FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42077

FusionGeneSummary for WRN_ADAM9

check button Fusion gene summary
Fusion gene informationFusion gene name: WRN_ADAM9
Fusion gene ID: 42077
HgeneTgene
Gene symbol

WRN

ADAM9

Gene ID

7486

8754

Gene nameWerner syndrome RecQ like helicaseADAM metallopeptidase domain 9
SynonymsRECQ3|RECQL2|RECQL3CORD9|MCMP|MDC9|Mltng
Cytomap

8p12

8p11.22

Type of geneprotein-codingprotein-coding
DescriptionWerner syndrome ATP-dependent helicaseDNA helicase, RecQ-like type 3Werner syndrome, RecQ helicase-likeexonuclease WRNrecQ protein-like 2disintegrin and metalloproteinase domain-containing protein 9ADAM metallopeptidase domain 9 (meltrin gamma)cellular disintegrin-related proteincone rod dystrophy 9metalloprotease/disintegrin/cysteine-rich protein 9myeloma cell metalloproteinase
Modification date2018052320180519
UniProtAcc

Q14191

Q13443

Ensembl transtripts involved in fusion geneENST00000298139, ENST00000487273, 
ENST00000466936, ENST00000481513, 
ENST00000484143, 
Fusion gene scores* DoF score4 X 4 X 4=648 X 6 X 6=288
# samples 48
** MAII scorelog2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/288*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: WRN [Title/Abstract] AND ADAM9 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneWRN

GO:0000731

DNA synthesis involved in DNA repair

17563354

HgeneWRN

GO:0006259

DNA metabolic process

16622405

HgeneWRN

GO:0006284

base-excision repair

17611195

HgeneWRN

GO:0006974

cellular response to DNA damage stimulus

18203716

HgeneWRN

GO:0006979

response to oxidative stress

17611195

HgeneWRN

GO:0009267

cellular response to starvation

11420665

HgeneWRN

GO:0010225

response to UV-C

17563354

HgeneWRN

GO:0031297

replication fork processing

17115688

HgeneWRN

GO:0032508

DNA duplex unwinding

11735402|26420422

HgeneWRN

GO:0044806

G-quadruplex DNA unwinding

11735402

HgeneWRN

GO:0051345

positive regulation of hydrolase activity

17611195

HgeneWRN

GO:0061820

telomeric D-loop disassembly

15200954|19734539|26420422

HgeneWRN

GO:0071480

cellular response to gamma radiation

21639834

HgeneWRN

GO:0098530

positive regulation of strand invasion

26420422

HgeneWRN

GO:1902570

protein localization to nucleolus

11420665

TgeneADAM9

GO:0000186

activation of MAPKK activity

17704059

TgeneADAM9

GO:0006509

membrane protein ectodomain proteolysis

9920899

TgeneADAM9

GO:0034612

response to tumor necrosis factor

11831872

TgeneADAM9

GO:0050714

positive regulation of protein secretion

17704059


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-B6-A0I1-01AWRNchr8

30982516

+ADAM9chr8

38871484

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000298139ENST00000487273WRNchr8

