FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42080

FusionGeneSummary for WRN_WDR70

check button Fusion gene summary
Fusion gene informationFusion gene name: WRN_WDR70
Fusion gene ID: 42080
HgeneTgene
Gene symbol

WRN

WDR70

Gene ID

7486

55100

Gene nameWerner syndrome RecQ like helicaseWD repeat domain 70
SynonymsRECQ3|RECQL2|RECQL3-
Cytomap

8p12

5p13.2

Type of geneprotein-codingprotein-coding
DescriptionWerner syndrome ATP-dependent helicaseDNA helicase, RecQ-like type 3Werner syndrome, RecQ helicase-likeexonuclease WRNrecQ protein-like 2WD repeat-containing protein 70
Modification date2018052320180523
UniProtAcc

Q14191

Q9NW82

Ensembl transtripts involved in fusion geneENST00000298139, ENST00000265107, 
ENST00000504564, ENST00000510699, 
Fusion gene scores* DoF score4 X 4 X 4=647 X 6 X 5=210
# samples 48
** MAII scorelog2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/210*10)=-1.39231742277876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: WRN [Title/Abstract] AND WDR70 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneWRN

GO:0000731

DNA synthesis involved in DNA repair

17563354

HgeneWRN

GO:0006259

DNA metabolic process

16622405

HgeneWRN

GO:0006284

base-excision repair

17611195

HgeneWRN

GO:0006974

cellular response to DNA damage stimulus

18203716

HgeneWRN

GO:0006979

response to oxidative stress

17611195

HgeneWRN

GO:0009267

cellular response to starvation

11420665

HgeneWRN

GO:0010225

response to UV-C

17563354

HgeneWRN

GO:0031297

replication fork processing

17115688

HgeneWRN

GO:0032508

DNA duplex unwinding

11735402|26420422

HgeneWRN

GO:0044806

G-quadruplex DNA unwinding

11735402

HgeneWRN

GO:0051345

positive regulation of hydrolase activity

17611195

HgeneWRN

GO:0061820

telomeric D-loop disassembly

15200954|19734539|26420422

HgeneWRN

GO:0071480

cellular response to gamma radiation

21639834

HgeneWRN

GO:0098530

positive regulation of strand invasion

26420422

HgeneWRN

GO:1902570

protein localization to nucleolus

11420665


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-X6-A7WC-01AWRNchr8

30941295

+WDR70chr5

37697757

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000298139ENST00000265107WRNchr8

30941295

+WDR70chr5

37697757

+
5CDS-3UTRENST00000298139ENST00000504564WRNchr8

30941295

+WDR70chr5

37697757

+
5CDS-3UTRENST00000298139ENST00000510699WRNchr8

30941295

+WDR70chr5

37697757

+

Top

FusionProtFeatures for WRN_WDR70


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
WRN

Q14191

WDR70

Q9NW82

Multifunctional enzyme that has both magnesium and ATP-dependent DNA-helicase activity and 3'->5' exonuclease activitytowards double-stranded DNA with a 5'-overhang. Has no nucleaseactivity towards single-stranded DNA or blunt-ended double-stranded DNA. Binds preferentially to DNA substrates containingalternate secondary structures, such as replication forks andHolliday junctions. May play an important role in the dissociationof joint DNA molecules that can arise as products of homologousrecombination, at stalled replication forks or during DNA repair.Alleviates stalling of DNA polymerases at the site of DNA lesions.Important for genomic integrity. Plays a role in the formation ofDNA replication focal centers; stably associates with focielements generating binding sites for RP-A (By similarity). Playsa role in double-strand break repair after gamma-irradiation.{ECO:0000250, ECO:0000269|PubMed:11863428,ECO:0000269|PubMed:17563354, ECO:0000269|PubMed:18596042,ECO:0000269|PubMed:19283071, ECO:0000269|PubMed:19652551,ECO:0000269|PubMed:21639834}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneWRNchr8:30941295chr5:37697757ENST00000298139+103560_2284501433DomainNote=3'-5' exonuclease
HgeneWRNchr8:30941295chr5:37697757ENST00000298139+1035424_4504501433Repeat1
TgeneWDR70chr8:30941295chr5:37697757ENST00000265107+918376_415364655RepeatNote=WD 5
TgeneWDR70chr8:30941295chr5:37697757ENST00000265107+918421_466364655RepeatNote=WD 6
TgeneWDR70chr8:30941295chr5:37697757ENST00000265107+918469_508364655RepeatNote=WD 7

