FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42214

FusionGeneSummary for XPR1_RFWD2

check button Fusion gene summary
Fusion gene informationFusion gene name: XPR1_RFWD2
Fusion gene ID: 42214
HgeneTgene
Gene symbol

XPR1

RFWD2

Gene ID

9213

Gene namexenotropic and polytropic retrovirus receptor 1
SynonymsIBGC6|SLC53A1|SYG1|X3
Cytomap

1q25.3

Type of geneprotein-coding
Descriptionxenotropic and polytropic retrovirus receptor 1X-receptorprotein SYG1 homologsolute carrier family 53 (phosphate exporter), member 1xenotropic and polytropic murine leukemia virus receptor X3
Modification date20180523
UniProtAcc

Q9UBH6

Ensembl transtripts involved in fusion geneENST00000367590, ENST00000367589, 
ENST00000467345, 
ENST00000367669, 
ENST00000308769, 
Fusion gene scores* DoF score14 X 4 X 10=56016 X 10 X 8=1280
# samples 1415
** MAII scorelog2(14/560*10)=-2
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/1280*10)=-3.09310940439148
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: XPR1 [Title/Abstract] AND RFWD2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-A8-A07W-01AXPR1chr1

180843078

+RFWD2chr1

176153828

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000367590ENST00000367669XPR1chr1

180843078

+RFWD2chr1

176153828

-
In-frameENST00000367590ENST00000308769XPR1chr1

180843078

+RFWD2chr1

176153828

-
In-frameENST00000367589ENST00000367669XPR1chr1

180843078

+RFWD2chr1

176153828

-
In-frameENST00000367589ENST00000308769XPR1chr1

180843078

+RFWD2chr1

176153828

-
intron-3CDSENST00000467345ENST00000367669XPR1chr1

180843078

+RFWD2chr1

176153828

-
intron-3CDSENST00000467345ENST00000308769XPR1chr1

180843078

+RFWD2chr1

176153828

-

Top

FusionProtFeatures for XPR1_RFWD2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
XPR1

Q9UBH6

RFWD2

Plays a role in phosphate homeostasis. Mediatesphosphate export from the cell (PubMed:23791524, PubMed:25938945).Binds inositol hexakisphosphate (Ins6P) and similar inositolpolyphosphates, such as 5-diphospho-inositol pentakisphosphate (5-InsP7); these are important intracellular signaling molecules(PubMed:27080106). {ECO:0000250|UniProtKB:Q9Z0U0,ECO:0000269|PubMed:23791524, ECO:0000269|PubMed:25938945,ECO:0000269|PubMed:27080106}. Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+12141_177537632DomainSPX
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+13151_177602697DomainSPX
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214158_165537632RegionImportant for inositol polyphosphate binding
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315158_165602697RegionImportant for inositol polyphosphate binding
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+12141_236537632Topological domainCytoplasmic
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214258_264537632Topological domainExtracellular
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214286_318537632Topological domainCytoplasmic
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214340_345537632Topological domainExtracellular
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214369_376537632Topological domainCytoplasmic
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214398_402537632Topological domainExtracellular
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214424_473537632Topological domainCytoplasmic
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214497_507537632Topological domainExtracellular
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+13151_236602697Topological domainCytoplasmic
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315258_264602697Topological domainExtracellular
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315286_318602697Topological domainCytoplasmic
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315340_345602697Topological domainExtracellular
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315369_376602697Topological domainCytoplasmic
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315398_402602697Topological domainExtracellular
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315424_473602697Topological domainCytoplasmic
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315497_507602697Topological domainExtracellular
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214237_257537632TransmembraneHelical
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214265_285537632TransmembraneHelical
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214319_339537632TransmembraneHelical
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214346_368537632TransmembraneHelical
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214377_397537632TransmembraneHelical
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214403_423537632TransmembraneHelical
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214474_496537632TransmembraneHelical
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214508_528537632TransmembraneHelical
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315237_257602697TransmembraneHelical
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315265_285602697TransmembraneHelical
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315319_339602697TransmembraneHelical
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315346_368602697TransmembraneHelical
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315377_397602697TransmembraneHelical
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315403_423602697TransmembraneHelical
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315474_496602697TransmembraneHelical
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315508_528602697TransmembraneHelical
TgeneRFWD2chr1:180843078chr1:176153828ENST00000308769-019233_301135708Coiled coilOntology_term=ECO:0000255
TgeneRFWD2chr1:180843078chr1:176153828ENST00000367669-020233_301135732Coiled coilOntology_term=ECO:0000255
TgeneRFWD2chr1:180843078chr1:176153828ENST00000308769-019195_206135708MotifNote=Nuclear localization signal 2
TgeneRFWD2chr1:180843078chr1:176153828ENST00000308769-019235_245135708MotifNuclear export signal
TgeneRFWD2chr1:180843078chr1:176153828ENST00000367669-020195_206135732MotifNote=Nuclear localization signal 2
TgeneRFWD2chr1:180843078chr1:176153828ENST00000367669-020235_245135732MotifNuclear export signal
TgeneRFWD2chr1:180843078chr1:176153828ENST00000308769-019419_458135708RepeatNote=WD 1
TgeneRFWD2chr1:180843078chr1:176153828ENST00000308769-019468_508135708RepeatNote=WD 2
TgeneRFWD2chr1:180843078chr1:176153828ENST00000308769-019511_551135708RepeatNote=WD 3
TgeneRFWD2chr1:180843078chr1:176153828ENST00000308769-019553_593135708RepeatNote=WD 4
TgeneRFWD2chr1:180843078chr1:176153828ENST00000308769-019597_635135708RepeatNote=WD 5
TgeneRFWD2chr1:180843078chr1:176153828ENST00000308769-019638_677135708RepeatNote=WD 6
TgeneRFWD2chr1:180843078chr1:176153828ENST00000308769-019691_729135708RepeatNote=WD 7
TgeneRFWD2chr1:180843078chr1:176153828ENST00000367669-020419_458135732RepeatNote=WD 1
TgeneRFWD2chr1:180843078chr1:176153828ENST00000367669-020468_508135732RepeatNote=WD 2
TgeneRFWD2chr1:180843078chr1:176153828ENST00000367669-020511_551135732RepeatNote=WD 3
TgeneRFWD2chr1:180843078chr1:176153828ENST00000367669-020553_593135732RepeatNote=WD 4
TgeneRFWD2chr1:180843078chr1:176153828ENST00000367669-020597_635135732RepeatNote=WD 5
TgeneRFWD2chr1:180843078chr1:176153828ENST00000367669-020638_677135732RepeatNote=WD 6
TgeneRFWD2chr1:180843078chr1:176153828ENST00000367669-020691_729135732RepeatNote=WD 7
TgeneRFWD2chr1:180843078chr1:176153828ENST00000308769-019136_174135708Zinc fingerRING-type
TgeneRFWD2chr1:180843078chr1:176153828ENST00000367669-020136_174135732Zinc fingerRING-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214439_643537632DomainEXS
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315439_643602697DomainEXS
HgeneXPR1chr1:180843078chr1:176153828ENST00000367589+1214529_696537632Topological domainCytoplasmic
HgeneXPR1chr1:180843078chr1:176153828ENST00000367590+1315529_696602697Topological domainCytoplasmic
TgeneRFWD2chr1:180843078chr1:176153828ENST00000308769-0192_110135708Compositional biasNote=Ser-rich
TgeneRFWD2chr1:180843078chr1:176153828ENST00000367669-0202_110135732Compositional biasNote=Ser-rich
TgeneRFWD2chr1:180843078chr1:176153828ENST00000308769-019109_113135708MotifNote=Nuclear localization signal 1
TgeneRFWD2chr1:180843078chr1:176153828ENST00000367669-020109_113135732MotifNote=Nuclear localization signal 1


Top

FusionGeneSequence for XPR1_RFWD2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_XPR1_ENST00000367590_chr1_180843078_+_RFWD2_ENST00000367669_chr1_176153828_-_1199aa
MKFAEHLSAHITPEWRKQYIQYEAFKDMLYSAQDQAPSVEVTDEDTVKRYFAKFEEKFFQTCEKELAKINTFYSEKLAEAQRRFATLQNE
LQSSLDAQKESTGVTTLRQRRKPVFHLSHEERVQHRNIKDLKLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKILETSRGADWRVAHV
EVAPFYTCKKINQLISETEAVVTNELEDGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLFCGIFIVLNITLVLAAVFKLETDRSIWPLIR
IYRGGFLLIEFLFLLGINTYGWRQAGVNHVLIFELNPRSNLSHQHLFEIAGFLGILWCLSLLACFFAPISVIPTYVYPLALYGFMVFFLI
NPTKTFYYKSRFWLLKLLFRVFTAPFHKVGFADFWLADQLNSLSVILMDLEYMICFYSLELKWDESKGLLPNNSEESGICHKYTYGVRAI
VQCIPAWLRFIQCLRRYRDTKRAFPHLVNAGKYSTTFFMVTFAALYSTHKERGHSDTMVFFYLWIVFYIISSCYTLIWDLKMDWGLFDKN
AGENTFLREEIVYPQKAYYYCAIIEDVILRFAWTIQISITSTTLLPHSGDIIATVFAPLEVFRPICFDMIEEAYMTKCGHSFCYKCIHQS
LEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHSVSSTNGHRWQIFQDWLGTDQDNLDLANVNLMLELLVQKKKQLE
AESHAAQLQILMEFLKVARRNKREQLEQIQKELSVLEEDIKRVEEMSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQT
KKQPWYNSTLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDC
DYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNL
MDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEI
VSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAV

>In-frame_XPR1_ENST00000367590_chr1_180843078_+_RFWD2_ENST00000308769_chr1_176153828_-_1175aa
MKFAEHLSAHITPEWRKQYIQYEAFKDMLYSAQDQAPSVEVTDEDTVKRYFAKFEEKFFQTCEKELAKINTFYSEKLAEAQRRFATLQNE
LQSSLDAQKESTGVTTLRQRRKPVFHLSHEERVQHRNIKDLKLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKILETSRGADWRVAHV
EVAPFYTCKKINQLISETEAVVTNELEDGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLFCGIFIVLNITLVLAAVFKLETDRSIWPLIR
IYRGGFLLIEFLFLLGINTYGWRQAGVNHVLIFELNPRSNLSHQHLFEIAGFLGILWCLSLLACFFAPISVIPTYVYPLALYGFMVFFLI
NPTKTFYYKSRFWLLKLLFRVFTAPFHKVGFADFWLADQLNSLSVILMDLEYMICFYSLELKWDESKGLLPNNSEESGICHKYTYGVRAI
VQCIPAWLRFIQCLRRYRDTKRAFPHLVNAGKYSTTFFMVTFAALYSTHKERGHSDTMVFFYLWIVFYIISSCYTLIWDLKMDWGLFDKN
AGENTFLREEIVYPQKAYYYCAIIEDVILRFAWTIQISITSTTLLPHSGDIIATVFAPLEVFRPICFDMIEEAYMTKCGHSFCYKCIHQS
LEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHSNGHRWQIFQDWLGTDQDNLDLANVNLMLELLVQKKKQLEAESH
AAQLQILMEFLKVARRNKREEMSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRLTAHFEDL
EQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDA
VDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDN
SVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFK
GHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKV

>In-frame_XPR1_ENST00000367589_chr1_180843078_+_RFWD2_ENST00000367669_chr1_176153828_-_1134aa
MKFAEHLSAHITPEWRKQYIQYEAFKDMLYSAQDQAPSVEVTDEDTVKRYFAKFEEKFFQTCEKELAKINTFYSEKLAEAQRRFATLQNE
LQSSLDAQKESTGVTTLRQRRKPVFHLSHEERVQHRNIKDLKLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKILETSRGADWRVAHV
EVAPFYTCKKINQLISETEAVVTNELEDGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLFCGIFIVLNITLVLAAVFKLETDRSIWPLIR
IYRGGFLLIEFLFLLGINTYGWRQAGVNHVLIFELNPRSNLSHQHLFEIAGFLGILWCLSLLACFFAPISVIPTYVYPLALYGFMVFFLI
NPTKTFYYKSRFWLLKLLFRVFTAPFHKVGFADFWLADQLNSLSVILMDLEYMICFYSLELKWDESKGLLPNNSEERGHSDTMVFFYLWI
VFYIISSCYTLIWDLKMDWGLFDKNAGENTFLREEIVYPQKAYYYCAIIEDVILRFAWTIQISITSTTLLPHSGDIIATVFAPLEVFRPI
CFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHSVSSTNGHRWQIFQDWLGT
DQDNLDLANVNLMLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLEQIQKELSVLEEDIKRVEEMSGLYSPVSEDSTVPQFEAP
SPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPL
ATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILW
DGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNT
KQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTF

>In-frame_XPR1_ENST00000367589_chr1_180843078_+_RFWD2_ENST00000308769_chr1_176153828_-_1110aa
MKFAEHLSAHITPEWRKQYIQYEAFKDMLYSAQDQAPSVEVTDEDTVKRYFAKFEEKFFQTCEKELAKINTFYSEKLAEAQRRFATLQNE
LQSSLDAQKESTGVTTLRQRRKPVFHLSHEERVQHRNIKDLKLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKILETSRGADWRVAHV
EVAPFYTCKKINQLISETEAVVTNELEDGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLFCGIFIVLNITLVLAAVFKLETDRSIWPLIR
IYRGGFLLIEFLFLLGINTYGWRQAGVNHVLIFELNPRSNLSHQHLFEIAGFLGILWCLSLLACFFAPISVIPTYVYPLALYGFMVFFLI
NPTKTFYYKSRFWLLKLLFRVFTAPFHKVGFADFWLADQLNSLSVILMDLEYMICFYSLELKWDESKGLLPNNSEERGHSDTMVFFYLWI
VFYIISSCYTLIWDLKMDWGLFDKNAGENTFLREEIVYPQKAYYYCAIIEDVILRFAWTIQISITSTTLLPHSGDIIATVFAPLEVFRPI
CFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHSNGHRWQIFQDWLGTDQDN
LDLANVNLMLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREEMSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQ
TKKQPWYNSTLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRD
CDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFN
LMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEE
IVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_XPR1_ENST00000367590_chr1_180843078_+_RFWD2_ENST00000367669_chr1_176153828_-_3597nt
ATGAAGTTCGCCGAGCACCTCTCCGCGCACATCACTCCCGAGTGGAGGAAGCAATACATCCAGTATGAGGCTTTCAAGGATATGCTGTAT
TCAGCTCAGGACCAGGCACCTTCTGTGGAAGTTACAGATGAGGACACAGTAAAGAGGTATTTTGCCAAGTTTGAAGAGAAGTTTTTCCAA
ACCTGTGAAAAAGAACTTGCCAAAATCAACACATTTTATTCAGAGAAGCTCGCAGAGGCTCAGCGCAGGTTTGCTACACTTCAGAATGAG
CTTCAGTCATCACTGGATGCACAGAAAGAAAGCACTGGTGTTACTACGCTGCGACAACGCAGAAAGCCAGTCTTCCACTTGTCCCATGAG
GAACGTGTCCAACATAGAAATATTAAAGACCTTAAACTGGCCTTCAGTGAGTTCTACCTCAGTCTAATCCTGCTGCAGAACTATCAGAAT
CTGAATTTTACAGGGTTTCGAAAAATCCTGAAAAAGCATGACAAGATCCTGGAAACATCTCGTGGAGCAGATTGGCGAGTGGCTCACGTA
GAGGTGGCCCCATTTTATACATGCAAGAAAATCAACCAGCTTATCTCTGAAACTGAGGCTGTAGTGACCAATGAACTTGAAGATGGTGAC
AGACAAAAGGCTATGAAGCGTTTACGTGTCCCCCCTTTGGGAGCTGCTCAGCCTGCACCAGCATGGACTACTTTTAGAGTTGGCCTATTT
TGTGGAATATTCATTGTACTGAATATTACCCTTGTGCTTGCCGCTGTATTTAAACTTGAAACAGATAGAAGTATATGGCCCTTGATAAGA
ATCTATCGGGGTGGCTTTCTTCTGATTGAATTCCTTTTTCTACTGGGCATCAACACGTATGGTTGGAGACAGGCTGGAGTAAACCATGTA
CTCATCTTTGAACTTAATCCGAGAAGCAATTTGTCTCATCAACATCTCTTTGAGATTGCTGGATTCCTCGGGATATTGTGGTGCCTGAGC
CTTCTGGCATGCTTCTTTGCTCCAATTAGTGTCATCCCCACATATGTGTATCCACTTGCCCTTTATGGATTTATGGTTTTCTTCCTTATC
AACCCCACCAAAACTTTCTACTATAAATCCCGGTTTTGGCTGCTTAAACTGCTGTTTCGAGTATTTACAGCCCCCTTCCATAAGGTAGGC
TTTGCTGATTTCTGGCTGGCGGATCAGCTGAACAGCCTGTCAGTGATACTGATGGACCTGGAATATATGATCTGCTTCTACAGTTTGGAG
CTCAAATGGGATGAAAGTAAGGGCCTGTTGCCAAATAATTCAGAAGAATCAGGAATTTGCCACAAATATACATATGGTGTGCGGGCCATT
GTTCAGTGCATTCCTGCTTGGCTTCGCTTCATCCAGTGCCTGCGCCGATATCGAGACACAAAAAGGGCCTTTCCTCATTTAGTTAATGCT
GGCAAATACTCCACAACTTTCTTCATGGTGACGTTTGCAGCCCTTTACAGCACTCACAAAGAACGAGGTCACTCGGACACTATGGTGTTC
TTTTACCTGTGGATTGTCTTTTATATCATCAGTTCCTGCTATACCCTCATCTGGGATCTCAAGATGGACTGGGGTCTCTTCGATAAGAAT
GCTGGAGAGAACACTTTCCTCCGGGAAGAGATTGTATACCCCCAAAAAGCCTACTACTACTGTGCCATAATAGAGGATGTGATTCTGCGC
TTTGCTTGGACTATCCAAATCTCGATTACCTCTACAACTTTGTTGCCTCATTCTGGGGACATCATTGCTACTGTCTTTGCCCCACTTGAG
GTTTTCCGCCCCATCTGCTTTGATATGATTGAAGAAGCATACATGACAAAATGTGGCCACAGCTTTTGCTACAAGTGTATTCATCAGAGT
TTGGAGGACAATAATAGATGTCCCAAGTGTAACTATGTTGTGGACAATATTGACCATCTGTATCCTAATTTCTTGGTGAATGAACTCATT
CTTAAACAGAAGCAAAGATTTGAGGAAAAGAGGTTCAAATTGGACCACTCAGTGAGTAGCACCAATGGCCACAGGTGGCAGATATTTCAA
GATTGGTTGGGAACTGACCAAGATAACCTTGATTTGGCCAATGTCAATCTTATGTTGGAGTTACTAGTGCAGAAGAAGAAACAACTGGAA
GCAGAATCACATGCAGCCCAACTACAGATTCTTATGGAATTCCTCAAGGTTGCAAGAAGAAATAAGAGAGAGCAACTGGAACAGATCCAG
AAGGAGCTAAGTGTTTTGGAAGAGGATATTAAGAGAGTGGAAGAAATGAGTGGCTTATACTCTCCTGTCAGTGAGGATAGCACAGTGCCT
CAATTTGAAGCTCCTTCTCCATCACACAGTAGTATTATTGATTCCACAGAATACAGCCAACCTCCAGGTTTCAGTGGCAGTTCTCAGACA
AAGAAACAGCCTTGGTATAATAGCACGTTAGCATCAAGACGAAAACGACTTACTGCTCATTTTGAAGACTTGGAGCAGTGTTACTTTTCT
ACAAGGATGTCTCGTATCTCAGATGACAGTCGAACTGCAAGCCAGTTGGATGAATTTCAGGAATGCTTGTCCAAGTTTACTCGATATAAT
TCAGTACGACCTTTAGCCACATTGTCATATGCTAGTGATCTCTATAATGGTTCCAGTATAGTCTCTAGTATTGAATTTGACCGGGATTGT
GACTATTTTGCGATTGCTGGAGTTACAAAGAAGATTAAAGTCTATGAATATGACACTGTCATCCAGGATGCAGTGGATATTCATTACCCT
GAGAATGAAATGACCTGCAATTCGAAAATCAGCTGTATCAGTTGGAGTAGTTACCATAAGAACCTGTTAGCTAGCAGTGATTATGAAGGC
ACTGTTATTTTATGGGATGGATTCACAGGACAGAGGTCAAAGGTCTATCAGGAGCATGAGAAGAGGTGTTGGAGTGTTGACTTTAATTTG
ATGGATCCTAAACTCTTGGCTTCAGGTTCTGATGATGCAAAAGTGAAGCTGTGGTCTACCAATCTAGACAACTCAGTGGCAAGCATTGAG
GCAAAGGCTAATGTGTGCTGTGTTAAATTCAGCCCCTCTTCCAGATACCATTTGGCTTTCGGCTGTGCAGATCACTGTGTCCACTACTAT
GATCTTCGTAACACTAAACAGCCAATCATGGTATTCAAAGGACACCGTAAAGCAGTCTCTTATGCAAAGTTTGTGAGTGGTGAGGAAATT
GTCTCTGCCTCAACAGACAGTCAGCTAAAACTGTGGAATGTAGGGAAACCATACTGCCTACGTTCCTTCAAGGGTCATATCAATGAAAAA
AACTTTGTAGGCCTGGCTTCCAATGGAGATTATATAGCTTGTGGAAGTGAAAATAACTCTCTCTACCTGTACTATAAAGGACTTTCTAAG
ACTTTGCTAACTTTTAAGTTTGATACAGTCAAAAGTGTTCTCGACAAAGACCGAAAAGAAGATGATACAAATGAATTTGTTAGTGCTGTG