30982516

+ADAM9chr8

38871484

+
In-frameENST00000298139ENST00000466936WRNchr8

30982516

+ADAM9chr8

38871484

+
Frame-shitENST00000298139ENST00000481513WRNchr8

30982516

+ADAM9chr8

38871484

+
5CDS-intronENST00000298139ENST00000484143WRNchr8

30982516

+ADAM9chr8

38871484

+

Top

FusionProtFeatures for WRN_ADAM9


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
WRN

Q14191

ADAM9

Q13443

Multifunctional enzyme that has both magnesium and ATP-dependent DNA-helicase activity and 3'->5' exonuclease activitytowards double-stranded DNA with a 5'-overhang. Has no nucleaseactivity towards single-stranded DNA or blunt-ended double-stranded DNA. Binds preferentially to DNA substrates containingalternate secondary structures, such as replication forks andHolliday junctions. May play an important role in the dissociationof joint DNA molecules that can arise as products of homologousrecombination, at stalled replication forks or during DNA repair.Alleviates stalling of DNA polymerases at the site of DNA lesions.Important for genomic integrity. Plays a role in the formation ofDNA replication focal centers; stably associates with focielements generating binding sites for RP-A (By similarity). Playsa role in double-strand break repair after gamma-irradiation.{ECO:0000250, ECO:0000269|PubMed:11863428,ECO:0000269|PubMed:17563354, ECO:0000269|PubMed:18596042,ECO:0000269|PubMed:19283071, ECO:0000269|PubMed:19652551,ECO:0000269|PubMed:21639834}. Cleaves and releases a number of molecules withimportant roles in tumorigenesis and angiogenesis, such as TEK,KDR, EPHB4, CD40, VCAM1 and CDH5. May mediate cell-cell, cell-matrix interactions and regulate the motility of cells viainteractions with integrins. {ECO:0000250|UniProtKB:Q61072}. Isoform 2: May act as alpha-secretase for amyloidprecursor protein (APP). {ECO:0000269|PubMed:12054541}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneWRNchr8:30982516chr8:38871484ENST00000298139+2335507_5109411433Compositional biasNote=Poly-Glu
HgeneWRNchr8:30982516chr8:38871484ENST00000298139+2335558_7249411433DomainHelicase ATP-binding
HgeneWRNchr8:30982516chr8:38871484ENST00000298139+233560_2289411433DomainNote=3'-5' exonuclease
HgeneWRNchr8:30982516chr8:38871484ENST00000298139+2335749_8999411433DomainHelicase C-terminal
HgeneWRNchr8:30982516chr8:38871484ENST00000298139+2335668_6719411433MotifNote=DEAH box
HgeneWRNchr8:30982516chr8:38871484ENST00000298139+2335571_5789411433Nucleotide bindingATP
HgeneWRNchr8:30982516chr8:38871484ENST00000298139+2335424_4779411433RegionNote=2 X 27 AA tandem repeats of H-L-S-P-N-D-N-E-N-D-T-S-Y-V-I-E-S-D-E-D-L-E-M-E-M-L-K
HgeneWRNchr8:30982516chr8:38871484ENST00000298139+2335424_4509411433Repeat1
HgeneWRNchr8:30982516chr8:38871484ENST00000298139+2335451_4779411433Repeat2
TgeneADAM9chr8:30982516chr8:38871484ENST00000487273+222505_63484820Compositional biasNote=Cys-rich
TgeneADAM9chr8:30982516chr8:38871484ENST00000487273+222790_79584820Compositional biasNote=Poly-Pro
TgeneADAM9chr8:30982516chr8:38871484ENST00000487273+222212_40684820DomainPeptidase M12B
TgeneADAM9chr8:30982516chr8:38871484ENST00000487273+222414_50184820DomainDisintegrin
TgeneADAM9chr8:30982516chr8:38871484ENST00000487273+222644_69884820DomainEGF-like
TgeneADAM9chr8:30982516chr8:38871484ENST00000487273+222719_81984820Topological domainCytoplasmic
TgeneADAM9chr8:30982516chr8:38871484ENST00000487273+222698_71884820TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneWRNchr8:30982516chr8:38871484ENST00000298139+23351150_12299411433DomainHRDC
TgeneADAM9chr8:30982516chr8:38871484ENST00000487273+22229_69784820Topological domainExtracellular