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneWRNchr8:30941295chr5:37697757ENST00000298139+1035507_5104501433Compositional biasNote=Poly-Glu
HgeneWRNchr8:30941295chr5:37697757ENST00000298139+10351150_12294501433DomainHRDC
HgeneWRNchr8:30941295chr5:37697757ENST00000298139+1035558_7244501433DomainHelicase ATP-binding
HgeneWRNchr8:30941295chr5:37697757ENST00000298139+1035749_8994501433DomainHelicase C-terminal
HgeneWRNchr8:30941295chr5:37697757ENST00000298139+1035668_6714501433MotifNote=DEAH box
HgeneWRNchr8:30941295chr5:37697757ENST00000298139+1035571_5784501433Nucleotide bindingATP
HgeneWRNchr8:30941295chr5:37697757ENST00000298139+1035424_4774501433RegionNote=2 X 27 AA tandem repeats of H-L-S-P-N-D-N-E-N-D-T-S-Y-V-I-E-S-D-E-D-L-E-M-E-M-L-K
HgeneWRNchr8:30941295chr5:37697757ENST00000298139+1035451_4774501433Repeat2
TgeneWDR70chr8:30941295chr5:37697757ENST00000265107+918148_164364655Compositional biasNote=Glu-rich
TgeneWDR70chr8:30941295chr5:37697757ENST00000265107+91884_113364655Compositional biasNote=Ser-rich
TgeneWDR70chr8:30941295chr5:37697757ENST00000265107+918180_219364655RepeatNote=WD 1
TgeneWDR70chr8:30941295chr5:37697757ENST00000265107+918227_268364655RepeatNote=WD 2
TgeneWDR70chr8:30941295chr5:37697757ENST00000265107+918281_321364655RepeatNote=WD 3
TgeneWDR70chr8:30941295chr5:37697757ENST00000265107+918330_369364655RepeatNote=WD 4


