACTGGGCCTTGGTAAAGCAGAGGAGGGCACACCCACAGTCCTCTTATTCTCTGTTTTACTGCTTGTTTTGAGGTTCTGGGGTC
TGGCAAAGAGGATGCAGTTTGACACCTGCAGCCCTTTCTCAATCCCACTAATGTCTTACTAATGTGGAACAGTCCATATTAGCTCCAGAG
AGTGTCAAACCCAGAGAAATGTGTGCAAAAATGATACTCTTTTCTGCATTAGCCCCACCATTGTGTTCACCAATGCTTGGAACACTGCCT
GAAGGCACTCATTTTTTAATTTTTATTTTATTTTTAATTTTTTATATCTTTATGAGACGATCTCACTCTGTCACCAGGTTGGAGTACAGT
GGTACAATCACAACTCACCGTAGCCTCAAACTCCTGGGCTCAAGTGATTCTCCCACCTCAGGCACCCAAATAGCTGGAACTACAGGCATA
TACCGCCACACCCAGCTAATTTTATTTTTTGAAAAGACAAGGTTCCCTATGTTGCCCAGCTGGTCTTAAACTCCTGGGCTCCAGCAATTA
TCCCAGCTTGGGCTCCAAAAGTGCTGGGATTACAGGCATGAGTCACCATGCCTGGCCTCATTTTTTAAAACAAATGAATAAATGGACAAA
TGAGTAAATGAGAAAGTCTCACACCATGAAAGATGCTAGTCCAATGAGCTGAATACAGAGGTAATATAAATGTCTTCCAGCTGTTGCTTT
TCTGTTCTCAAGCTGCCCCTCCTGGGGTAGGAGCATAATCTACATCACTGGGCAGTCACAGGACACTCTATAGCAAGGTTGTAGCGTCCT
CTCCAGTGGGGGGAGAAAAGGAACTGTGCCTACCAAAGGTACTCTCTTGTCAGCAATTTCCATTTCTATACTTTATGGGACACTAGAAAC
TAAAAGCAACAAATAATCTGATATAAGTCCTTGTATAGTCATCCTTCAATTCAGTAGCAATATTTTCTGGTCACTACTAACCTGTATTGT
ATTAAAATGAGACTATTGGAAGGAAATGGTGCTAAAACTAATAACATCTCTTACCAACCTTTACCCAACTCCTGGGTTGGCAAACAGCTG
ACCAAACTGCCATCACCTCCCACTTGGAAGTGTATGGCCGACAGCATGAAATAGCTGAGCCCAGATGTTCCTTCTGCATCCTCCGAATCC
CAGGGCTGGGTGTAGGTAGCCGTTGGAGGCCATCGCTACAGGGCACCTATCTGTTATCGCTGCTGTCCTCCCAACAGCTGTCTCCAGTTC
TAGTTCCTTGGTTTTCAGGCACAGTGGGGGATGTTCTGCACCCAGTGGACTTCAAAAGAGTTTTGAAGACTTAATTTTTTGTAAAACAAG
TACTTGAGATTTTGGTTTATCCATAATAGAATGTATTTCATTAGATTCTCTGATTCTATATAAGAATGTGAAAAGATTGATATATTGTTG
TTAGAAATAATGTTATTTCTTTCCAATTTTTTTTTTTTTTTTTTTTGAGATGGAGTCTCGCTCTGTCACCCAGGCTGGAGTGCAGTGGTG
TGATCTCGGCTCACTGCAGCCTCTAACTCCCAGGTTCAAGCTATTCTCCTGCCTCAGCCTCCCAAGTAGCTGGATTACAGGCATACACCA
CCACGCCTGGCTATGTTTTGTATTTTTCGTAGAGATAGGGTTTCACCATGTTGGCCAGGCTGGTCTCAAACTCCTGACCTCAAGTGATCC
ACCCACTTCAGCTTCCCAAAGCACTGGGATTACAGGTGTGAGCCACTGTGCCCGGCAAATTTTTTTACCTTTACAGAAGGTTTTGCTTAT
TTAATTGTGAGCTCATTTTTCTTTGTTACTTTTGTCCCCCCAGATTTGGGGGACAAAATAAAATTAATCTTTTAAAATGTGTCAGCCATA
TGTATGGGGCTTCCATTTGGGGTGAGGAGAAAGTTCTGGAACTAGATAGTGGTCATGGTTATACAACATCATAAATGCAATTACTGCCAC
TGAATTGTATGTTTTAAAGTGGTTAAAATGTTAAGTTTTATGTTTTATTACAATTTTTAAATGTGTCAACCAACTTTATAGTACATAAAT

>In-frame_XRCC6_ENST00000402580_chr22_42024234_+_ARSB_ENST00000396151_chr5_78265015_-_1766nt
ATGCGTGGATTGTCGTCTTCTGTCCAAGTTGGTCGCTTCCCTGCGCCAAAGTGAGCAGTAGCCAACATGTCAGGGTGGGAGTCATATTAC
AAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTATAAATATTCAGGAAGAGATAGTTTG
ATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTTGACATGAGCATCCAGATCCGTACA
GGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTGCCCCAGCTCCTAAAAGAAGCAGGT
TATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGCCGAGGATTTGATACCTACTTTGGA
TATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTCACACGATGTGCTCTTGATTTTCGA
GATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCTATAGCCCTCATAACTAACCATCCA
CCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAGGAATACTTGAAGCCATATGACTTT
ATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAATGTCACTGCAGCTTTAAAAAGCAGT
GGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGTAATAACTGGCCCCTTCGAGGAAGA
AAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAGAAGGGCGTGAAGAACCGGGAGCTC
ATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAGCCTCTGGATGGCTTCGACGTGTGG
AAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTCGTGGACTCTTCACCGTACTGGCCT