Top

FusionGeneSequence for WRN_ADAM9


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_WRN_ENST00000298139_chr8_30982516_+_ADAM9_ENST00000487273_chr8_38871484_+_1677aa
MSEKKLETTAQQRKCPEWMNVQNKRCAVEERKACVRKSVFEDDLPFLEFTGSIVTSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYN
RGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSL
VKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLTAATDATAGFIIYRNLEILDDTVQRFAINKEEEILLSDMNKQLTSISEEVMDLAKHLPH
AFSKLENPRRVSILLKDISENLTSLRRMIIGSTNIETELRPSNNLNLLSFEDSTTGGVQQKQIREHEVLIHVEDETWDPTLDHLAKHDGE
DVLGNKVERKEDGFEDGVEDNKLKENMERACLMSLDITEHELQILEQQSQEETLSDIATKSTEHLSPNDNENDTSTVIESDEDLEMEMLK
HLSPNDNENDTSTVIESDEDLEMEMLKSLENLNSGTVEPTHSKCLKMERNLGLPTKEEEEDDENEANEGEEDDDKDFLWPAPNEEQVTCL
KMYFGHSSFKPVQWKVIHSVLEERRDNVAVMATGTGKSLCFQTPPVTVGKIGLVISPLISLMEDQVLQLKMSNIPACFLGSAQSENVLTD
IKLGKYRIVYVTPEYCSGNMGLLQQLEADIGITLIAVDEAHCISEWGHDFRDSFRKLGSLKTALPMVPIVALTATASSSIREDIVRCLNL
RNPQITCTGFDRPNLTLEVRRKTGNILQDLQPFLVKTSSHWEFEGPTIIYCPSRKMTQQVTGELRKLNLSCGTYHAGMSFSTRKDIHHRF
VRDEIQCVIATIAFGMGINKADIRQVIHYGAPKDMESTTQEIGRAGRDGLQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKME
KTLHSSRCRRQIILSHFEDKQVQKASLGIMGTEKCCDNCRSRDLLPEDFVVTTYNKEGTLITDHPNIQNHCHTRGTVEGVHNSSIALSDC
FGLRGLLHLENASTGIEPLQNSSHFEHIITRMDDVYKEPLKCGVSNKDIEKETAKDEEEEPPSMTQLLRRRRAVLPQTRTVELFIVVDKE
RTDMMGRNQTAVREEMILLANYLDSMTIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDSAQLVLKKGFGGTA
GMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELGHNLGMNHDDGRDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGNCLL
NIPKPDEATSAPSCGNKLVDAGEECDCGTPKECELDPCCEGSTCKLKSFAECATGDCCKDCRFLPGGTLCRGKTSECDVPEYCNGSSQFC
QPDVFIQNGTPCQNNKATCYNGMCQTTDAQCQVIFGSKAKAAPKDCFIEVNSKGDRFGNCGFSGNEYKKCATGNALCGKLQCENVQEIPV
FGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCGAGKICRNFQCVDASVLNTDCDVQKKCHGHGVCNSNKNCHCENGWAPPNC
ETKGYGGSVDSGPTYNEMNTALRDGLLVFFFLIVPLIVCAIFIFIKRDQLWRSYFRKKRSQTTESDGKNQANPSRQPGSVPRHVSPVTPP