>In-frame_XPR1_ENST00000367590_chr1_180843078_+_RFWD2_ENST00000308769_chr1_176153828_-_3525nt
ATGAAGTTCGCCGAGCACCTCTCCGCGCACATCACTCCCGAGTGGAGGAAGCAATACATCCAGTATGAGGCTTTCAAGGATATGCTGTAT
TCAGCTCAGGACCAGGCACCTTCTGTGGAAGTTACAGATGAGGACACAGTAAAGAGGTATTTTGCCAAGTTTGAAGAGAAGTTTTTCCAA
ACCTGTGAAAAAGAACTTGCCAAAATCAACACATTTTATTCAGAGAAGCTCGCAGAGGCTCAGCGCAGGTTTGCTACACTTCAGAATGAG
CTTCAGTCATCACTGGATGCACAGAAAGAAAGCACTGGTGTTACTACGCTGCGACAACGCAGAAAGCCAGTCTTCCACTTGTCCCATGAG
GAACGTGTCCAACATAGAAATATTAAAGACCTTAAACTGGCCTTCAGTGAGTTCTACCTCAGTCTAATCCTGCTGCAGAACTATCAGAAT
CTGAATTTTACAGGGTTTCGAAAAATCCTGAAAAAGCATGACAAGATCCTGGAAACATCTCGTGGAGCAGATTGGCGAGTGGCTCACGTA
GAGGTGGCCCCATTTTATACATGCAAGAAAATCAACCAGCTTATCTCTGAAACTGAGGCTGTAGTGACCAATGAACTTGAAGATGGTGAC
AGACAAAAGGCTATGAAGCGTTTACGTGTCCCCCCTTTGGGAGCTGCTCAGCCTGCACCAGCATGGACTACTTTTAGAGTTGGCCTATTT
TGTGGAATATTCATTGTACTGAATATTACCCTTGTGCTTGCCGCTGTATTTAAACTTGAAACAGATAGAAGTATATGGCCCTTGATAAGA
ATCTATCGGGGTGGCTTTCTTCTGATTGAATTCCTTTTTCTACTGGGCATCAACACGTATGGTTGGAGACAGGCTGGAGTAAACCATGTA
CTCATCTTTGAACTTAATCCGAGAAGCAATTTGTCTCATCAACATCTCTTTGAGATTGCTGGATTCCTCGGGATATTGTGGTGCCTGAGC
CTTCTGGCATGCTTCTTTGCTCCAATTAGTGTCATCCCCACATATGTGTATCCACTTGCCCTTTATGGATTTATGGTTTTCTTCCTTATC
AACCCCACCAAAACTTTCTACTATAAATCCCGGTTTTGGCTGCTTAAACTGCTGTTTCGAGTATTTACAGCCCCCTTCCATAAGGTAGGC
TTTGCTGATTTCTGGCTGGCGGATCAGCTGAACAGCCTGTCAGTGATACTGATGGACCTGGAATATATGATCTGCTTCTACAGTTTGGAG
CTCAAATGGGATGAAAGTAAGGGCCTGTTGCCAAATAATTCAGAAGAATCAGGAATTTGCCACAAATATACATATGGTGTGCGGGCCATT
GTTCAGTGCATTCCTGCTTGGCTTCGCTTCATCCAGTGCCTGCGCCGATATCGAGACACAAAAAGGGCCTTTCCTCATTTAGTTAATGCT
GGCAAATACTCCACAACTTTCTTCATGGTGACGTTTGCAGCCCTTTACAGCACTCACAAAGAACGAGGTCACTCGGACACTATGGTGTTC
TTTTACCTGTGGATTGTCTTTTATATCATCAGTTCCTGCTATACCCTCATCTGGGATCTCAAGATGGACTGGGGTCTCTTCGATAAGAAT
GCTGGAGAGAACACTTTCCTCCGGGAAGAGATTGTATACCCCCAAAAAGCCTACTACTACTGTGCCATAATAGAGGATGTGATTCTGCGC
TTTGCTTGGACTATCCAAATCTCGATTACCTCTACAACTTTGTTGCCTCATTCTGGGGACATCATTGCTACTGTCTTTGCCCCACTTGAG
GTTTTCCGCCCCATCTGCTTTGATATGATTGAAGAAGCATACATGACAAAATGTGGCCACAGCTTTTGCTACAAGTGTATTCATCAGAGT
TTGGAGGACAATAATAGATGTCCCAAGTGTAACTATGTTGTGGACAATATTGACCATCTGTATCCTAATTTCTTGGTGAATGAACTCATT
CTTAAACAGAAGCAAAGATTTGAGGAAAAGAGGTTCAAATTGGACCACTCAAATGGCCACAGGTGGCAGATATTTCAAGATTGGTTGGGA
ACTGACCAAGATAACCTTGATTTGGCCAATGTCAATCTTATGTTGGAGTTACTAGTGCAGAAGAAGAAACAACTGGAAGCAGAATCACAT
GCAGCCCAACTACAGATTCTTATGGAATTCCTCAAGGTTGCAAGAAGAAATAAGAGAGAGGAAATGAGTGGCTTATACTCTCCTGTCAGT
GAGGATAGCACAGTGCCTCAATTTGAAGCTCCTTCTCCATCACACAGTAGTATTATTGATTCCACAGAATACAGCCAACCTCCAGGTTTC
AGTGGCAGTTCTCAGACAAAGAAACAGCCTTGGTATAATAGCACGTTAGCATCAAGACGAAAACGACTTACTGCTCATTTTGAAGACTTG
GAGCAGTGTTACTTTTCTACAAGGATGTCTCGTATCTCAGATGACAGTCGAACTGCAAGCCAGTTGGATGAATTTCAGGAATGCTTGTCC
AAGTTTACTCGATATAATTCAGTACGACCTTTAGCCACATTGTCATATGCTAGTGATCTCTATAATGGTTCCAGTATAGTCTCTAGTATT
GAATTTGACCGGGATTGTGACTATTTTGCGATTGCTGGAGTTACAAAGAAGATTAAAGTCTATGAATATGACACTGTCATCCAGGATGCA
GTGGATATTCATTACCCTGAGAATGAAATGACCTGCAATTCGAAAATCAGCTGTATCAGTTGGAGTAGTTACCATAAGAACCTGTTAGCT
AGCAGTGATTATGAAGGCACTGTTATTTTATGGGATGGATTCACAGGACAGAGGTCAAAGGTCTATCAGGAGCATGAGAAGAGGTGTTGG
AGTGTTGACTTTAATTTGATGGATCCTAAACTCTTGGCTTCAGGTTCTGATGATGCAAAAGTGAAGCTGTGGTCTACCAATCTAGACAAC
TCAGTGGCAAGCATTGAGGCAAAGGCTAATGTGTGCTGTGTTAAATTCAGCCCCTCTTCCAGATACCATTTGGCTTTCGGCTGTGCAGAT
CACTGTGTCCACTACTATGATCTTCGTAACACTAAACAGCCAATCATGGTATTCAAAGGACACCGTAAAGCAGTCTCTTATGCAAAGTTT
GTGAGTGGTGAGGAAATTGTCTCTGCCTCAACAGACAGTCAGCTAAAACTGTGGAATGTAGGGAAACCATACTGCCTACGTTCCTTCAAG
GGTCATATCAATGAAAAAAACTTTGTAGGCCTGGCTTCCAATGGAGATTATATAGCTTGTGGAAGTGAAAATAACTCTCTCTACCTGTAC
TATAAAGGACTTTCTAAGACTTTGCTAACTTTTAAGTTTGATACAGTCAAAAGTGTTCTCGACAAAGACCGAAAAGAAGATGATACAAAT
GAATTTGTTAGTGCTGTGTGCTGGAGGGCACTACCAGATGGGGAGTCCAATGTGCTGATTGCTGCTAACAGTCAGGGTACAATTAAGGTG