GAGTGCTCGCTGCTGTTGTAGCTACCACCAACTTTCTACTGAAGATGATAACCCAGGGCATAAGAAATGACTTCAGACCCAAGGTTCTGA
AAGGGCCCCTCAAGGCCTCGGGTGGCTCCTGCAGAAGTGGCAGAAGAGGCGGGAACTAGGAACCTGGCATCATAGGAAAAGTGCCTTCTC
CAAGAAAGAAGGGGCCCCAGGAGGCTGTCTTACTTAGATCAACCATAAACTACCACAGATGGGTCATTTCTTATATTATTTCAAAATATC
TTTGAAGATGAGAATTCATTTGTGTCCTTCATAGACCAAAGTTCTTTGTGTTACCTTTTCCCAAAAGTAAATTCCTTTCCCTTTATTCAT
TCCTTGTGGAAATAAAATGCAAGCCCTTTATACTTGTCTTACAGTAATATGGCACATGTAGCTTACTTTTGAGCATCCCAGTGAATAATG
TTTGGAACTTTTCTTATTACCTAATAGCATATAGAGAAGAGTGAAGTCAGCTAAAAACAGAAATTTTGAAAAGCCATCTTCAGGAAAATG

>In-frame_XRCC6_ENST00000402580_chr22_42024234_+_ARSB_ENST00000565165_chr5_78265015_-_1222nt
ATGCGTGGATTGTCGTCTTCTGTCCAAGTTGGTCGCTTCCCTGCGCCAAAGTGAGCAGTAGCCAACATGTCAGGGTGGGAGTCATATTAC
AAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTATAAATATTCAGGAAGAGATAGTTTG
ATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTTGACATGAGCATCCAGATCCGTACA
GGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTGCCCCAGCTCCTAAAAGAAGCAGGT
TATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGCCGAGGATTTGATACCTACTTTGGA
TATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTCACACGATGTGCTCTTGATTTTCGA
GATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCTATAGCCCTCATAACTAACCATCCA
CCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAGGAATACTTGAAGCCATATGACTTT
ATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAATGTCACTGCAGCTTTAAAAAGCAGT
GGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGTAATAACTGGCCCCTTCGAGGAAGA
AAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAGAAGGGCGTGAAGAACCGGGAGCTC
ATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAGCCTCTGGATGGCTTCGACGTGTGG
AAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTCGTGGACTCTTCACCGTACTGGCCT

>In-frame_XRCC6_ENST00000359308_chr22_42024234_+_ARSB_ENST00000264914_chr5_78265015_-_5328nt
GCGGGCCGTTATCCATTTGTGTTGTTCGCCAGCTAGGCCTGGCCTCGTCCCGCTTCGCTCGGTCGGTCTCGCGCGCCCCCATAGCCTTGC
TAGAGGGTTAGCGTTAGCCTTAAGTGTGCGAATCCGAGGAGCAGCGACAGACTCGAGACCACGCTCCTTCCTCGGGAAGGAGGCGGCACC
TCGCGTTTGAGGCCCGCCTGCGTTTGAGGCCCGCCTGCGCTTGCGGCCCGCCTGCGCTTGAGGCCTGTCTGCGTTTGAGATCTCATTGGG
CGTGATTGAGGAATTTGGGGAGGTTTTTGGGCGGTATTGAGGACGAGGGGGTCCGTTAGTCAGCATAGAATCCTGGAGCGGGAATCCCTC
ACCGTCTAAATGGCGTCGGGGGCGGGACCTCCGGGATCTGGCTTCCGCGGGCCGCCGCCGGCCCTGAAACGTGAGGGATAGCTGAGATGA
GGCAGCTACTGGGATGGCCCCCATGCGCATTTACATGCAGTCCGACTGCCGAGCTTTCGAGGCAGCAGGATTTACCGTCCACATTCCTCA
CTACTAACCAAGCTTTTAGAACAGATCTCACAAGAACCTAGAGGTCGGTATTTTTTCGATTTAAATTTGCCTGTTACTGACGTTAACGTC
TTTCGCCTAGTGAGCAGTAGCCAACATGTCAGGGTGGGAGTCATATTACAAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGA
GAACCTTGAAGCAAGTGGAGACTATAAATATTCAGGAAGAGATAGTTTGATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCA
GAGTGAAGATGAGTTGACACCTTTTGACATGAGCATCCAGATCCGTACAGGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTG
TGTTCCTCTGGATGAAAAACTCCTGCCCCAGCTCCTAAAAGAAGCAGGTTATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTA
CCGGAAAGAATGCCTTCCAACCCGCCGAGGATTTGATACCTACTTTGGATATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTG
TACATTAATTGACGCTCTGAATGTCACACGATGTGCTCTTGATTTTCGAGATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTC
AACAAACATATTCACCAAAAGGGCTATAGCCCTCATAACTAACCATCCACCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGT
GCATGAGCCCCTTCAGGTCCCTGAGGAATACTTGAAGCCATATGACTTTATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTC
CCTTATGGATGAAGCAGTAGGAAATGTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAA
CGGAGGGCAGACTTTGGCAGGGGGTAATAACTGGCCCCTTCGAGGAAGAAAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTT
TGTGGCAAGCCCCTTGCTGAAGCAGAAGGGCGTGAAGAACCGGGAGCTCATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGC
CAGGGGACACACCAATGGCACAAAGCCTCTGGATGGCTTCGACGTGTGGAAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCT
GCTGCATAATATTGACCCGAACTTCGTGGACTCTTCACCGTGTCCCAGGAACAGCATGGCTCCAGCAAAGGATGACTCTTCTCTTCCAGA
ATATTCAGCCTTTAACACATCTGTCCATGCTGCAATTAGACATGGAAATTGGAAACTCCTCACGGGCTACCCAGGCTGTGGTTACTGGTT
CCCTCCACCGTCTCAATACAATGTTTCTGAGATACCCTCATCAGACCCACCAACCAAGACCCTCTGGCTCTTTGATATTGATCGGGACCC
TGAAGAAAGACATGACCTGTCCAGAGAATATCCTCACATCGTCACAAAGCTCCTGTCCCGCCTACAGTTCTACCATAAACACTCAGTCCC
CGTGTACTTCCCTGCACAGGACCCCCGCTGTGATCCCAAGGCCACTGGGGTGTGGGGCCCTTGGATGTAGGATTTCAGGGAGGCTAGAAA
ACCTTTCAATTGGAAGTTGGACCTCAGGCCTTTTCTCACGACTCTTGTCTCATTTGTTATCCCAACCTGGGTTCACTTGGCCCTTCTCTT
GCTCTTAAACCACACCGAGGTGTCTAATTTCAACCCCTAATGCATTTAAGAAGCTGATAAAATCTGCAACACTCCTGCTGTTGGCTGGAG
CATGTGTCTAGAGGTGGGGGTGGCTGGGTTTATCCCCCTTTCCTAAGCCTTGGGACAGCTGGGAACTTAACTTGAAATAGGAAGTTCTCA
CTGAATCCTGGAGGCTGGAACAGCTGGCTCTTTTAGACTCACAAGTCAGACGTTCGATTCCCCTCTGCCAATAGCCAGTTTTATTGGAGT
GAATCACATTTCTTACGCAAATGAAGGGAGCAGACAGTGATTAATGGTTCTGTTGGCCAAGGCTTCTCCCTGTCGGTGAAGGATCATGTT
CAGGCACTCCAAGTGAACCACCCCTCTTGGTTCACCCCTTACTCACTTATCTCATCACAGAGCATAAGGCCCATTTTGTTGTTCAGGTCA
ACAGCAAAATGCCTGCACCATGACTGTGGCTTTTAAAATAAAGAAATGTGTTTTTATCGTAATTTATTTCCCCCCAGCCATTGCTCACTC
TGTCTAGACTTCCTGCCACTTCCAATTCTTCTGTGGCTTTTCCTGCCTTTCCTTTTGACCTCAGTAGTCCTATCCCTGGGAAGGCCACTT
TGCTTCTCTACCTGAGCACCCCTGATTTCTGGAACGCTGCTGAGCCCTGCCTTACTTTTGCCCCTAGGGCTGAAGCTAGAGGCCTCCCCG
TAATAGGCGGTGGAGTTGCTCTGTGAGGATGTTCATGGTAGACACTAAGAGGGCTGGGTGGGAGATGCTTGGCTCTGTGGCATCTGTTCA
GCGAGGCTTTTCCTATATTGCATGGAGTTAGTCATTGTGATTGTAGCTTTATTTCATAATATATTAAGACTTGCACTGCTATTTACTAGC
AGTGAGAAGAAACCTCAGGAAAGGATATGAAAAAGCAAGTGGCCAGTGTCTGGGATACTGGGCCTTGGTAAAGCAGAGGAGGGCACACCC
ACAGTCCTCTTATTCTCTGTTTTACTGCTTGTTTTGAGGTTCTGGGGTCTGGCAAAGAGGATGCAGTTTGACACCTGCAGCCCTTTCTCA
ATCCCACTAATGTCTTACTAATGTGGAACAGTCCATATTAGCTCCAGAGAGTGTCAAACCCAGAGAAATGTGTGCAAAAATGATACTCTT
TTCTGCATTAGCCCCACCATTGTGTTCACCAATGCTTGGAACACTGCCTGAAGGCACTCATTTTTTAATTTTTATTTTATTTTTAATTTT
TTATATCTTTATGAGACGATCTCACTCTGTCACCAGGTTGGAGTACAGTGGTACAATCACAACTCACCGTAGCCTCAAACTCCTGGGCTC
AAGTGATTCTCCCACCTCAGGCACCCAAATAGCTGGAACTACAGGCATATACCGCCACACCCAGCTAATTTTATTTTTTGAAAAGACAAG
GTTCCCTATGTTGCCCAGCTGGTCTTAAACTCCTGGGCTCCAGCAATTATCCCAGCTTGGGCTCCAAAAGTGCTGGGATTACAGGCATGA
GTCACCATGCCTGGCCTCATTTTTTAAAACAAATGAATAAATGGACAAATGAGTAAATGAGAAAGTCTCACACCATGAAAGATGCTAGTC
CAATGAGCTGAATACAGAGGTAATATAAATGTCTTCCAGCTGTTGCTTTTCTGTTCTCAAGCTGCCCCTCCTGGGGTAGGAGCATAATCT
ACATCACTGGGCAGTCACAGGACACTCTATAGCAAGGTTGTAGCGTCCTCTCCAGTGGGGGGAGAAAAGGAACTGTGCCTACCAAAGGTA
CTCTCTTGTCAGCAATTTCCATTTCTATACTTTATGGGACACTAGAAACTAAAAGCAACAAATAATCTGATATAAGTCCTTGTATAGTCA
TCCTTCAATTCAGTAGCAATATTTTCTGGTCACTACTAACCTGTATTGTATTAAAATGAGACTATTGGAAGGAAATGGTGCTAAAACTAA
TAACATCTCTTACCAACCTTTACCCAACTCCTGGGTTGGCAAACAGCTGACCAAACTGCCATCACCTCCCACTTGGAAGTGTATGGCCGA
CAGCATGAAATAGCTGAGCCCAGATGTTCCTTCTGCATCCTCCGAATCCCAGGGCTGGGTGTAGGTAGCCGTTGGAGGCCATCGCTACAG
GGCACCTATCTGTTATCGCTGCTGTCCTCCCAACAGCTGTCTCCAGTTCTAGTTCCTTGGTTTTCAGGCACAGTGGGGGATGTTCTGCAC
CCAGTGGACTTCAAAAGAGTTTTGAAGACTTAATTTTTTGTAAAACAAGTACTTGAGATTTTGGTTTATCCATAATAGAATGTATTTCAT