>In-frame_WRN_ENST00000298139_chr8_30982516_+_ADAM9_ENST00000466936_chr8_38871484_+_1005aa
MSEKKLETTAQQRKCPEWMNVQNKRCAVEERKACVRKSVFEDDLPFLEFTGSIVTSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYN
RGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSL
VKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLTAATDATAGFIIYRNLEILDDTVQRFAINKEEEILLSDMNKQLTSISEEVMDLAKHLPH
AFSKLENPRRVSILLKDISENLTSLRRMIIGSTNIETELRPSNNLNLLSFEDSTTGGVQQKQIREHEVLIHVEDETWDPTLDHLAKHDGE
DVLGNKVERKEDGFEDGVEDNKLKENMERACLMSLDITEHELQILEQQSQEETLSDIATKSTEHLSPNDNENDTSTVIESDEDLEMEMLK
HLSPNDNENDTSTVIESDEDLEMEMLKSLENLNSGTVEPTHSKCLKMERNLGLPTKEEEEDDENEANEGEEDDDKDFLWPAPNEEQVTCL
KMYFGHSSFKPVQWKVIHSVLEERRDNVAVMATGTGKSLCFQTPPVTVGKIGLVISPLISLMEDQVLQLKMSNIPACFLGSAQSENVLTD
IKLGKYRIVYVTPEYCSGNMGLLQQLEADIGITLIAVDEAHCISEWGHDFRDSFRKLGSLKTALPMVPIVALTATASSSIREDIVRCLNL
RNPQITCTGFDRPNLTLEVRRKTGNILQDLQPFLVKTSSHWEFEGPTIIYCPSRKMTQQVTGELRKLNLSCGTYHAGMSFSTRKDIHHRF
VRDEIQCVIATIAFGMGINKADIRQVIHYGAPKDMESTTQEIGRAGRDGLQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKME
KTLHSSRCRRQIILSHFEDKQVQKASLGIMGTEKCCDNCRSRDLLPEDFVVTTYNKEGTLITDHPNIQRCGPLCIREQSTPGDRAGQNTQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_WRN_ENST00000298139_chr8_30982516_+_ADAM9_ENST00000487273_chr8_38871484_+_5031nt
ATGAGTGAAAAAAAATTGGAAACAACTGCACAGCAGCGGAAATGTCCTGAATGGATGAATGTGCAGAATAAAAGATGTGCTGTAGAAGAA
AGAAAGGCATGTGTTCGGAAGAGTGTTTTTGAAGATGACCTCCCCTTCTTAGAATTCACTGGATCCATTGTGTATAGTTACGATGCTAGT
GATTGCTCTTTCCTGTCAGAAGATATTAGCATGAGTCTATCAGATGGGGATGTGGTGGGATTTGACATGGAGTGGCCACCATTATACAAT
AGAGGGAAACTTGGCAAAGTTGCACTAATTCAGTTGTGTGTTTCTGAGAGCAAATGTTACTTGTTCCACGTTTCTTCCATGTCAGTTTTT
CCCCAGGGATTAAAAATGTTGCTTGAAAATAAAGCAGTTAAAAAGGCAGGTGTAGGAATTGAAGGAGATCAGTGGAAACTTCTACGTGAC
TTTGATATCAAATTGAAGAATTTTGTGGAGTTGACAGATGTTGCCAATAAAAAGCTGAAATGCACAGAGACCTGGAGCCTTAACAGTCTG
GTTAAACACCTCTTAGGTAAACAGCTCCTGAAAGACAAGTCTATCCGCTGTAGCAATTGGAGTAAATTTCCTCTCACTGAGGACCAGAAA
CTGTATGCAGCCACTGATGCTTATGCTGGTTTTATTATTTACCGAAATTTAGAGATTTTGGATGATACTGTGCAAAGGTTTGCTATAAAT
AAAGAGGAAGAAATCCTACTTAGCGACATGAACAAACAGTTGACTTCAATCTCTGAGGAAGTGATGGATCTGGCTAAGCATCTTCCTCAT