>In-frame_XPR1_ENST00000367589_chr1_180843078_+_RFWD2_ENST00000367669_chr1_176153828_-_3402nt
ATGAAGTTCGCCGAGCACCTCTCCGCGCACATCACTCCCGAGTGGAGGAAGCAATACATCCAGTATGAGGCTTTCAAGGATATGCTGTAT
TCAGCTCAGGACCAGGCACCTTCTGTGGAAGTTACAGATGAGGACACAGTAAAGAGGTATTTTGCCAAGTTTGAAGAGAAGTTTTTCCAA
ACCTGTGAAAAAGAACTTGCCAAAATCAACACATTTTATTCAGAGAAGCTCGCAGAGGCTCAGCGCAGGTTTGCTACACTTCAGAATGAG
CTTCAGTCATCACTGGATGCACAGAAAGAAAGCACTGGTGTTACTACGCTGCGACAACGCAGAAAGCCAGTCTTCCACTTGTCCCATGAG
GAACGTGTCCAACATAGAAATATTAAAGACCTTAAACTGGCCTTCAGTGAGTTCTACCTCAGTCTAATCCTGCTGCAGAACTATCAGAAT
CTGAATTTTACAGGGTTTCGAAAAATCCTGAAAAAGCATGACAAGATCCTGGAAACATCTCGTGGAGCAGATTGGCGAGTGGCTCACGTA
GAGGTGGCCCCATTTTATACATGCAAGAAAATCAACCAGCTTATCTCTGAAACTGAGGCTGTAGTGACCAATGAACTTGAAGATGGTGAC
AGACAAAAGGCTATGAAGCGTTTACGTGTCCCCCCTTTGGGAGCTGCTCAGCCTGCACCAGCATGGACTACTTTTAGAGTTGGCCTATTT
TGTGGAATATTCATTGTACTGAATATTACCCTTGTGCTTGCCGCTGTATTTAAACTTGAAACAGATAGAAGTATATGGCCCTTGATAAGA
ATCTATCGGGGTGGCTTTCTTCTGATTGAATTCCTTTTTCTACTGGGCATCAACACGTATGGTTGGAGACAGGCTGGAGTAAACCATGTA
CTCATCTTTGAACTTAATCCGAGAAGCAATTTGTCTCATCAACATCTCTTTGAGATTGCTGGATTCCTCGGGATATTGTGGTGCCTGAGC
CTTCTGGCATGCTTCTTTGCTCCAATTAGTGTCATCCCCACATATGTGTATCCACTTGCCCTTTATGGATTTATGGTTTTCTTCCTTATC
AACCCCACCAAAACTTTCTACTATAAATCCCGGTTTTGGCTGCTTAAACTGCTGTTTCGAGTATTTACAGCCCCCTTCCATAAGGTAGGC
TTTGCTGATTTCTGGCTGGCGGATCAGCTGAACAGCCTGTCAGTGATACTGATGGACCTGGAATATATGATCTGCTTCTACAGTTTGGAG
CTCAAATGGGATGAAAGTAAGGGCCTGTTGCCAAATAATTCAGAAGAACGAGGTCACTCGGACACTATGGTGTTCTTTTACCTGTGGATT
GTCTTTTATATCATCAGTTCCTGCTATACCCTCATCTGGGATCTCAAGATGGACTGGGGTCTCTTCGATAAGAATGCTGGAGAGAACACT
TTCCTCCGGGAAGAGATTGTATACCCCCAAAAAGCCTACTACTACTGTGCCATAATAGAGGATGTGATTCTGCGCTTTGCTTGGACTATC
CAAATCTCGATTACCTCTACAACTTTGTTGCCTCATTCTGGGGACATCATTGCTACTGTCTTTGCCCCACTTGAGGTTTTCCGCCCCATC
TGCTTTGATATGATTGAAGAAGCATACATGACAAAATGTGGCCACAGCTTTTGCTACAAGTGTATTCATCAGAGTTTGGAGGACAATAAT
AGATGTCCCAAGTGTAACTATGTTGTGGACAATATTGACCATCTGTATCCTAATTTCTTGGTGAATGAACTCATTCTTAAACAGAAGCAA
AGATTTGAGGAAAAGAGGTTCAAATTGGACCACTCAGTGAGTAGCACCAATGGCCACAGGTGGCAGATATTTCAAGATTGGTTGGGAACT
GACCAAGATAACCTTGATTTGGCCAATGTCAATCTTATGTTGGAGTTACTAGTGCAGAAGAAGAAACAACTGGAAGCAGAATCACATGCA
GCCCAACTACAGATTCTTATGGAATTCCTCAAGGTTGCAAGAAGAAATAAGAGAGAGCAACTGGAACAGATCCAGAAGGAGCTAAGTGTT
TTGGAAGAGGATATTAAGAGAGTGGAAGAAATGAGTGGCTTATACTCTCCTGTCAGTGAGGATAGCACAGTGCCTCAATTTGAAGCTCCT
TCTCCATCACACAGTAGTATTATTGATTCCACAGAATACAGCCAACCTCCAGGTTTCAGTGGCAGTTCTCAGACAAAGAAACAGCCTTGG
TATAATAGCACGTTAGCATCAAGACGAAAACGACTTACTGCTCATTTTGAAGACTTGGAGCAGTGTTACTTTTCTACAAGGATGTCTCGT
ATCTCAGATGACAGTCGAACTGCAAGCCAGTTGGATGAATTTCAGGAATGCTTGTCCAAGTTTACTCGATATAATTCAGTACGACCTTTA
GCCACATTGTCATATGCTAGTGATCTCTATAATGGTTCCAGTATAGTCTCTAGTATTGAATTTGACCGGGATTGTGACTATTTTGCGATT
GCTGGAGTTACAAAGAAGATTAAAGTCTATGAATATGACACTGTCATCCAGGATGCAGTGGATATTCATTACCCTGAGAATGAAATGACC
TGCAATTCGAAAATCAGCTGTATCAGTTGGAGTAGTTACCATAAGAACCTGTTAGCTAGCAGTGATTATGAAGGCACTGTTATTTTATGG
GATGGATTCACAGGACAGAGGTCAAAGGTCTATCAGGAGCATGAGAAGAGGTGTTGGAGTGTTGACTTTAATTTGATGGATCCTAAACTC
TTGGCTTCAGGTTCTGATGATGCAAAAGTGAAGCTGTGGTCTACCAATCTAGACAACTCAGTGGCAAGCATTGAGGCAAAGGCTAATGTG
TGCTGTGTTAAATTCAGCCCCTCTTCCAGATACCATTTGGCTTTCGGCTGTGCAGATCACTGTGTCCACTACTATGATCTTCGTAACACT
AAACAGCCAATCATGGTATTCAAAGGACACCGTAAAGCAGTCTCTTATGCAAAGTTTGTGAGTGGTGAGGAAATTGTCTCTGCCTCAACA
GACAGTCAGCTAAAACTGTGGAATGTAGGGAAACCATACTGCCTACGTTCCTTCAAGGGTCATATCAATGAAAAAAACTTTGTAGGCCTG
GCTTCCAATGGAGATTATATAGCTTGTGGAAGTGAAAATAACTCTCTCTACCTGTACTATAAAGGACTTTCTAAGACTTTGCTAACTTTT
AAGTTTGATACAGTCAAAAGTGTTCTCGACAAAGACCGAAAAGAAGATGATACAAATGAATTTGTTAGTGCTGTGTGCTGGAGGGCACTA