TAGATTCTCTGATTCTATATAAGAATGTGAAAAGATTGATATATTGTTGTTAGAAATAATGTTATTTCTTTCCAATTTTTTTTTTTTTTT
TTTTTGAGATGGAGTCTCGCTCTGTCACCCAGGCTGGAGTGCAGTGGTGTGATCTCGGCTCACTGCAGCCTCTAACTCCCAGGTTCAAGC
TATTCTCCTGCCTCAGCCTCCCAAGTAGCTGGATTACAGGCATACACCACCACGCCTGGCTATGTTTTGTATTTTTCGTAGAGATAGGGT
TTCACCATGTTGGCCAGGCTGGTCTCAAACTCCTGACCTCAAGTGATCCACCCACTTCAGCTTCCCAAAGCACTGGGATTACAGGTGTGA
GCCACTGTGCCCGGCAAATTTTTTTACCTTTACAGAAGGTTTTGCTTATTTAATTGTGAGCTCATTTTTCTTTGTTACTTTTGTCCCCCC
AGATTTGGGGGACAAAATAAAATTAATCTTTTAAAATGTGTCAGCCATATGTATGGGGCTTCCATTTGGGGTGAGGAGAAAGTTCTGGAA
CTAGATAGTGGTCATGGTTATACAACATCATAAATGCAATTACTGCCACTGAATTGTATGTTTTAAAGTGGTTAAAATGTTAAGTTTTAT
GTTTTATTACAATTTTTAAATGTGTCAACCAACTTTATAGTACATAAATTATATCTCAGTAAAGCTGTTAAATAAATAAATATAGTAAAA

>In-frame_XRCC6_ENST00000359308_chr22_42024234_+_ARSB_ENST00000396151_chr5_78265015_-_2355nt
GCGGGCCGTTATCCATTTGTGTTGTTCGCCAGCTAGGCCTGGCCTCGTCCCGCTTCGCTCGGTCGGTCTCGCGCGCCCCCATAGCCTTGC
TAGAGGGTTAGCGTTAGCCTTAAGTGTGCGAATCCGAGGAGCAGCGACAGACTCGAGACCACGCTCCTTCCTCGGGAAGGAGGCGGCACC
TCGCGTTTGAGGCCCGCCTGCGTTTGAGGCCCGCCTGCGCTTGCGGCCCGCCTGCGCTTGAGGCCTGTCTGCGTTTGAGATCTCATTGGG
CGTGATTGAGGAATTTGGGGAGGTTTTTGGGCGGTATTGAGGACGAGGGGGTCCGTTAGTCAGCATAGAATCCTGGAGCGGGAATCCCTC
ACCGTCTAAATGGCGTCGGGGGCGGGACCTCCGGGATCTGGCTTCCGCGGGCCGCCGCCGGCCCTGAAACGTGAGGGATAGCTGAGATGA
GGCAGCTACTGGGATGGCCCCCATGCGCATTTACATGCAGTCCGACTGCCGAGCTTTCGAGGCAGCAGGATTTACCGTCCACATTCCTCA
CTACTAACCAAGCTTTTAGAACAGATCTCACAAGAACCTAGAGGTCGGTATTTTTTCGATTTAAATTTGCCTGTTACTGACGTTAACGTC
TTTCGCCTAGTGAGCAGTAGCCAACATGTCAGGGTGGGAGTCATATTACAAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGA
GAACCTTGAAGCAAGTGGAGACTATAAATATTCAGGAAGAGATAGTTTGATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCA
GAGTGAAGATGAGTTGACACCTTTTGACATGAGCATCCAGATCCGTACAGGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTG
TGTTCCTCTGGATGAAAAACTCCTGCCCCAGCTCCTAAAAGAAGCAGGTTATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTA
CCGGAAAGAATGCCTTCCAACCCGCCGAGGATTTGATACCTACTTTGGATATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTG
TACATTAATTGACGCTCTGAATGTCACACGATGTGCTCTTGATTTTCGAGATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTC
AACAAACATATTCACCAAAAGGGCTATAGCCCTCATAACTAACCATCCACCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGT
GCATGAGCCCCTTCAGGTCCCTGAGGAATACTTGAAGCCATATGACTTTATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTC
CCTTATGGATGAAGCAGTAGGAAATGTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAA
CGGAGGGCAGACTTTGGCAGGGGGTAATAACTGGCCCCTTCGAGGAAGAAAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTT
TGTGGCAAGCCCCTTGCTGAAGCAGAAGGGCGTGAAGAACCGGGAGCTCATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGC
CAGGGGACACACCAATGGCACAAAGCCTCTGGATGGCTTCGACGTGTGGAAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCT
GCTGCATAATATTGACCCGAACTTCGTGGACTCTTCACCGTACTGGCCTGAGTGCTCGCTGCTGTTGTAGCTACCACCAACTTTCTACTG
AAGATGATAACCCAGGGCATAAGAAATGACTTCAGACCCAAGGTTCTGAAAGGGCCCCTCAAGGCCTCGGGTGGCTCCTGCAGAAGTGGC
AGAAGAGGCGGGAACTAGGAACCTGGCATCATAGGAAAAGTGCCTTCTCCAAGAAAGAAGGGGCCCCAGGAGGCTGTCTTACTTAGATCA
ACCATAAACTACCACAGATGGGTCATTTCTTATATTATTTCAAAATATCTTTGAAGATGAGAATTCATTTGTGTCCTTCATAGACCAAAG
TTCTTTGTGTTACCTTTTCCCAAAAGTAAATTCCTTTCCCTTTATTCATTCCTTGTGGAAATAAAATGCAAGCCCTTTATACTTGTCTTA
CAGTAATATGGCACATGTAGCTTACTTTTGAGCATCCCAGTGAATAATGTTTGGAACTTTTCTTATTACCTAATAGCATATAGAGAAGAG