GCTTTCAGTAAATTGGAAAACCCACGGAGGGTTTCTATCTTACTAAAGGATATTTCAGAAAATCTATATTCACTGAGGAGGATGATAATT
GGGTCTACTAACATTGAGACTGAACTGAGGCCCAGCAATAATTTAAACTTATTATCCTTTGAAGATTCAACTACTGGGGGAGTACAACAG
AAACAAATTAGAGAACATGAAGTTTTAATTCACGTTGAAGATGAAACATGGGACCCAACACTTGATCATTTAGCTAAACATGATGGAGAA
GATGTACTTGGAAATAAAGTGGAACGAAAAGAAGATGGATTTGAAGATGGAGTAGAAGACAACAAATTGAAAGAGAATATGGAAAGAGCT
TGTTTGATGTCGTTAGATATTACAGAACATGAACTCCAAATTTTGGAACAGCAGTCTCAGGAAGAATATCTTAGTGATATTGCTTATAAA
TCTACTGAGCATTTATCTCCCAATGATAATGAAAACGATACGTCCTATGTAATTGAGAGTGATGAAGATTTAGAAATGGAGATGCTTAAG
CATTTATCTCCCAATGATAATGAAAACGATACGTCCTATGTAATTGAGAGTGATGAAGATTTAGAAATGGAGATGCTTAAGTCTTTAGAA
AACCTCAATAGTGGCACGGTAGAACCAACTCATTCTAAATGCTTAAAAATGGAAAGAAATCTGGGTCTTCCTACTAAAGAAGAAGAAGAA
GATGATGAAAATGAAGCTAATGAAGGGGAAGAAGATGATGATAAGGACTTTTTGTGGCCAGCACCCAATGAAGAGCAAGTTACTTGCCTC
AAGATGTACTTTGGCCATTCCAGTTTTAAACCAGTTCAGTGGAAAGTGATTCATTCAGTATTAGAAGAAAGAAGAGATAATGTTGCTGTC
ATGGCAACTGGATATGGAAAGAGTTTGTGCTTCCAGTATCCACCTGTTTATGTAGGCAAGATTGGCCTTGTTATCTCTCCCCTTATTTCT
CTGATGGAAGACCAAGTGCTACAGCTTAAAATGTCCAACATCCCAGCTTGCTTCCTTGGATCAGCACAGTCAGAAAATGTTCTAACAGAT
ATTAAATTAGGTAAATACCGGATTGTATACGTAACTCCAGAATACTGTTCAGGTAACATGGGCCTGCTCCAGCAACTTGAGGCTGATATT
GGTATCACGCTCATTGCTGTGGATGAGGCTCACTGTATTTCTGAGTGGGGGCATGATTTTAGGGATTCATTCAGGAAGTTGGGCTCCCTA
AAGACAGCACTGCCAATGGTTCCAATCGTTGCACTTACTGCTACTGCAAGTTCTTCAATCCGGGAAGACATTGTACGTTGCTTAAATCTG
AGAAATCCTCAGATCACCTGTACTGGTTTTGATCGACCAAACCTGTATTTAGAAGTTAGGCGAAAAACAGGGAATATCCTTCAGGATCTG
CAGCCATTTCTTGTCAAAACAAGTTCCCACTGGGAATTTGAAGGTCCAACAATCATCTACTGTCCTTCTAGAAAAATGACACAACAAGTT
ACAGGTGAACTTAGGAAACTGAATCTATCCTGTGGAACATACCATGCGGGCATGAGTTTTAGCACAAGGAAAGACATTCATCATAGGTTT
GTAAGAGATGAAATTCAGTGTGTCATAGCTACCATAGCTTTTGGAATGGGCATTAATAAAGCTGACATTCGCCAAGTCATTCATTACGGT
GCTCCTAAGGACATGGAATCATATTATCAGGAGATTGGTAGAGCTGGTCGTGATGGACTTCAAAGTTCTTGTCACGTCCTCTGGGCTCCT
GCAGACATTAACTTAAATAGGCACCTTCTTACTGAGATACGTAATGAGAAGTTTCGATTATACAAATTAAAGATGATGGCAAAGATGGAA
AAATATCTTCATTCTAGCAGATGTAGGAGACAAATCATCTTGTCTCATTTTGAGGACAAACAAGTACAAAAAGCCTCCTTGGGAATTATG
GGAACTGAAAAATGCTGTGATAATTGCAGGTCCAGAGACCTTTTGCCTGAAGATTTTGTGGTTTATACTTACAACAAGGAAGGGACTTTA