>In-frame_XPR1_ENST00000367589_chr1_180843078_+_RFWD2_ENST00000308769_chr1_176153828_-_3330nt
ATGAAGTTCGCCGAGCACCTCTCCGCGCACATCACTCCCGAGTGGAGGAAGCAATACATCCAGTATGAGGCTTTCAAGGATATGCTGTAT
TCAGCTCAGGACCAGGCACCTTCTGTGGAAGTTACAGATGAGGACACAGTAAAGAGGTATTTTGCCAAGTTTGAAGAGAAGTTTTTCCAA
ACCTGTGAAAAAGAACTTGCCAAAATCAACACATTTTATTCAGAGAAGCTCGCAGAGGCTCAGCGCAGGTTTGCTACACTTCAGAATGAG
CTTCAGTCATCACTGGATGCACAGAAAGAAAGCACTGGTGTTACTACGCTGCGACAACGCAGAAAGCCAGTCTTCCACTTGTCCCATGAG
GAACGTGTCCAACATAGAAATATTAAAGACCTTAAACTGGCCTTCAGTGAGTTCTACCTCAGTCTAATCCTGCTGCAGAACTATCAGAAT
CTGAATTTTACAGGGTTTCGAAAAATCCTGAAAAAGCATGACAAGATCCTGGAAACATCTCGTGGAGCAGATTGGCGAGTGGCTCACGTA
GAGGTGGCCCCATTTTATACATGCAAGAAAATCAACCAGCTTATCTCTGAAACTGAGGCTGTAGTGACCAATGAACTTGAAGATGGTGAC
AGACAAAAGGCTATGAAGCGTTTACGTGTCCCCCCTTTGGGAGCTGCTCAGCCTGCACCAGCATGGACTACTTTTAGAGTTGGCCTATTT
TGTGGAATATTCATTGTACTGAATATTACCCTTGTGCTTGCCGCTGTATTTAAACTTGAAACAGATAGAAGTATATGGCCCTTGATAAGA
ATCTATCGGGGTGGCTTTCTTCTGATTGAATTCCTTTTTCTACTGGGCATCAACACGTATGGTTGGAGACAGGCTGGAGTAAACCATGTA
CTCATCTTTGAACTTAATCCGAGAAGCAATTTGTCTCATCAACATCTCTTTGAGATTGCTGGATTCCTCGGGATATTGTGGTGCCTGAGC
CTTCTGGCATGCTTCTTTGCTCCAATTAGTGTCATCCCCACATATGTGTATCCACTTGCCCTTTATGGATTTATGGTTTTCTTCCTTATC
AACCCCACCAAAACTTTCTACTATAAATCCCGGTTTTGGCTGCTTAAACTGCTGTTTCGAGTATTTACAGCCCCCTTCCATAAGGTAGGC
TTTGCTGATTTCTGGCTGGCGGATCAGCTGAACAGCCTGTCAGTGATACTGATGGACCTGGAATATATGATCTGCTTCTACAGTTTGGAG
CTCAAATGGGATGAAAGTAAGGGCCTGTTGCCAAATAATTCAGAAGAACGAGGTCACTCGGACACTATGGTGTTCTTTTACCTGTGGATT
GTCTTTTATATCATCAGTTCCTGCTATACCCTCATCTGGGATCTCAAGATGGACTGGGGTCTCTTCGATAAGAATGCTGGAGAGAACACT
TTCCTCCGGGAAGAGATTGTATACCCCCAAAAAGCCTACTACTACTGTGCCATAATAGAGGATGTGATTCTGCGCTTTGCTTGGACTATC
CAAATCTCGATTACCTCTACAACTTTGTTGCCTCATTCTGGGGACATCATTGCTACTGTCTTTGCCCCACTTGAGGTTTTCCGCCCCATC
TGCTTTGATATGATTGAAGAAGCATACATGACAAAATGTGGCCACAGCTTTTGCTACAAGTGTATTCATCAGAGTTTGGAGGACAATAAT
AGATGTCCCAAGTGTAACTATGTTGTGGACAATATTGACCATCTGTATCCTAATTTCTTGGTGAATGAACTCATTCTTAAACAGAAGCAA
AGATTTGAGGAAAAGAGGTTCAAATTGGACCACTCAAATGGCCACAGGTGGCAGATATTTCAAGATTGGTTGGGAACTGACCAAGATAAC
CTTGATTTGGCCAATGTCAATCTTATGTTGGAGTTACTAGTGCAGAAGAAGAAACAACTGGAAGCAGAATCACATGCAGCCCAACTACAG
ATTCTTATGGAATTCCTCAAGGTTGCAAGAAGAAATAAGAGAGAGGAAATGAGTGGCTTATACTCTCCTGTCAGTGAGGATAGCACAGTG
CCTCAATTTGAAGCTCCTTCTCCATCACACAGTAGTATTATTGATTCCACAGAATACAGCCAACCTCCAGGTTTCAGTGGCAGTTCTCAG
ACAAAGAAACAGCCTTGGTATAATAGCACGTTAGCATCAAGACGAAAACGACTTACTGCTCATTTTGAAGACTTGGAGCAGTGTTACTTT
TCTACAAGGATGTCTCGTATCTCAGATGACAGTCGAACTGCAAGCCAGTTGGATGAATTTCAGGAATGCTTGTCCAAGTTTACTCGATAT
AATTCAGTACGACCTTTAGCCACATTGTCATATGCTAGTGATCTCTATAATGGTTCCAGTATAGTCTCTAGTATTGAATTTGACCGGGAT
TGTGACTATTTTGCGATTGCTGGAGTTACAAAGAAGATTAAAGTCTATGAATATGACACTGTCATCCAGGATGCAGTGGATATTCATTAC
CCTGAGAATGAAATGACCTGCAATTCGAAAATCAGCTGTATCAGTTGGAGTAGTTACCATAAGAACCTGTTAGCTAGCAGTGATTATGAA
GGCACTGTTATTTTATGGGATGGATTCACAGGACAGAGGTCAAAGGTCTATCAGGAGCATGAGAAGAGGTGTTGGAGTGTTGACTTTAAT
TTGATGGATCCTAAACTCTTGGCTTCAGGTTCTGATGATGCAAAAGTGAAGCTGTGGTCTACCAATCTAGACAACTCAGTGGCAAGCATT
GAGGCAAAGGCTAATGTGTGCTGTGTTAAATTCAGCCCCTCTTCCAGATACCATTTGGCTTTCGGCTGTGCAGATCACTGTGTCCACTAC
TATGATCTTCGTAACACTAAACAGCCAATCATGGTATTCAAAGGACACCGTAAAGCAGTCTCTTATGCAAAGTTTGTGAGTGGTGAGGAA
ATTGTCTCTGCCTCAACAGACAGTCAGCTAAAACTGTGGAATGTAGGGAAACCATACTGCCTACGTTCCTTCAAGGGTCATATCAATGAA
AAAAACTTTGTAGGCCTGGCTTCCAATGGAGATTATATAGCTTGTGGAAGTGAAAATAACTCTCTCTACCTGTACTATAAAGGACTTTCT
AAGACTTTGCTAACTTTTAAGTTTGATACAGTCAAAAGTGTTCTCGACAAAGACCGAAAAGAAGATGATACAAATGAATTTGTTAGTGCT
GTGTGCTGGAGGGCACTACCAGATGGGGAGTCCAATGTGCTGATTGCTGCTAACAGTCAGGGTACAATTAAGGTGCTAGAATTGGTATGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_XPR1_ENST00000367590_chr1_180843078_+_RFWD2_ENST00000367669_chr1_176153828_-_4117nt
GCGGGGAGGGGCGGGGCTATGGAGAGGAGGAGGAAGATGGCGGGCGGGCTGCTCTGAAGAGACCTCGGCGGCGGCGGAGGAGGAGAGAAG
CGCAGCGCCGCGCCGCGCCGGGGCCCATGTGGGGAGGAGTCGGAGTCGCTGTTGCCGCCGCCGCCTGTAGCTGCTGGACCCGAGTGGGAG
TGAGGGGGAAACGGCAGGATGAAGTTCGCCGAGCACCTCTCCGCGCACATCACTCCCGAGTGGAGGAAGCAATACATCCAGTATGAGGCT
TTCAAGGATATGCTGTATTCAGCTCAGGACCAGGCACCTTCTGTGGAAGTTACAGATGAGGACACAGTAAAGAGGTATTTTGCCAAGTTT
GAAGAGAAGTTTTTCCAAACCTGTGAAAAAGAACTTGCCAAAATCAACACATTTTATTCAGAGAAGCTCGCAGAGGCTCAGCGCAGGTTT
GCTACACTTCAGAATGAGCTTCAGTCATCACTGGATGCACAGAAAGAAAGCACTGGTGTTACTACGCTGCGACAACGCAGAAAGCCAGTC
TTCCACTTGTCCCATGAGGAACGTGTCCAACATAGAAATATTAAAGACCTTAAACTGGCCTTCAGTGAGTTCTACCTCAGTCTAATCCTG
CTGCAGAACTATCAGAATCTGAATTTTACAGGGTTTCGAAAAATCCTGAAAAAGCATGACAAGATCCTGGAAACATCTCGTGGAGCAGAT
TGGCGAGTGGCTCACGTAGAGGTGGCCCCATTTTATACATGCAAGAAAATCAACCAGCTTATCTCTGAAACTGAGGCTGTAGTGACCAAT
GAACTTGAAGATGGTGACAGACAAAAGGCTATGAAGCGTTTACGTGTCCCCCCTTTGGGAGCTGCTCAGCCTGCACCAGCATGGACTACT
TTTAGAGTTGGCCTATTTTGTGGAATATTCATTGTACTGAATATTACCCTTGTGCTTGCCGCTGTATTTAAACTTGAAACAGATAGAAGT
ATATGGCCCTTGATAAGAATCTATCGGGGTGGCTTTCTTCTGATTGAATTCCTTTTTCTACTGGGCATCAACACGTATGGTTGGAGACAG
GCTGGAGTAAACCATGTACTCATCTTTGAACTTAATCCGAGAAGCAATTTGTCTCATCAACATCTCTTTGAGATTGCTGGATTCCTCGGG
ATATTGTGGTGCCTGAGCCTTCTGGCATGCTTCTTTGCTCCAATTAGTGTCATCCCCACATATGTGTATCCACTTGCCCTTTATGGATTT
ATGGTTTTCTTCCTTATCAACCCCACCAAAACTTTCTACTATAAATCCCGGTTTTGGCTGCTTAAACTGCTGTTTCGAGTATTTACAGCC
CCCTTCCATAAGGTAGGCTTTGCTGATTTCTGGCTGGCGGATCAGCTGAACAGCCTGTCAGTGATACTGATGGACCTGGAATATATGATC
TGCTTCTACAGTTTGGAGCTCAAATGGGATGAAAGTAAGGGCCTGTTGCCAAATAATTCAGAAGAATCAGGAATTTGCCACAAATATACA
TATGGTGTGCGGGCCATTGTTCAGTGCATTCCTGCTTGGCTTCGCTTCATCCAGTGCCTGCGCCGATATCGAGACACAAAAAGGGCCTTT
CCTCATTTAGTTAATGCTGGCAAATACTCCACAACTTTCTTCATGGTGACGTTTGCAGCCCTTTACAGCACTCACAAAGAACGAGGTCAC
TCGGACACTATGGTGTTCTTTTACCTGTGGATTGTCTTTTATATCATCAGTTCCTGCTATACCCTCATCTGGGATCTCAAGATGGACTGG
GGTCTCTTCGATAAGAATGCTGGAGAGAACACTTTCCTCCGGGAAGAGATTGTATACCCCCAAAAAGCCTACTACTACTGTGCCATAATA
GAGGATGTGATTCTGCGCTTTGCTTGGACTATCCAAATCTCGATTACCTCTACAACTTTGTTGCCTCATTCTGGGGACATCATTGCTACT
GTCTTTGCCCCACTTGAGGTTTTCCGCCCCATCTGCTTTGATATGATTGAAGAAGCATACATGACAAAATGTGGCCACAGCTTTTGCTAC
AAGTGTATTCATCAGAGTTTGGAGGACAATAATAGATGTCCCAAGTGTAACTATGTTGTGGACAATATTGACCATCTGTATCCTAATTTC
TTGGTGAATGAACTCATTCTTAAACAGAAGCAAAGATTTGAGGAAAAGAGGTTCAAATTGGACCACTCAGTGAGTAGCACCAATGGCCAC
AGGTGGCAGATATTTCAAGATTGGTTGGGAACTGACCAAGATAACCTTGATTTGGCCAATGTCAATCTTATGTTGGAGTTACTAGTGCAG
AAGAAGAAACAACTGGAAGCAGAATCACATGCAGCCCAACTACAGATTCTTATGGAATTCCTCAAGGTTGCAAGAAGAAATAAGAGAGAG
CAACTGGAACAGATCCAGAAGGAGCTAAGTGTTTTGGAAGAGGATATTAAGAGAGTGGAAGAAATGAGTGGCTTATACTCTCCTGTCAGT
GAGGATAGCACAGTGCCTCAATTTGAAGCTCCTTCTCCATCACACAGTAGTATTATTGATTCCACAGAATACAGCCAACCTCCAGGTTTC
AGTGGCAGTTCTCAGACAAAGAAACAGCCTTGGTATAATAGCACGTTAGCATCAAGACGAAAACGACTTACTGCTCATTTTGAAGACTTG
GAGCAGTGTTACTTTTCTACAAGGATGTCTCGTATCTCAGATGACAGTCGAACTGCAAGCCAGTTGGATGAATTTCAGGAATGCTTGTCC
AAGTTTACTCGATATAATTCAGTACGACCTTTAGCCACATTGTCATATGCTAGTGATCTCTATAATGGTTCCAGTATAGTCTCTAGTATT
GAATTTGACCGGGATTGTGACTATTTTGCGATTGCTGGAGTTACAAAGAAGATTAAAGTCTATGAATATGACACTGTCATCCAGGATGCA
GTGGATATTCATTACCCTGAGAATGAAATGACCTGCAATTCGAAAATCAGCTGTATCAGTTGGAGTAGTTACCATAAGAACCTGTTAGCT
AGCAGTGATTATGAAGGCACTGTTATTTTATGGGATGGATTCACAGGACAGAGGTCAAAGGTCTATCAGGAGCATGAGAAGAGGTGTTGG
AGTGTTGACTTTAATTTGATGGATCCTAAACTCTTGGCTTCAGGTTCTGATGATGCAAAAGTGAAGCTGTGGTCTACCAATCTAGACAAC
TCAGTGGCAAGCATTGAGGCAAAGGCTAATGTGTGCTGTGTTAAATTCAGCCCCTCTTCCAGATACCATTTGGCTTTCGGCTGTGCAGAT
CACTGTGTCCACTACTATGATCTTCGTAACACTAAACAGCCAATCATGGTATTCAAAGGACACCGTAAAGCAGTCTCTTATGCAAAGTTT
GTGAGTGGTGAGGAAATTGTCTCTGCCTCAACAGACAGTCAGCTAAAACTGTGGAATGTAGGGAAACCATACTGCCTACGTTCCTTCAAG
GGTCATATCAATGAAAAAAACTTTGTAGGCCTGGCTTCCAATGGAGATTATATAGCTTGTGGAAGTGAAAATAACTCTCTCTACCTGTAC
TATAAAGGACTTTCTAAGACTTTGCTAACTTTTAAGTTTGATACAGTCAAAAGTGTTCTCGACAAAGACCGAAAAGAAGATGATACAAAT
GAATTTGTTAGTGCTGTGTGCTGGAGGGCACTACCAGATGGGGAGTCCAATGTGCTGATTGCTGCTAACAGTCAGGGTACAATTAAGGTG
CTAGAATTGGTATGAAGGGTTAACTCAAGTCAAATTGTACTTGATCCTGCTGAAATACATCTGCAGCTGACAATGAGAGAAGAAACAGAA
AATGTCATGTGATGTCTCTCCCCAAAGTCATCATGGGTTTTGGATTTGTTTTGAATATTTTTTTCTTTTTTTCTTTTCCCTCCTTTATGA
CCTTTGGGACATTGGGAATACCCAGCCAACTCTCCACCATCAATGTAACTCCATGGACATTGCTGCTCTTGGTGGTGTTATCTAATTTTT