Top

FusionGeneSequence for WRN_WDR70


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_WRN_ENST00000298139_chr8_30941295_+_WDR70_ENST00000265107_chr5_37697757_+_741aa
MSEKKLETTAQQRKCPEWMNVQNKRCAVEERKACVRKSVFEDDLPFLEFTGSIVTSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYN
RGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSL
VKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLTAATDATAGFIIYRNLEILDDTVQRFAINKEEEILLSDMNKQLTSISEEVMDLAKHLPH
AFSKLENPRRVSILLKDISENLTSLRRMIIGSTNIETELRPSNNLNLLSFEDSTTGGVQQKQIREHEVLIHVEDETWDPTLDHLAKHDGE
DVLGNKVERKEDGFEDGVEDNKLKENMERACLMSLDITEHELQILEQQSQEETLSDIATKSTEHLSPNDNENDTSTVIESDEDLEMEMLK
VHPKFHTKQAHDSGTDTSCVTFSTDGNVLASRGGDDSLKLWDIRQFNKPLFSASGLPTMFPMTDCCFSPDDKLIVTGTSIQRGCGSGKLV
FFERRTFQRVTEIDITDASVVRCLWHPKLNQIMVGTGNGLAKVTYDPNKSQRGAKLCVVKTQRKAKQAETLTQDYIITPHALPMFREPRQ
RSTRKQLEKDRLDPLKSHKPEPPVAGPGRGGRVGTHGGTLSSTIVKNIALDKTDDSNPREAILRHAKAAEDSPTWVSPATSKTQPKTMFA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_WRN_ENST00000298139_chr8_30941295_+_WDR70_ENST00000265107_chr5_37697757_+_2223nt
ATGAGTGAAAAAAAATTGGAAACAACTGCACAGCAGCGGAAATGTCCTGAATGGATGAATGTGCAGAATAAAAGATGTGCTGTAGAAGAA
AGAAAGGCATGTGTTCGGAAGAGTGTTTTTGAAGATGACCTCCCCTTCTTAGAATTCACTGGATCCATTGTGTATAGTTACGATGCTAGT
GATTGCTCTTTCCTGTCAGAAGATATTAGCATGAGTCTATCAGATGGGGATGTGGTGGGATTTGACATGGAGTGGCCACCATTATACAAT
AGAGGGAAACTTGGCAAAGTTGCACTAATTCAGTTGTGTGTTTCTGAGAGCAAATGTTACTTGTTCCACGTTTCTTCCATGTCAGTTTTT
CCCCAGGGATTAAAAATGTTGCTTGAAAATAAAGCAGTTAAAAAGGCAGGTGTAGGAATTGAAGGAGATCAGTGGAAACTTCTACGTGAC
TTTGATATCAAATTGAAGAATTTTGTGGAGTTGACAGATGTTGCCAATAAAAAGCTGAAATGCACAGAGACCTGGAGCCTTAACAGTCTG
GTTAAACACCTCTTAGGTAAACAGCTCCTGAAAGACAAGTCTATCCGCTGTAGCAATTGGAGTAAATTTCCTCTCACTGAGGACCAGAAA
CTGTATGCAGCCACTGATGCTTATGCTGGTTTTATTATTTACCGAAATTTAGAGATTTTGGATGATACTGTGCAAAGGTTTGCTATAAAT
AAAGAGGAAGAAATCCTACTTAGCGACATGAACAAACAGTTGACTTCAATCTCTGAGGAAGTGATGGATCTGGCTAAGCATCTTCCTCAT
GCTTTCAGTAAATTGGAAAACCCACGGAGGGTTTCTATCTTACTAAAGGATATTTCAGAAAATCTATATTCACTGAGGAGGATGATAATT
GGGTCTACTAACATTGAGACTGAACTGAGGCCCAGCAATAATTTAAACTTATTATCCTTTGAAGATTCAACTACTGGGGGAGTACAACAG
AAACAAATTAGAGAACATGAAGTTTTAATTCACGTTGAAGATGAAACATGGGACCCAACACTTGATCATTTAGCTAAACATGATGGAGAA
GATGTACTTGGAAATAAAGTGGAACGAAAAGAAGATGGATTTGAAGATGGAGTAGAAGACAACAAATTGAAAGAGAATATGGAAAGAGCT
TGTTTGATGTCGTTAGATATTACAGAACATGAACTCCAAATTTTGGAACAGCAGTCTCAGGAAGAATATCTTAGTGATATTGCTTATAAA
TCTACTGAGCATTTATCTCCCAATGATAATGAAAACGATACGTCCTATGTAATTGAGAGTGATGAAGATTTAGAAATGGAGATGCTTAAG
GTTCATCCTAAGTTCCACTATAAACAGGCTCATGACTCGGGCACAGACACTTCTTGCGTGACTTTTTCCTATGATGGTAATGTCCTTGCC
TCTCGTGGAGGTGACGATTCATTAAAATTATGGGACATCCGACAATTTAATAAACCACTTTTTTCAGCCTCGGGTCTTCCCACCATGTTC
CCAATGACTGACTGCTGTTTCAGTCCAGATGATAAGCTCATAGTCACTGGTACATCTATTCAAAGAGGATGTGGCAGCGGCAAACTTGTT
TTCTTTGAGCGTAGGACTTTCCAAAGGGTGTATGAAATAGACATCACAGATGCGAGTGTTGTTCGCTGCCTGTGGCATCCAAAGCTGAAC
CAGATCATGGTTGGAACTGGAAATGGATTGGCTAAAGTCTATTACGACCCCAACAAGAGTCAGAGGGGAGCAAAATTATGTGTGGTTAAA
ACCCAGCGGAAGGCAAAACAAGCTGAGACTCTAACTCAGGACTACATCATCACCCCTCATGCCTTGCCTATGTTCCGTGAGCCCCGCCAA
CGGAGTACAAGGAAACAGCTGGAGAAGGACAGACTGGATCCCCTGAAGTCGCATAAACCTGAACCTCCTGTAGCAGGCCCAGGTCGTGGT
GGCCGAGTTGGAACCCACGGGGGCACTCTCTCTTCCTATATTGTGAAGAACATTGCTTTGGACAAGACCGATGACAGTAATCCTCGGGAA
GCCATTTTGCGTCATGCCAAAGCAGCAGAAGACAGCCCATATTGGGTTTCTCCAGCATATTCCAAGACTCAGCCCAAAACCATGTTTGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_WRN_ENST00000298139_chr8_30941295_+_WDR70_ENST00000265107_chr5_37697757_+_3334nt