ATCACTGACCATCCCAATATACAGAATCATTGTCATTATCGGGGCTATGTGGAGGGAGTTCATAATTCATCCATTGCTCTTAGCGACTGT
TTTGGACTCAGAGGATTGCTGCATTTAGAGAATGCGAGTTATGGGATTGAACCCCTGCAGAACAGCTCTCATTTTGAGCACATCATTTAT
CGAATGGATGATGTCTACAAAGAGCCTCTGAAATGTGGAGTTTCCAACAAGGATATAGAGAAAGAAACTGCAAAGGATGAAGAGGAAGAG
CCTCCCAGCATGACTCAGCTACTTCGAAGAAGAAGAGCTGTCTTGCCACAGACCCGGTATGTGGAGCTGTTCATTGTCGTAGACAAGGAA
AGGTATGACATGATGGGAAGAAATCAGACTGCTGTGAGAGAAGAGATGATTCTCCTGGCAAACTACTTGGATAGTATGTATATTATGTTA
AATATTCGAATTGTGCTAGTTGGACTGGAGATTTGGACCAATGGAAACCTGATCAACATAGTTGGGGGTGCTGGTGATGTGCTGGGGAAC
TTCGTGCAGTGGCGGGAAAAGTTTCTTATCACACGTCGGAGACATGACAGTGCACAGCTAGTTCTAAAGAAAGGTTTTGGTGGAACTGCA
GGAATGGCATTTGTGGGAACAGTGTGTTCAAGGAGCCACGCAGGCGGGATTAATGTGTTTGGACAAATCACTGTGGAGACATTTGCTTCC
ATTGTTGCTCATGAATTGGGTCATAATCTTGGAATGAATCACGATGATGGGAGAGATTGTTCCTGTGGAGCAAAGAGCTGCATCATGAAT
TCAGGAGCATCGGGTTCCAGAAACTTTAGCAGTTGCAGTGCAGAGGACTTTGAGAAGTTAACTTTAAATAAAGGAGGAAACTGCCTTCTT
AATATTCCAAAGCCTGATGAAGCCTATAGTGCTCCCTCCTGTGGTAATAAGTTGGTGGACGCTGGGGAAGAGTGTGACTGTGGTACTCCA
AAGGAATGTGAATTGGACCCTTGCTGCGAAGGAAGTACCTGTAAGCTTAAATCATTTGCTGAGTGTGCATATGGTGACTGTTGTAAAGAC
TGTCGGTTCCTTCCAGGAGGTACTTTATGCCGAGGAAAAACCAGTGAGTGTGATGTTCCAGAGTACTGCAATGGTTCTTCTCAGTTCTGT
CAGCCAGATGTTTTTATTCAGAATGGATATCCTTGCCAGAATAACAAAGCCTATTGCTACAACGGCATGTGCCAGTATTATGATGCTCAA
TGTCAAGTCATCTTTGGCTCAAAAGCCAAGGCTGCCCCCAAAGATTGTTTCATTGAAGTGAATTCTAAAGGTGACAGATTTGGCAATTGT
GGTTTCTCTGGCAATGAATACAAGAAGTGTGCCACTGGGAATGCTTTGTGTGGAAAGCTTCAGTGTGAGAATGTACAAGAGATACCTGTA
TTTGGAATTGTGCCTGCTATTATTCAAACGCCTAGTCGAGGCACCAAATGTTGGGGTGTGGATTTCCAGCTAGGATCAGATGTTCCAGAT
CCTGGGATGGTTAACGAAGGCACAAAATGTGGTGCTGGAAAGATCTGTAGAAACTTCCAGTGTGTAGATGCTTCTGTTCTGAATTATGAC
TGTGATGTTCAGAAAAAGTGTCATGGACATGGGGTATGTAATAGCAATAAGAATTGTCACTGTGAAAATGGCTGGGCTCCCCCAAATTGT
GAGACTAAAGGATACGGAGGAAGTGTGGACAGTGGACCTACATACAATGAAATGAATACTGCATTGAGGGACGGACTTCTGGTCTTCTTC
TTCCTAATTGTTCCCCTTATTGTCTGTGCTATTTTTATCTTCATCAAGAGGGATCAACTGTGGAGAAGCTACTTCAGAAAGAAGAGATCA
CAAACATATGAGTCAGATGGCAAAAATCAAGCAAACCCTTCTAGACAGCCGGGGAGTGTTCCTCGACATGTTTCTCCAGTGACACCTCCC
AGAGAAGTTCCTATATATGCAAACAGATTTGCAGTACCAACCTATGCAGCCAAGCAACCTCAGCAGTTCCCATCAAGGCCACCTCCACCA