>In-frame_XPR1_ENST00000367590_chr1_180843078_+_RFWD2_ENST00000308769_chr1_176153828_-_3723nt
GCGGGGAGGGGCGGGGCTATGGAGAGGAGGAGGAAGATGGCGGGCGGGCTGCTCTGAAGAGACCTCGGCGGCGGCGGAGGAGGAGAGAAG
CGCAGCGCCGCGCCGCGCCGGGGCCCATGTGGGGAGGAGTCGGAGTCGCTGTTGCCGCCGCCGCCTGTAGCTGCTGGACCCGAGTGGGAG
TGAGGGGGAAACGGCAGGATGAAGTTCGCCGAGCACCTCTCCGCGCACATCACTCCCGAGTGGAGGAAGCAATACATCCAGTATGAGGCT
TTCAAGGATATGCTGTATTCAGCTCAGGACCAGGCACCTTCTGTGGAAGTTACAGATGAGGACACAGTAAAGAGGTATTTTGCCAAGTTT
GAAGAGAAGTTTTTCCAAACCTGTGAAAAAGAACTTGCCAAAATCAACACATTTTATTCAGAGAAGCTCGCAGAGGCTCAGCGCAGGTTT
GCTACACTTCAGAATGAGCTTCAGTCATCACTGGATGCACAGAAAGAAAGCACTGGTGTTACTACGCTGCGACAACGCAGAAAGCCAGTC
TTCCACTTGTCCCATGAGGAACGTGTCCAACATAGAAATATTAAAGACCTTAAACTGGCCTTCAGTGAGTTCTACCTCAGTCTAATCCTG
CTGCAGAACTATCAGAATCTGAATTTTACAGGGTTTCGAAAAATCCTGAAAAAGCATGACAAGATCCTGGAAACATCTCGTGGAGCAGAT
TGGCGAGTGGCTCACGTAGAGGTGGCCCCATTTTATACATGCAAGAAAATCAACCAGCTTATCTCTGAAACTGAGGCTGTAGTGACCAAT
GAACTTGAAGATGGTGACAGACAAAAGGCTATGAAGCGTTTACGTGTCCCCCCTTTGGGAGCTGCTCAGCCTGCACCAGCATGGACTACT
TTTAGAGTTGGCCTATTTTGTGGAATATTCATTGTACTGAATATTACCCTTGTGCTTGCCGCTGTATTTAAACTTGAAACAGATAGAAGT
ATATGGCCCTTGATAAGAATCTATCGGGGTGGCTTTCTTCTGATTGAATTCCTTTTTCTACTGGGCATCAACACGTATGGTTGGAGACAG
GCTGGAGTAAACCATGTACTCATCTTTGAACTTAATCCGAGAAGCAATTTGTCTCATCAACATCTCTTTGAGATTGCTGGATTCCTCGGG
ATATTGTGGTGCCTGAGCCTTCTGGCATGCTTCTTTGCTCCAATTAGTGTCATCCCCACATATGTGTATCCACTTGCCCTTTATGGATTT
ATGGTTTTCTTCCTTATCAACCCCACCAAAACTTTCTACTATAAATCCCGGTTTTGGCTGCTTAAACTGCTGTTTCGAGTATTTACAGCC
CCCTTCCATAAGGTAGGCTTTGCTGATTTCTGGCTGGCGGATCAGCTGAACAGCCTGTCAGTGATACTGATGGACCTGGAATATATGATC
TGCTTCTACAGTTTGGAGCTCAAATGGGATGAAAGTAAGGGCCTGTTGCCAAATAATTCAGAAGAATCAGGAATTTGCCACAAATATACA
TATGGTGTGCGGGCCATTGTTCAGTGCATTCCTGCTTGGCTTCGCTTCATCCAGTGCCTGCGCCGATATCGAGACACAAAAAGGGCCTTT
CCTCATTTAGTTAATGCTGGCAAATACTCCACAACTTTCTTCATGGTGACGTTTGCAGCCCTTTACAGCACTCACAAAGAACGAGGTCAC
TCGGACACTATGGTGTTCTTTTACCTGTGGATTGTCTTTTATATCATCAGTTCCTGCTATACCCTCATCTGGGATCTCAAGATGGACTGG
GGTCTCTTCGATAAGAATGCTGGAGAGAACACTTTCCTCCGGGAAGAGATTGTATACCCCCAAAAAGCCTACTACTACTGTGCCATAATA
GAGGATGTGATTCTGCGCTTTGCTTGGACTATCCAAATCTCGATTACCTCTACAACTTTGTTGCCTCATTCTGGGGACATCATTGCTACT
GTCTTTGCCCCACTTGAGGTTTTCCGCCCCATCTGCTTTGATATGATTGAAGAAGCATACATGACAAAATGTGGCCACAGCTTTTGCTAC
AAGTGTATTCATCAGAGTTTGGAGGACAATAATAGATGTCCCAAGTGTAACTATGTTGTGGACAATATTGACCATCTGTATCCTAATTTC
TTGGTGAATGAACTCATTCTTAAACAGAAGCAAAGATTTGAGGAAAAGAGGTTCAAATTGGACCACTCAAATGGCCACAGGTGGCAGATA
TTTCAAGATTGGTTGGGAACTGACCAAGATAACCTTGATTTGGCCAATGTCAATCTTATGTTGGAGTTACTAGTGCAGAAGAAGAAACAA
CTGGAAGCAGAATCACATGCAGCCCAACTACAGATTCTTATGGAATTCCTCAAGGTTGCAAGAAGAAATAAGAGAGAGGAAATGAGTGGC
TTATACTCTCCTGTCAGTGAGGATAGCACAGTGCCTCAATTTGAAGCTCCTTCTCCATCACACAGTAGTATTATTGATTCCACAGAATAC
AGCCAACCTCCAGGTTTCAGTGGCAGTTCTCAGACAAAGAAACAGCCTTGGTATAATAGCACGTTAGCATCAAGACGAAAACGACTTACT
GCTCATTTTGAAGACTTGGAGCAGTGTTACTTTTCTACAAGGATGTCTCGTATCTCAGATGACAGTCGAACTGCAAGCCAGTTGGATGAA
TTTCAGGAATGCTTGTCCAAGTTTACTCGATATAATTCAGTACGACCTTTAGCCACATTGTCATATGCTAGTGATCTCTATAATGGTTCC
AGTATAGTCTCTAGTATTGAATTTGACCGGGATTGTGACTATTTTGCGATTGCTGGAGTTACAAAGAAGATTAAAGTCTATGAATATGAC
ACTGTCATCCAGGATGCAGTGGATATTCATTACCCTGAGAATGAAATGACCTGCAATTCGAAAATCAGCTGTATCAGTTGGAGTAGTTAC
CATAAGAACCTGTTAGCTAGCAGTGATTATGAAGGCACTGTTATTTTATGGGATGGATTCACAGGACAGAGGTCAAAGGTCTATCAGGAG
CATGAGAAGAGGTGTTGGAGTGTTGACTTTAATTTGATGGATCCTAAACTCTTGGCTTCAGGTTCTGATGATGCAAAAGTGAAGCTGTGG
TCTACCAATCTAGACAACTCAGTGGCAAGCATTGAGGCAAAGGCTAATGTGTGCTGTGTTAAATTCAGCCCCTCTTCCAGATACCATTTG
GCTTTCGGCTGTGCAGATCACTGTGTCCACTACTATGATCTTCGTAACACTAAACAGCCAATCATGGTATTCAAAGGACACCGTAAAGCA
GTCTCTTATGCAAAGTTTGTGAGTGGTGAGGAAATTGTCTCTGCCTCAACAGACAGTCAGCTAAAACTGTGGAATGTAGGGAAACCATAC
TGCCTACGTTCCTTCAAGGGTCATATCAATGAAAAAAACTTTGTAGGCCTGGCTTCCAATGGAGATTATATAGCTTGTGGAAGTGAAAAT
AACTCTCTCTACCTGTACTATAAAGGACTTTCTAAGACTTTGCTAACTTTTAAGTTTGATACAGTCAAAAGTGTTCTCGACAAAGACCGA
AAAGAAGATGATACAAATGAATTTGTTAGTGCTGTGTGCTGGAGGGCACTACCAGATGGGGAGTCCAATGTGCTGATTGCTGCTAACAGT