GGAGCTGATGTGTACTGTGTGCGCCGGGGAGGCGCCGGCTTGTACTCGGCAGCGCGGGAATAAAGTTTGCTGATTTGGTGTCTAGCCTGG
ATGCCTGGGTTGCAGGCCCTGCTTGTGGTGGCGCTCCACAGTCATCCGGCTGAAGAAGACCTGTTGGACTGGATCTTCTCGGGTTTTCTT
TCAGATATTGTTTTGTATTTACCCATGAAGACATTGTTTTTTGGACTCTGCAAATAGGACATTTCAAAGATGAGTGAAAAAAAATTGGAA
ACAACTGCACAGCAGCGGAAATGTCCTGAATGGATGAATGTGCAGAATAAAAGATGTGCTGTAGAAGAAAGAAAGGCATGTGTTCGGAAG
AGTGTTTTTGAAGATGACCTCCCCTTCTTAGAATTCACTGGATCCATTGTGTATAGTTACGATGCTAGTGATTGCTCTTTCCTGTCAGAA
GATATTAGCATGAGTCTATCAGATGGGGATGTGGTGGGATTTGACATGGAGTGGCCACCATTATACAATAGAGGGAAACTTGGCAAAGTT
GCACTAATTCAGTTGTGTGTTTCTGAGAGCAAATGTTACTTGTTCCACGTTTCTTCCATGTCAGTTTTTCCCCAGGGATTAAAAATGTTG
CTTGAAAATAAAGCAGTTAAAAAGGCAGGTGTAGGAATTGAAGGAGATCAGTGGAAACTTCTACGTGACTTTGATATCAAATTGAAGAAT
TTTGTGGAGTTGACAGATGTTGCCAATAAAAAGCTGAAATGCACAGAGACCTGGAGCCTTAACAGTCTGGTTAAACACCTCTTAGGTAAA
CAGCTCCTGAAAGACAAGTCTATCCGCTGTAGCAATTGGAGTAAATTTCCTCTCACTGAGGACCAGAAACTGTATGCAGCCACTGATGCT
TATGCTGGTTTTATTATTTACCGAAATTTAGAGATTTTGGATGATACTGTGCAAAGGTTTGCTATAAATAAAGAGGAAGAAATCCTACTT
AGCGACATGAACAAACAGTTGACTTCAATCTCTGAGGAAGTGATGGATCTGGCTAAGCATCTTCCTCATGCTTTCAGTAAATTGGAAAAC
CCACGGAGGGTTTCTATCTTACTAAAGGATATTTCAGAAAATCTATATTCACTGAGGAGGATGATAATTGGGTCTACTAACATTGAGACT
GAACTGAGGCCCAGCAATAATTTAAACTTATTATCCTTTGAAGATTCAACTACTGGGGGAGTACAACAGAAACAAATTAGAGAACATGAA
GTTTTAATTCACGTTGAAGATGAAACATGGGACCCAACACTTGATCATTTAGCTAAACATGATGGAGAAGATGTACTTGGAAATAAAGTG
GAACGAAAAGAAGATGGATTTGAAGATGGAGTAGAAGACAACAAATTGAAAGAGAATATGGAAAGAGCTTGTTTGATGTCGTTAGATATT
ACAGAACATGAACTCCAAATTTTGGAACAGCAGTCTCAGGAAGAATATCTTAGTGATATTGCTTATAAATCTACTGAGCATTTATCTCCC
AATGATAATGAAAACGATACGTCCTATGTAATTGAGAGTGATGAAGATTTAGAAATGGAGATGCTTAAGGTTCATCCTAAGTTCCACTAT
AAACAGGCTCATGACTCGGGCACAGACACTTCTTGCGTGACTTTTTCCTATGATGGTAATGTCCTTGCCTCTCGTGGAGGTGACGATTCA
TTAAAATTATGGGACATCCGACAATTTAATAAACCACTTTTTTCAGCCTCGGGTCTTCCCACCATGTTCCCAATGACTGACTGCTGTTTC
AGTCCAGATGATAAGCTCATAGTCACTGGTACATCTATTCAAAGAGGATGTGGCAGCGGCAAACTTGTTTTCTTTGAGCGTAGGACTTTC
CAAAGGGTGTATGAAATAGACATCACAGATGCGAGTGTTGTTCGCTGCCTGTGGCATCCAAAGCTGAACCAGATCATGGTTGGAACTGGA
AATGGATTGGCTAAAGTCTATTACGACCCCAACAAGAGTCAGAGGGGAGCAAAATTATGTGTGGTTAAAACCCAGCGGAAGGCAAAACAA
GCTGAGACTCTAACTCAGGACTACATCATCACCCCTCATGCCTTGCCTATGTTCCGTGAGCCCCGCCAACGGAGTACAAGGAAACAGCTG
GAGAAGGACAGACTGGATCCCCTGAAGTCGCATAAACCTGAACCTCCTGTAGCAGGCCCAGGTCGTGGTGGCCGAGTTGGAACCCACGGG
GGCACTCTCTCTTCCTATATTGTGAAGAACATTGCTTTGGACAAGACCGATGACAGTAATCCTCGGGAAGCCATTTTGCGTCATGCCAAA
GCAGCAGAAGACAGCCCATATTGGGTTTCTCCAGCATATTCCAAGACTCAGCCCAAAACCATGTTTGCCCAAGTTGAATCTGATGATGAG
GAAGCAAAGAATGAGCCAGAATGGAAAAAACGTAAAATTTGAAGAATCTCATTTGAGAGCTGTTTGCATGAGTGGGAGGGGTATGGGACA
GGTTTGGGTTTTTTTTTTATGCTCATGAAATTAAAAATTCATTTTTATGAACAGGTTTTGTCCTTTGCATTATTGAACTGGTCAAAAGTT
TGGTGGCTAGGCTTCACTAAAATTGTGCTTAAATTTTCTTACCTGCAACTATTAAACTGATTACAGATAAACAAGAAACAGATTCTTAGT
CTATTACCAAGTACTTTAGGTATTTGGAAACTTTATTCAACAATTATTGGTCTTGTCCAGATTCTCATAACCTTAGAGAGGAAAATGTAC
ATTAAGATGTGCATCTGTCTCTAGCAATTCTAGGAACATAATATAGAAATAGAGATCAAAAAGTTTAATGTTTCTGTATAATTTCACAAC
AGTTGTTTACATGACTGTAATTAATTAGGCTGAGTTCAAACCAAATACATTGCCATACTGGGAAAGAGCATTATCTCATTATCCTTCAAT
AGCAGAATACAGTGGTTAAGAGTTAGGAGTGGGCTTTGAAGTCAGACTCATGTGGATTCAAGTCCTGGCTTTGCTCTTTACTTCTGGGTC
ATCTTAAGAGAGTTATTTAACTTTTCTTTTCTAGCCTCAGATGATGAAATAGTACGTACTTTGCAGGTTCGTCAGAAGAATTAAATGGGA
CATGCCTCACAGAGCATTTAGTACAGTACCTGGAACACAGTAAATGTATACCAAATATTTGCTATTTTAAAATAGGGCTAATATTTACTT
TGCTTGGTTTTTATCAGTATTAAATTAGAAAGGTATAGAATTGCTTTGTAAATGTAAAGACTAAACAGAAGACATTAAAAATTATTCTAA