>In-frame_WRN_ENST00000298139_chr8_30982516_+_ADAM9_ENST00000466936_chr8_38871484_+_3015nt
ATGAGTGAAAAAAAATTGGAAACAACTGCACAGCAGCGGAAATGTCCTGAATGGATGAATGTGCAGAATAAAAGATGTGCTGTAGAAGAA
AGAAAGGCATGTGTTCGGAAGAGTGTTTTTGAAGATGACCTCCCCTTCTTAGAATTCACTGGATCCATTGTGTATAGTTACGATGCTAGT
GATTGCTCTTTCCTGTCAGAAGATATTAGCATGAGTCTATCAGATGGGGATGTGGTGGGATTTGACATGGAGTGGCCACCATTATACAAT
AGAGGGAAACTTGGCAAAGTTGCACTAATTCAGTTGTGTGTTTCTGAGAGCAAATGTTACTTGTTCCACGTTTCTTCCATGTCAGTTTTT
CCCCAGGGATTAAAAATGTTGCTTGAAAATAAAGCAGTTAAAAAGGCAGGTGTAGGAATTGAAGGAGATCAGTGGAAACTTCTACGTGAC
TTTGATATCAAATTGAAGAATTTTGTGGAGTTGACAGATGTTGCCAATAAAAAGCTGAAATGCACAGAGACCTGGAGCCTTAACAGTCTG
GTTAAACACCTCTTAGGTAAACAGCTCCTGAAAGACAAGTCTATCCGCTGTAGCAATTGGAGTAAATTTCCTCTCACTGAGGACCAGAAA
CTGTATGCAGCCACTGATGCTTATGCTGGTTTTATTATTTACCGAAATTTAGAGATTTTGGATGATACTGTGCAAAGGTTTGCTATAAAT
AAAGAGGAAGAAATCCTACTTAGCGACATGAACAAACAGTTGACTTCAATCTCTGAGGAAGTGATGGATCTGGCTAAGCATCTTCCTCAT
GCTTTCAGTAAATTGGAAAACCCACGGAGGGTTTCTATCTTACTAAAGGATATTTCAGAAAATCTATATTCACTGAGGAGGATGATAATT
GGGTCTACTAACATTGAGACTGAACTGAGGCCCAGCAATAATTTAAACTTATTATCCTTTGAAGATTCAACTACTGGGGGAGTACAACAG
AAACAAATTAGAGAACATGAAGTTTTAATTCACGTTGAAGATGAAACATGGGACCCAACACTTGATCATTTAGCTAAACATGATGGAGAA
GATGTACTTGGAAATAAAGTGGAACGAAAAGAAGATGGATTTGAAGATGGAGTAGAAGACAACAAATTGAAAGAGAATATGGAAAGAGCT
TGTTTGATGTCGTTAGATATTACAGAACATGAACTCCAAATTTTGGAACAGCAGTCTCAGGAAGAATATCTTAGTGATATTGCTTATAAA
TCTACTGAGCATTTATCTCCCAATGATAATGAAAACGATACGTCCTATGTAATTGAGAGTGATGAAGATTTAGAAATGGAGATGCTTAAG
CATTTATCTCCCAATGATAATGAAAACGATACGTCCTATGTAATTGAGAGTGATGAAGATTTAGAAATGGAGATGCTTAAGTCTTTAGAA
AACCTCAATAGTGGCACGGTAGAACCAACTCATTCTAAATGCTTAAAAATGGAAAGAAATCTGGGTCTTCCTACTAAAGAAGAAGAAGAA
GATGATGAAAATGAAGCTAATGAAGGGGAAGAAGATGATGATAAGGACTTTTTGTGGCCAGCACCCAATGAAGAGCAAGTTACTTGCCTC
AAGATGTACTTTGGCCATTCCAGTTTTAAACCAGTTCAGTGGAAAGTGATTCATTCAGTATTAGAAGAAAGAAGAGATAATGTTGCTGTC
ATGGCAACTGGATATGGAAAGAGTTTGTGCTTCCAGTATCCACCTGTTTATGTAGGCAAGATTGGCCTTGTTATCTCTCCCCTTATTTCT
CTGATGGAAGACCAAGTGCTACAGCTTAAAATGTCCAACATCCCAGCTTGCTTCCTTGGATCAGCACAGTCAGAAAATGTTCTAACAGAT
ATTAAATTAGGTAAATACCGGATTGTATACGTAACTCCAGAATACTGTTCAGGTAACATGGGCCTGCTCCAGCAACTTGAGGCTGATATT