TGAAGTCAGCTAAAAACAGAAATTTTGAAAAGCCATCTTCAGGAAAATGTAGGCCCAGATGCTTTCCTCCACCTTTTTTGACAGGCTGCC

>In-frame_XRCC6_ENST00000359308_chr22_42024234_+_ARSB_ENST00000565165_chr5_78265015_-_1811nt
GCGGGCCGTTATCCATTTGTGTTGTTCGCCAGCTAGGCCTGGCCTCGTCCCGCTTCGCTCGGTCGGTCTCGCGCGCCCCCATAGCCTTGC
TAGAGGGTTAGCGTTAGCCTTAAGTGTGCGAATCCGAGGAGCAGCGACAGACTCGAGACCACGCTCCTTCCTCGGGAAGGAGGCGGCACC
TCGCGTTTGAGGCCCGCCTGCGTTTGAGGCCCGCCTGCGCTTGCGGCCCGCCTGCGCTTGAGGCCTGTCTGCGTTTGAGATCTCATTGGG
CGTGATTGAGGAATTTGGGGAGGTTTTTGGGCGGTATTGAGGACGAGGGGGTCCGTTAGTCAGCATAGAATCCTGGAGCGGGAATCCCTC
ACCGTCTAAATGGCGTCGGGGGCGGGACCTCCGGGATCTGGCTTCCGCGGGCCGCCGCCGGCCCTGAAACGTGAGGGATAGCTGAGATGA
GGCAGCTACTGGGATGGCCCCCATGCGCATTTACATGCAGTCCGACTGCCGAGCTTTCGAGGCAGCAGGATTTACCGTCCACATTCCTCA
CTACTAACCAAGCTTTTAGAACAGATCTCACAAGAACCTAGAGGTCGGTATTTTTTCGATTTAAATTTGCCTGTTACTGACGTTAACGTC
TTTCGCCTAGTGAGCAGTAGCCAACATGTCAGGGTGGGAGTCATATTACAAAACCGAGGGCGATGAAGAAGCAGAGGAAGAACAAGAAGA
GAACCTTGAAGCAAGTGGAGACTATAAATATTCAGGAAGAGATAGTTTGATTTTTTTGGTTGATGCCTCCAAGGCTATGTTTGAATCTCA
GAGTGAAGATGAGTTGACACCTTTTGACATGAGCATCCAGATCCGTACAGGTTTACAGCACCAAATAATCTGGCCCTGTCAGCCCAGCTG
TGTTCCTCTGGATGAAAAACTCCTGCCCCAGCTCCTAAAAGAAGCAGGTTATACTACCCATATGGTCGGAAAATGGCACCTGGGAATGTA
CCGGAAAGAATGCCTTCCAACCCGCCGAGGATTTGATACCTACTTTGGATATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTG
TACATTAATTGACGCTCTGAATGTCACACGATGTGCTCTTGATTTTCGAGATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTATTC
AACAAACATATTCACCAAAAGGGCTATAGCCCTCATAACTAACCATCCACCAGAGAAGCCTCTGTTTCTCTACCTTGCTCTCCAGTCTGT
GCATGAGCCCCTTCAGGTCCCTGAGGAATACTTGAAGCCATATGACTTTATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTC
CCTTATGGATGAAGCAGTAGGAAATGTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAA
CGGAGGGCAGACTTTGGCAGGGGGTAATAACTGGCCCCTTCGAGGAAGAAAATGGAGCCTGTGGGAAGGAGGCGTCCGAGGGGTGGGCTT
TGTGGCAAGCCCCTTGCTGAAGCAGAAGGGCGTGAAGAACCGGGAGCTCATCCACATCTCTGACTGGCTGCCAACACTCGTGAAGCTGGC
CAGGGGACACACCAATGGCACAAAGCCTCTGGATGGCTTCGACGTGTGGAAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCT
GCTGCATAATATTGACCCGAACTTCGTGGACTCTTCACCGTACTGGCCTGAGTGCTCGCTGCTGTTGTAGCTACCACCAACTTTCTACTG

>In-frame_XRCC6_ENST00000405878_chr22_42024234_+_ARSB_ENST00000264914_chr5_78265015_-_4819nt
AAGTGTGCGAATCCGAGGAGCAGCGACAGACTCGAGACCACGCTCCTTCCTCGGGAAGGAGGCGGCACCTCGCGTTTGAGGCCCGCCTGC
GTTTGAGGCCCGCCTGCGCTTGCGGCCCGCCTGCGCTTGAGTGAGCAGTAGCCAACATGTCAGGGTGGGAGTCATATTACAAAACCGAGG
GCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTATAAATATTCAGGAAGAGATAGTTTGATTTTTTTGG
TTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTTGACATGAGCATCCAGATCCGTACAGGTTTACAGC
ACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTGCCCCAGCTCCTAAAAGAAGCAGGTTATACTACCC
ATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGCCGAGGATTTGATACCTACTTTGGATATCTCCTGG
GTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTCACACGATGTGCTCTTGATTTTCGAGATGGCGAAG
AAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCTATAGCCCTCATAACTAACCATCCACCAGAGAAGC
CTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAGGAATACTTGAAGCCATATGACTTTATCCAAGACA
AGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAATGTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGA
ACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGTAATAACTGGCCCCTTCGAGGAAGAAAATGGAGCC
TGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAGAAGGGCGTGAAGAACCGGGAGCTCATCCACATCT
CTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAGCCTCTGGATGGCTTCGACGTGTGGAAAACCATCA
GTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTCGTGGACTCTTCACCGTGTCCCAGGAACAGCATGG
CTCCAGCAAAGGATGACTCTTCTCTTCCAGAATATTCAGCCTTTAACACATCTGTCCATGCTGCAATTAGACATGGAAATTGGAAACTCC
TCACGGGCTACCCAGGCTGTGGTTACTGGTTCCCTCCACCGTCTCAATACAATGTTTCTGAGATACCCTCATCAGACCCACCAACCAAGA
CCCTCTGGCTCTTTGATATTGATCGGGACCCTGAAGAAAGACATGACCTGTCCAGAGAATATCCTCACATCGTCACAAAGCTCCTGTCCC
GCCTACAGTTCTACCATAAACACTCAGTCCCCGTGTACTTCCCTGCACAGGACCCCCGCTGTGATCCCAAGGCCACTGGGGTGTGGGGCC
CTTGGATGTAGGATTTCAGGGAGGCTAGAAAACCTTTCAATTGGAAGTTGGACCTCAGGCCTTTTCTCACGACTCTTGTCTCATTTGTTA
TCCCAACCTGGGTTCACTTGGCCCTTCTCTTGCTCTTAAACCACACCGAGGTGTCTAATTTCAACCCCTAATGCATTTAAGAAGCTGATA
AAATCTGCAACACTCCTGCTGTTGGCTGGAGCATGTGTCTAGAGGTGGGGGTGGCTGGGTTTATCCCCCTTTCCTAAGCCTTGGGACAGC
TGGGAACTTAACTTGAAATAGGAAGTTCTCACTGAATCCTGGAGGCTGGAACAGCTGGCTCTTTTAGACTCACAAGTCAGACGTTCGATT
CCCCTCTGCCAATAGCCAGTTTTATTGGAGTGAATCACATTTCTTACGCAAATGAAGGGAGCAGACAGTGATTAATGGTTCTGTTGGCCA
AGGCTTCTCCCTGTCGGTGAAGGATCATGTTCAGGCACTCCAAGTGAACCACCCCTCTTGGTTCACCCCTTACTCACTTATCTCATCACA
GAGCATAAGGCCCATTTTGTTGTTCAGGTCAACAGCAAAATGCCTGCACCATGACTGTGGCTTTTAAAATAAAGAAATGTGTTTTTATCG
TAATTTATTTCCCCCCAGCCATTGCTCACTCTGTCTAGACTTCCTGCCACTTCCAATTCTTCTGTGGCTTTTCCTGCCTTTCCTTTTGAC
CTCAGTAGTCCTATCCCTGGGAAGGCCACTTTGCTTCTCTACCTGAGCACCCCTGATTTCTGGAACGCTGCTGAGCCCTGCCTTACTTTT
GCCCCTAGGGCTGAAGCTAGAGGCCTCCCCGTAATAGGCGGTGGAGTTGCTCTGTGAGGATGTTCATGGTAGACACTAAGAGGGCTGGGT
GGGAGATGCTTGGCTCTGTGGCATCTGTTCAGCGAGGCTTTTCCTATATTGCATGGAGTTAGTCATTGTGATTGTAGCTTTATTTCATAA
TATATTAAGACTTGCACTGCTATTTACTAGCAGTGAGAAGAAACCTCAGGAAAGGATATGAAAAAGCAAGTGGCCAGTGTCTGGGATACT
GGGCCTTGGTAAAGCAGAGGAGGGCACACCCACAGTCCTCTTATTCTCTGTTTTACTGCTTGTTTTGAGGTTCTGGGGTCTGGCAAAGAG
GATGCAGTTTGACACCTGCAGCCCTTTCTCAATCCCACTAATGTCTTACTAATGTGGAACAGTCCATATTAGCTCCAGAGAGTGTCAAAC
CCAGAGAAATGTGTGCAAAAATGATACTCTTTTCTGCATTAGCCCCACCATTGTGTTCACCAATGCTTGGAACACTGCCTGAAGGCACTC
ATTTTTTAATTTTTATTTTATTTTTAATTTTTTATATCTTTATGAGACGATCTCACTCTGTCACCAGGTTGGAGTACAGTGGTACAATCA
CAACTCACCGTAGCCTCAAACTCCTGGGCTCAAGTGATTCTCCCACCTCAGGCACCCAAATAGCTGGAACTACAGGCATATACCGCCACA
CCCAGCTAATTTTATTTTTTGAAAAGACAAGGTTCCCTATGTTGCCCAGCTGGTCTTAAACTCCTGGGCTCCAGCAATTATCCCAGCTTG
GGCTCCAAAAGTGCTGGGATTACAGGCATGAGTCACCATGCCTGGCCTCATTTTTTAAAACAAATGAATAAATGGACAAATGAGTAAATG
AGAAAGTCTCACACCATGAAAGATGCTAGTCCAATGAGCTGAATACAGAGGTAATATAAATGTCTTCCAGCTGTTGCTTTTCTGTTCTCA
AGCTGCCCCTCCTGGGGTAGGAGCATAATCTACATCACTGGGCAGTCACAGGACACTCTATAGCAAGGTTGTAGCGTCCTCTCCAGTGGG
GGGAGAAAAGGAACTGTGCCTACCAAAGGTACTCTCTTGTCAGCAATTTCCATTTCTATACTTTATGGGACACTAGAAACTAAAAGCAAC
AAATAATCTGATATAAGTCCTTGTATAGTCATCCTTCAATTCAGTAGCAATATTTTCTGGTCACTACTAACCTGTATTGTATTAAAATGA
GACTATTGGAAGGAAATGGTGCTAAAACTAATAACATCTCTTACCAACCTTTACCCAACTCCTGGGTTGGCAAACAGCTGACCAAACTGC
CATCACCTCCCACTTGGAAGTGTATGGCCGACAGCATGAAATAGCTGAGCCCAGATGTTCCTTCTGCATCCTCCGAATCCCAGGGCTGGG
TGTAGGTAGCCGTTGGAGGCCATCGCTACAGGGCACCTATCTGTTATCGCTGCTGTCCTCCCAACAGCTGTCTCCAGTTCTAGTTCCTTG
GTTTTCAGGCACAGTGGGGGATGTTCTGCACCCAGTGGACTTCAAAAGAGTTTTGAAGACTTAATTTTTTGTAAAACAAGTACTTGAGAT
TTTGGTTTATCCATAATAGAATGTATTTCATTAGATTCTCTGATTCTATATAAGAATGTGAAAAGATTGATATATTGTTGTTAGAAATAA
TGTTATTTCTTTCCAATTTTTTTTTTTTTTTTTTTTGAGATGGAGTCTCGCTCTGTCACCCAGGCTGGAGTGCAGTGGTGTGATCTCGGC
TCACTGCAGCCTCTAACTCCCAGGTTCAAGCTATTCTCCTGCCTCAGCCTCCCAAGTAGCTGGATTACAGGCATACACCACCACGCCTGG