Top

FusionGenePPI for WRN_WDR70


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
WRNMDC1, TERF2, BLM, ATM, ATR, PRKDC, FEN1, PCNA, WRNIP1, POLR1C, XRCC5, XRCC6, TP53, WDR48, CHAF1A, POLB, POT1, H2AFX, NBN, DHX9, RAD51, RAD52, ATRX, RAD54B, SIRT1, WRN, PARP1, VCP, CDKN2A, CDC5L, PML, SUMO1, SUMO2, RPA1, RPA2, RPA3, CREBBP, KIAA0930, SKAP1, NTRK1, MUS81, PTTG1, TINF2, POLK, POLL, SUPT16H, ARL3, CHEK2, CHEK1, WEE1, TUBA1AWDR70WDR48, UBTF, ZC3H18, TSSC4, SIRT1, LMNA, RBPJ, NTRK1, SRPK2, XPO1, CHORDC1, CCT7, TCEANC2, CCT3, ARRB2, PRPF38A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneWRNchr8:30941295chr5:37697757ENST00000298139+10352_2774501433WRNIP1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneWRNchr8:30941295chr5:37697757ENST00000298139+1035987_9934501433DNA


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for WRN_WDR70


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for WRN_WDR70


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneWRNC0043119Werner Syndrome3CTD_human;ORPHANET;UNIPROT
HgeneWRNC0231341Premature aging syndrome1CTD_human