>In-frame_XPR1_ENST00000367589_chr1_180843078_+_RFWD2_ENST00000367669_chr1_176153828_-_3894nt
GGAGGAAGATGGCGGGCGGGCTGCTCTGAAGAGACCTCGGCGGCGGCGGAGGAGGAGAGAAGCGCAGCGCCGCGCCGCGCCGGGGCCCAT
GTGGGGAGGAGTCGGAGTCGCTGTTGCCGCCGCCGCCTGTAGCTGCTGGACCCGAGTGGGAGTGAGGGGGAAACGGCAGGATGAAGTTCG
CCGAGCACCTCTCCGCGCACATCACTCCCGAGTGGAGGAAGCAATACATCCAGTATGAGGCTTTCAAGGATATGCTGTATTCAGCTCAGG
ACCAGGCACCTTCTGTGGAAGTTACAGATGAGGACACAGTAAAGAGGTATTTTGCCAAGTTTGAAGAGAAGTTTTTCCAAACCTGTGAAA
AAGAACTTGCCAAAATCAACACATTTTATTCAGAGAAGCTCGCAGAGGCTCAGCGCAGGTTTGCTACACTTCAGAATGAGCTTCAGTCAT
CACTGGATGCACAGAAAGAAAGCACTGGTGTTACTACGCTGCGACAACGCAGAAAGCCAGTCTTCCACTTGTCCCATGAGGAACGTGTCC
AACATAGAAATATTAAAGACCTTAAACTGGCCTTCAGTGAGTTCTACCTCAGTCTAATCCTGCTGCAGAACTATCAGAATCTGAATTTTA
CAGGGTTTCGAAAAATCCTGAAAAAGCATGACAAGATCCTGGAAACATCTCGTGGAGCAGATTGGCGAGTGGCTCACGTAGAGGTGGCCC
CATTTTATACATGCAAGAAAATCAACCAGCTTATCTCTGAAACTGAGGCTGTAGTGACCAATGAACTTGAAGATGGTGACAGACAAAAGG
CTATGAAGCGTTTACGTGTCCCCCCTTTGGGAGCTGCTCAGCCTGCACCAGCATGGACTACTTTTAGAGTTGGCCTATTTTGTGGAATAT
TCATTGTACTGAATATTACCCTTGTGCTTGCCGCTGTATTTAAACTTGAAACAGATAGAAGTATATGGCCCTTGATAAGAATCTATCGGG
GTGGCTTTCTTCTGATTGAATTCCTTTTTCTACTGGGCATCAACACGTATGGTTGGAGACAGGCTGGAGTAAACCATGTACTCATCTTTG
AACTTAATCCGAGAAGCAATTTGTCTCATCAACATCTCTTTGAGATTGCTGGATTCCTCGGGATATTGTGGTGCCTGAGCCTTCTGGCAT
GCTTCTTTGCTCCAATTAGTGTCATCCCCACATATGTGTATCCACTTGCCCTTTATGGATTTATGGTTTTCTTCCTTATCAACCCCACCA
AAACTTTCTACTATAAATCCCGGTTTTGGCTGCTTAAACTGCTGTTTCGAGTATTTACAGCCCCCTTCCATAAGGTAGGCTTTGCTGATT
TCTGGCTGGCGGATCAGCTGAACAGCCTGTCAGTGATACTGATGGACCTGGAATATATGATCTGCTTCTACAGTTTGGAGCTCAAATGGG
ATGAAAGTAAGGGCCTGTTGCCAAATAATTCAGAAGAACGAGGTCACTCGGACACTATGGTGTTCTTTTACCTGTGGATTGTCTTTTATA
TCATCAGTTCCTGCTATACCCTCATCTGGGATCTCAAGATGGACTGGGGTCTCTTCGATAAGAATGCTGGAGAGAACACTTTCCTCCGGG
AAGAGATTGTATACCCCCAAAAAGCCTACTACTACTGTGCCATAATAGAGGATGTGATTCTGCGCTTTGCTTGGACTATCCAAATCTCGA
TTACCTCTACAACTTTGTTGCCTCATTCTGGGGACATCATTGCTACTGTCTTTGCCCCACTTGAGGTTTTCCGCCCCATCTGCTTTGATA
TGATTGAAGAAGCATACATGACAAAATGTGGCCACAGCTTTTGCTACAAGTGTATTCATCAGAGTTTGGAGGACAATAATAGATGTCCCA
AGTGTAACTATGTTGTGGACAATATTGACCATCTGTATCCTAATTTCTTGGTGAATGAACTCATTCTTAAACAGAAGCAAAGATTTGAGG
AAAAGAGGTTCAAATTGGACCACTCAGTGAGTAGCACCAATGGCCACAGGTGGCAGATATTTCAAGATTGGTTGGGAACTGACCAAGATA
ACCTTGATTTGGCCAATGTCAATCTTATGTTGGAGTTACTAGTGCAGAAGAAGAAACAACTGGAAGCAGAATCACATGCAGCCCAACTAC
AGATTCTTATGGAATTCCTCAAGGTTGCAAGAAGAAATAAGAGAGAGCAACTGGAACAGATCCAGAAGGAGCTAAGTGTTTTGGAAGAGG
ATATTAAGAGAGTGGAAGAAATGAGTGGCTTATACTCTCCTGTCAGTGAGGATAGCACAGTGCCTCAATTTGAAGCTCCTTCTCCATCAC
ACAGTAGTATTATTGATTCCACAGAATACAGCCAACCTCCAGGTTTCAGTGGCAGTTCTCAGACAAAGAAACAGCCTTGGTATAATAGCA
CGTTAGCATCAAGACGAAAACGACTTACTGCTCATTTTGAAGACTTGGAGCAGTGTTACTTTTCTACAAGGATGTCTCGTATCTCAGATG
ACAGTCGAACTGCAAGCCAGTTGGATGAATTTCAGGAATGCTTGTCCAAGTTTACTCGATATAATTCAGTACGACCTTTAGCCACATTGT
CATATGCTAGTGATCTCTATAATGGTTCCAGTATAGTCTCTAGTATTGAATTTGACCGGGATTGTGACTATTTTGCGATTGCTGGAGTTA
CAAAGAAGATTAAAGTCTATGAATATGACACTGTCATCCAGGATGCAGTGGATATTCATTACCCTGAGAATGAAATGACCTGCAATTCGA
AAATCAGCTGTATCAGTTGGAGTAGTTACCATAAGAACCTGTTAGCTAGCAGTGATTATGAAGGCACTGTTATTTTATGGGATGGATTCA
CAGGACAGAGGTCAAAGGTCTATCAGGAGCATGAGAAGAGGTGTTGGAGTGTTGACTTTAATTTGATGGATCCTAAACTCTTGGCTTCAG
GTTCTGATGATGCAAAAGTGAAGCTGTGGTCTACCAATCTAGACAACTCAGTGGCAAGCATTGAGGCAAAGGCTAATGTGTGCTGTGTTA
AATTCAGCCCCTCTTCCAGATACCATTTGGCTTTCGGCTGTGCAGATCACTGTGTCCACTACTATGATCTTCGTAACACTAAACAGCCAA
TCATGGTATTCAAAGGACACCGTAAAGCAGTCTCTTATGCAAAGTTTGTGAGTGGTGAGGAAATTGTCTCTGCCTCAACAGACAGTCAGC
TAAAACTGTGGAATGTAGGGAAACCATACTGCCTACGTTCCTTCAAGGGTCATATCAATGAAAAAAACTTTGTAGGCCTGGCTTCCAATG
GAGATTATATAGCTTGTGGAAGTGAAAATAACTCTCTCTACCTGTACTATAAAGGACTTTCTAAGACTTTGCTAACTTTTAAGTTTGATA
CAGTCAAAAGTGTTCTCGACAAAGACCGAAAAGAAGATGATACAAATGAATTTGTTAGTGCTGTGTGCTGGAGGGCACTACCAGATGGGG
AGTCCAATGTGCTGATTGCTGCTAACAGTCAGGGTACAATTAAGGTGCTAGAATTGGTATGAAGGGTTAACTCAAGTCAAATTGTACTTG
ATCCTGCTGAAATACATCTGCAGCTGACAATGAGAGAAGAAACAGAAAATGTCATGTGATGTCTCTCCCCAAAGTCATCATGGGTTTTGG
ATTTGTTTTGAATATTTTTTTCTTTTTTTCTTTTCCCTCCTTTATGACCTTTGGGACATTGGGAATACCCAGCCAACTCTCCACCATCAA
TGTAACTCCATGGACATTGCTGCTCTTGGTGGTGTTATCTAATTTTTGTGATAGGGAAACAAATTCTTTTGAATAAAAATAAATAACAAA