CTATGTTTTGTATTTTTCGTAGAGATAGGGTTTCACCATGTTGGCCAGGCTGGTCTCAAACTCCTGACCTCAAGTGATCCACCCACTTCA
GCTTCCCAAAGCACTGGGATTACAGGTGTGAGCCACTGTGCCCGGCAAATTTTTTTACCTTTACAGAAGGTTTTGCTTATTTAATTGTGA
GCTCATTTTTCTTTGTTACTTTTGTCCCCCCAGATTTGGGGGACAAAATAAAATTAATCTTTTAAAATGTGTCAGCCATATGTATGGGGC
TTCCATTTGGGGTGAGGAGAAAGTTCTGGAACTAGATAGTGGTCATGGTTATACAACATCATAAATGCAATTACTGCCACTGAATTGTAT
GTTTTAAAGTGGTTAAAATGTTAAGTTTTATGTTTTATTACAATTTTTAAATGTGTCAACCAACTTTATAGTACATAAATTATATCTCAG

>In-frame_XRCC6_ENST00000405878_chr22_42024234_+_ARSB_ENST00000396151_chr5_78265015_-_1846nt
AAGTGTGCGAATCCGAGGAGCAGCGACAGACTCGAGACCACGCTCCTTCCTCGGGAAGGAGGCGGCACCTCGCGTTTGAGGCCCGCCTGC
GTTTGAGGCCCGCCTGCGCTTGCGGCCCGCCTGCGCTTGAGTGAGCAGTAGCCAACATGTCAGGGTGGGAGTCATATTACAAAACCGAGG
GCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTATAAATATTCAGGAAGAGATAGTTTGATTTTTTTGG
TTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTTGACATGAGCATCCAGATCCGTACAGGTTTACAGC
ACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTGCCCCAGCTCCTAAAAGAAGCAGGTTATACTACCC
ATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGCCGAGGATTTGATACCTACTTTGGATATCTCCTGG
GTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTCACACGATGTGCTCTTGATTTTCGAGATGGCGAAG
AAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCTATAGCCCTCATAACTAACCATCCACCAGAGAAGC
CTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAGGAATACTTGAAGCCATATGACTTTATCCAAGACA
AGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAATGTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGA
ACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGTAATAACTGGCCCCTTCGAGGAAGAAAATGGAGCC
TGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAGAAGGGCGTGAAGAACCGGGAGCTCATCCACATCT
CTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAGCCTCTGGATGGCTTCGACGTGTGGAAAACCATCA
GTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTCGTGGACTCTTCACCGTACTGGCCTGAGTGCTCGC
TGCTGTTGTAGCTACCACCAACTTTCTACTGAAGATGATAACCCAGGGCATAAGAAATGACTTCAGACCCAAGGTTCTGAAAGGGCCCCT
CAAGGCCTCGGGTGGCTCCTGCAGAAGTGGCAGAAGAGGCGGGAACTAGGAACCTGGCATCATAGGAAAAGTGCCTTCTCCAAGAAAGAA
GGGGCCCCAGGAGGCTGTCTTACTTAGATCAACCATAAACTACCACAGATGGGTCATTTCTTATATTATTTCAAAATATCTTTGAAGATG
AGAATTCATTTGTGTCCTTCATAGACCAAAGTTCTTTGTGTTACCTTTTCCCAAAAGTAAATTCCTTTCCCTTTATTCATTCCTTGTGGA
AATAAAATGCAAGCCCTTTATACTTGTCTTACAGTAATATGGCACATGTAGCTTACTTTTGAGCATCCCAGTGAATAATGTTTGGAACTT
TTCTTATTACCTAATAGCATATAGAGAAGAGTGAAGTCAGCTAAAAACAGAAATTTTGAAAAGCCATCTTCAGGAAAATGTAGGCCCAGA

>In-frame_XRCC6_ENST00000405878_chr22_42024234_+_ARSB_ENST00000565165_chr5_78265015_-_1302nt
AAGTGTGCGAATCCGAGGAGCAGCGACAGACTCGAGACCACGCTCCTTCCTCGGGAAGGAGGCGGCACCTCGCGTTTGAGGCCCGCCTGC
GTTTGAGGCCCGCCTGCGCTTGCGGCCCGCCTGCGCTTGAGTGAGCAGTAGCCAACATGTCAGGGTGGGAGTCATATTACAAAACCGAGG
GCGATGAAGAAGCAGAGGAAGAACAAGAAGAGAACCTTGAAGCAAGTGGAGACTATAAATATTCAGGAAGAGATAGTTTGATTTTTTTGG
TTGATGCCTCCAAGGCTATGTTTGAATCTCAGAGTGAAGATGAGTTGACACCTTTTGACATGAGCATCCAGATCCGTACAGGTTTACAGC
ACCAAATAATCTGGCCCTGTCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTGCCCCAGCTCCTAAAAGAAGCAGGTTATACTACCC
ATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGCCGAGGATTTGATACCTACTTTGGATATCTCCTGG
GTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCTGAATGTCACACGATGTGCTCTTGATTTTCGAGATGGCGAAG
AAGTTGCAACAGGATATAAAAATATGTATTCAACAAACATATTCACCAAAAGGGCTATAGCCCTCATAACTAACCATCCACCAGAGAAGC
CTCTGTTTCTCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAGGAATACTTGAAGCCATATGACTTTATCCAAGACA
AGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAATGTCACTGCAGCTTTAAAAAGCAGTGGGCTCTGGA
ACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGCAGACTTTGGCAGGGGGTAATAACTGGCCCCTTCGAGGAAGAAAATGGAGCC
TGTGGGAAGGAGGCGTCCGAGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAGAAGGGCGTGAAGAACCGGGAGCTCATCCACATCT
CTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAGCCTCTGGATGGCTTCGACGTGTGGAAAACCATCA
GTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCCGAACTTCGTGGACTCTTCACCGTACTGGCCTGAGTGCTCGC


Top

FusionGenePPI for XRCC6_ARSB


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
XRCC6VAV1, NCF4, XRCC5, MRE11A, CBX5, AR, CCNA1, CDK2, TERF2IP, CHEK1, NCOA6, KAT2A, CREBBP, ACD, CDCA5, ARAP1, FMNL1, GAL3ST4, ILVBL, NOTCH1, PGAM1, RBBP4, TBCD, ABCD4, PLGRKT, GSE1, NHP2L1, NIT1, PECAM1, RRAS2, SNTA1, ATP6V1E1, PAEP, PAFAH1B3, RPLP1, SERPINB9, YWHAZ, XRCC6BP1, CLU, PRKDC, RPA2, TERT, DNTT, HOXC4, HOXD4, DLX2, POU2F2, POU2F1, TAL1, TERF2, WRN, BIN1, PTTG1, CD40, PCNA, HSF1, ABL1, DHX9, FCHSD1, SIRT6, NR1H4, CHD1L, TP53, BARD1, ESR1, PARP1, SIRT3, MGMT, PDX1, SRRM2, MSX2, RUNX2, NAA15, H2AFX, PHF1, XRCC4, LIG4, KAT2B, EP300, ATXN3, ILF2, THRA, THRB, BIRC5, CHAF1A, HIST1H3A, HIST1H3E, H3F3A, BAZ1A, MYC, USF1, HDAC5, UBE3A, RBM39, MDM2, BAX, DDB2, PSMA3, CMTM6, RPS10, RASA1, EFNA1, TAC1, PDK1, CENPU, KIAA0408, EID1, VBP1, SDHC, PDPK1, ANXA1, BTG1, PNRC2, QRSL1, RGS2, MAP4K2, HERPUD1, SEP15, SPARC, COIL, LIG3, HOXB7, YY1, RNF146, SMARCAD1, ORC3, ORC2, ORC6, ORC4, TCF7L2, NDRG1, HDGF, ILF3, MSH6, MSH2, CBX1, CBX3, CEBPA, ARRB2, SIRT7, HNRNPA1, CFLAR, HDAC6, ERG, ISG15, TONSL, CUL5, COPS5, CAND1, HTT, CLTC, TADA3, CCT3, KCND3, ARHGAP5, EEF2, SDHA, HSPA5, KIF23, PGR, XRCC6, BRCA1, ECT2, PAXIP1, TP53BP1, NCL, CSNK2A1, SMURF1, PNKP, FN1, VCAM1, GZMA, GZMB, SMAD7, SKIL, SMAD3, ZNF512B, ITGA4, PPID, IGSF8, ICAM1, HMGA1, HMGA2, LMNA, CTBP2, COPB1, ADCY7, EPS8, MAP2K5, CAPN11, SERPINA2, TARDBP, PARK2, PRPF40A, WBP4, PIN1, CTNNA1, CUL2, CSDE1, FARSB, GANAB, GART, IMPDH1, JUP, DPYSL3, PLOD2, RANBP3, SAMHD1, SET, ST13, SUPT5H, SWAP70, ATP6V1B2, HYOU1, RPSA, NARS, RPA1, RPA3, ATRX, EMD, ELF3, EHF, ENO1, SHMT2, MOV10, NXF1, PPARG, CUL7, OBSL1, CCDC8, EED, SUMO2, MAST3, WDR76, APLF, PHRF1, NTRK1, DYNC1LI1, GTF2I, HNRNPK, NAE1, PDIA3, RFC1, TKT, TMOD3, SCARNA22, CSNK1A1, DNM2, BAG2, ANKRD28, POT1, TINF2, TNRC18, CCDC57, C9orf142, BANP, CRY2, MACROD1, MCM2, NF2, SNW1, TFAP2A, UHRF2, U2AF2, RC3H1, FOXL2, NFATC1, NFATC2, AHSA1, RNF126, PARP2, XPC, SUPT16H, XRCC1, H2AFY, CDK5RAP1, SSRP1, SPTA1, COX15, DLD, DLST, DNM1L, HSD17B10, SOD1, VDAC1, TRIM25, UBE2S, YAP1ARSBELAVL1, ESR1, SUSD4, PLAUR, PTPRK, SIAE, NAAA, ERP29, DEFA1, INSL5, AVP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneXRCC6chr22:42024234chr5:78265015ENST00000359308+212550_60965610DEAF1
HgeneXRCC6chr22:42024234chr5:78265015ENST00000360079+313550_60965610DEAF1
HgeneXRCC6chr22:42024234chr5:78265015ENST00000405878+313550_60965610DEAF1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for XRCC6_ARSB


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for XRCC6_ARSB


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneARSBC0026709Mucopolysaccharidosis VI11CTD_human;UNIPROT