>In-frame_XPR1_ENST00000367589_chr1_180843078_+_RFWD2_ENST00000308769_chr1_176153828_-_3500nt
GGAGGAAGATGGCGGGCGGGCTGCTCTGAAGAGACCTCGGCGGCGGCGGAGGAGGAGAGAAGCGCAGCGCCGCGCCGCGCCGGGGCCCAT
GTGGGGAGGAGTCGGAGTCGCTGTTGCCGCCGCCGCCTGTAGCTGCTGGACCCGAGTGGGAGTGAGGGGGAAACGGCAGGATGAAGTTCG
CCGAGCACCTCTCCGCGCACATCACTCCCGAGTGGAGGAAGCAATACATCCAGTATGAGGCTTTCAAGGATATGCTGTATTCAGCTCAGG
ACCAGGCACCTTCTGTGGAAGTTACAGATGAGGACACAGTAAAGAGGTATTTTGCCAAGTTTGAAGAGAAGTTTTTCCAAACCTGTGAAA
AAGAACTTGCCAAAATCAACACATTTTATTCAGAGAAGCTCGCAGAGGCTCAGCGCAGGTTTGCTACACTTCAGAATGAGCTTCAGTCAT
CACTGGATGCACAGAAAGAAAGCACTGGTGTTACTACGCTGCGACAACGCAGAAAGCCAGTCTTCCACTTGTCCCATGAGGAACGTGTCC
AACATAGAAATATTAAAGACCTTAAACTGGCCTTCAGTGAGTTCTACCTCAGTCTAATCCTGCTGCAGAACTATCAGAATCTGAATTTTA
CAGGGTTTCGAAAAATCCTGAAAAAGCATGACAAGATCCTGGAAACATCTCGTGGAGCAGATTGGCGAGTGGCTCACGTAGAGGTGGCCC
CATTTTATACATGCAAGAAAATCAACCAGCTTATCTCTGAAACTGAGGCTGTAGTGACCAATGAACTTGAAGATGGTGACAGACAAAAGG
CTATGAAGCGTTTACGTGTCCCCCCTTTGGGAGCTGCTCAGCCTGCACCAGCATGGACTACTTTTAGAGTTGGCCTATTTTGTGGAATAT
TCATTGTACTGAATATTACCCTTGTGCTTGCCGCTGTATTTAAACTTGAAACAGATAGAAGTATATGGCCCTTGATAAGAATCTATCGGG
GTGGCTTTCTTCTGATTGAATTCCTTTTTCTACTGGGCATCAACACGTATGGTTGGAGACAGGCTGGAGTAAACCATGTACTCATCTTTG
AACTTAATCCGAGAAGCAATTTGTCTCATCAACATCTCTTTGAGATTGCTGGATTCCTCGGGATATTGTGGTGCCTGAGCCTTCTGGCAT
GCTTCTTTGCTCCAATTAGTGTCATCCCCACATATGTGTATCCACTTGCCCTTTATGGATTTATGGTTTTCTTCCTTATCAACCCCACCA
AAACTTTCTACTATAAATCCCGGTTTTGGCTGCTTAAACTGCTGTTTCGAGTATTTACAGCCCCCTTCCATAAGGTAGGCTTTGCTGATT
TCTGGCTGGCGGATCAGCTGAACAGCCTGTCAGTGATACTGATGGACCTGGAATATATGATCTGCTTCTACAGTTTGGAGCTCAAATGGG
ATGAAAGTAAGGGCCTGTTGCCAAATAATTCAGAAGAACGAGGTCACTCGGACACTATGGTGTTCTTTTACCTGTGGATTGTCTTTTATA
TCATCAGTTCCTGCTATACCCTCATCTGGGATCTCAAGATGGACTGGGGTCTCTTCGATAAGAATGCTGGAGAGAACACTTTCCTCCGGG
AAGAGATTGTATACCCCCAAAAAGCCTACTACTACTGTGCCATAATAGAGGATGTGATTCTGCGCTTTGCTTGGACTATCCAAATCTCGA
TTACCTCTACAACTTTGTTGCCTCATTCTGGGGACATCATTGCTACTGTCTTTGCCCCACTTGAGGTTTTCCGCCCCATCTGCTTTGATA
TGATTGAAGAAGCATACATGACAAAATGTGGCCACAGCTTTTGCTACAAGTGTATTCATCAGAGTTTGGAGGACAATAATAGATGTCCCA
AGTGTAACTATGTTGTGGACAATATTGACCATCTGTATCCTAATTTCTTGGTGAATGAACTCATTCTTAAACAGAAGCAAAGATTTGAGG
AAAAGAGGTTCAAATTGGACCACTCAAATGGCCACAGGTGGCAGATATTTCAAGATTGGTTGGGAACTGACCAAGATAACCTTGATTTGG
CCAATGTCAATCTTATGTTGGAGTTACTAGTGCAGAAGAAGAAACAACTGGAAGCAGAATCACATGCAGCCCAACTACAGATTCTTATGG
AATTCCTCAAGGTTGCAAGAAGAAATAAGAGAGAGGAAATGAGTGGCTTATACTCTCCTGTCAGTGAGGATAGCACAGTGCCTCAATTTG
AAGCTCCTTCTCCATCACACAGTAGTATTATTGATTCCACAGAATACAGCCAACCTCCAGGTTTCAGTGGCAGTTCTCAGACAAAGAAAC
AGCCTTGGTATAATAGCACGTTAGCATCAAGACGAAAACGACTTACTGCTCATTTTGAAGACTTGGAGCAGTGTTACTTTTCTACAAGGA
TGTCTCGTATCTCAGATGACAGTCGAACTGCAAGCCAGTTGGATGAATTTCAGGAATGCTTGTCCAAGTTTACTCGATATAATTCAGTAC
GACCTTTAGCCACATTGTCATATGCTAGTGATCTCTATAATGGTTCCAGTATAGTCTCTAGTATTGAATTTGACCGGGATTGTGACTATT
TTGCGATTGCTGGAGTTACAAAGAAGATTAAAGTCTATGAATATGACACTGTCATCCAGGATGCAGTGGATATTCATTACCCTGAGAATG
AAATGACCTGCAATTCGAAAATCAGCTGTATCAGTTGGAGTAGTTACCATAAGAACCTGTTAGCTAGCAGTGATTATGAAGGCACTGTTA
TTTTATGGGATGGATTCACAGGACAGAGGTCAAAGGTCTATCAGGAGCATGAGAAGAGGTGTTGGAGTGTTGACTTTAATTTGATGGATC
CTAAACTCTTGGCTTCAGGTTCTGATGATGCAAAAGTGAAGCTGTGGTCTACCAATCTAGACAACTCAGTGGCAAGCATTGAGGCAAAGG
CTAATGTGTGCTGTGTTAAATTCAGCCCCTCTTCCAGATACCATTTGGCTTTCGGCTGTGCAGATCACTGTGTCCACTACTATGATCTTC
GTAACACTAAACAGCCAATCATGGTATTCAAAGGACACCGTAAAGCAGTCTCTTATGCAAAGTTTGTGAGTGGTGAGGAAATTGTCTCTG
CCTCAACAGACAGTCAGCTAAAACTGTGGAATGTAGGGAAACCATACTGCCTACGTTCCTTCAAGGGTCATATCAATGAAAAAAACTTTG
TAGGCCTGGCTTCCAATGGAGATTATATAGCTTGTGGAAGTGAAAATAACTCTCTCTACCTGTACTATAAAGGACTTTCTAAGACTTTGC
TAACTTTTAAGTTTGATACAGTCAAAAGTGTTCTCGACAAAGACCGAAAAGAAGATGATACAAATGAATTTGTTAGTGCTGTGTGCTGGA


Top

FusionGenePPI for XPR1_RFWD2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
XPR1ELAVL1, AMOT, CEACAM21, VSIG4, TGOLN2, FAF2, NTRK1, CLTC, DBN1, GAK, KIF5B, RAB5C, RAB7A, VAPA, TACC3, GOLT1B, KIDINS220, FGFR2, VSIG1, B4GAT1, RHOT2, DKKL1, TNFRSF1A, PTGIR, APLNR, SLC15A1, CD79B, PDCD1, SLC4A2, UPK1A, RNF19B, TRIM25RFWD2DET1, DDB1, CUL4A, RBX1, JUN, RFWD2, JUND, FOXO1, CRTC2, TP53, HSPA8, HSPA6, HSPA2, CCT3, TCP1, CCT6A, CCT5, CCT8, CCT7, CCT4, CCT2, CUL4B, WDR5, COPS2, COPS8, ETV5, ETV1, ETV4, MDM2, MDM4, RCHY1, YWHAZ, YWHAB, TRIB3, ELAVL1, MVP, CUL3, LRR1, DDA1, COPS3, COPS4, COPS5, COPS6, COPS7A, COPS7B, CUL1, SKP1, CUL2, TCEB2, BTBD2, KLHL42, DDB2, ERCC8, VPRBP, DCAF11, UBE2D2, PTPN11, REG1A, RB1CC1, SFN, UBE2D1, PTPN1, PARP4, TRIB1, JUNB, ETS2, ETS1, TRIB2, ZNF397, DMC1, FOSL2, FOS, STK40, CDKN1B, ATF6, STAT3, SEPSECS, SPOP, FAM120B, PPP2R2D, AGGF1, TAX1BP1, JPH1, TSKS, NFIL3, PPP2CA, CEP164, KHDRBS2, TINAG, CCT6B, ZNF263, PNPLA2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneRFWD2chr1:180843078chr1:176153828ENST00000308769-019643_645135708TRIB1
TgeneRFWD2chr1:180843078chr1:176153828ENST00000367669-020643_645135732TRIB1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for XPR1_RFWD2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for XPR1_RFWD2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneXPR1C0004782Basal Ganglia Diseases1CTD_human
HgeneXPR1C0006663Calcinosis1CTD_human
HgeneXPR1C4225335BASAL GANGLIA CALCIFICATION, IDIOPATHIC, 61UNIPROT