GGTATCACGCTCATTGCTGTGGATGAGGCTCACTGTATTTCTGAGTGGGGGCATGATTTTAGGGATTCATTCAGGAAGTTGGGCTCCCTA
AAGACAGCACTGCCAATGGTTCCAATCGTTGCACTTACTGCTACTGCAAGTTCTTCAATCCGGGAAGACATTGTACGTTGCTTAAATCTG
AGAAATCCTCAGATCACCTGTACTGGTTTTGATCGACCAAACCTGTATTTAGAAGTTAGGCGAAAAACAGGGAATATCCTTCAGGATCTG
CAGCCATTTCTTGTCAAAACAAGTTCCCACTGGGAATTTGAAGGTCCAACAATCATCTACTGTCCTTCTAGAAAAATGACACAACAAGTT
ACAGGTGAACTTAGGAAACTGAATCTATCCTGTGGAACATACCATGCGGGCATGAGTTTTAGCACAAGGAAAGACATTCATCATAGGTTT
GTAAGAGATGAAATTCAGTGTGTCATAGCTACCATAGCTTTTGGAATGGGCATTAATAAAGCTGACATTCGCCAAGTCATTCATTACGGT
GCTCCTAAGGACATGGAATCATATTATCAGGAGATTGGTAGAGCTGGTCGTGATGGACTTCAAAGTTCTTGTCACGTCCTCTGGGCTCCT
GCAGACATTAACTTAAATAGGCACCTTCTTACTGAGATACGTAATGAGAAGTTTCGATTATACAAATTAAAGATGATGGCAAAGATGGAA
AAATATCTTCATTCTAGCAGATGTAGGAGACAAATCATCTTGTCTCATTTTGAGGACAAACAAGTACAAAAAGCCTCCTTGGGAATTATG
GGAACTGAAAAATGCTGTGATAATTGCAGGTCCAGAGACCTTTTGCCTGAAGATTTTGTGGTTTATACTTACAACAAGGAAGGGACTTTA
ATCACTGACCATCCCAATATACAGAGGTGTGGTCCTCTCTGCATCAGAGAACAGAGTACTCCTGGGGACAGAGCTGGCCAGAATACCCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_WRN_ENST00000298139_chr8_30982516_+_ADAM9_ENST00000487273_chr8_38871484_+_6581nt
GGAGCTGATGTGTACTGTGTGCGCCGGGGAGGCGCCGGCTTGTACTCGGCAGCGCGGGAATAAAGTTTGCTGATTTGGTGTCTAGCCTGG
ATGCCTGGGTTGCAGGCCCTGCTTGTGGTGGCGCTCCACAGTCATCCGGCTGAAGAAGACCTGTTGGACTGGATCTTCTCGGGTTTTCTT
TCAGATATTGTTTTGTATTTACCCATGAAGACATTGTTTTTTGGACTCTGCAAATAGGACATTTCAAAGATGAGTGAAAAAAAATTGGAA
ACAACTGCACAGCAGCGGAAATGTCCTGAATGGATGAATGTGCAGAATAAAAGATGTGCTGTAGAAGAAAGAAAGGCATGTGTTCGGAAG
AGTGTTTTTGAAGATGACCTCCCCTTCTTAGAATTCACTGGATCCATTGTGTATAGTTACGATGCTAGTGATTGCTCTTTCCTGTCAGAA
GATATTAGCATGAGTCTATCAGATGGGGATGTGGTGGGATTTGACATGGAGTGGCCACCATTATACAATAGAGGGAAACTTGGCAAAGTT
GCACTAATTCAGTTGTGTGTTTCTGAGAGCAAATGTTACTTGTTCCACGTTTCTTCCATGTCAGTTTTTCCCCAGGGATTAAAAATGTTG
CTTGAAAATAAAGCAGTTAAAAAGGCAGGTGTAGGAATTGAAGGAGATCAGTGGAAACTTCTACGTGACTTTGATATCAAATTGAAGAAT
TTTGTGGAGTTGACAGATGTTGCCAATAAAAAGCTGAAATGCACAGAGACCTGGAGCCTTAACAGTCTGGTTAAACACCTCTTAGGTAAA
CAGCTCCTGAAAGACAAGTCTATCCGCTGTAGCAATTGGAGTAAATTTCCTCTCACTGAGGACCAGAAACTGTATGCAGCCACTGATGCT
TATGCTGGTTTTATTATTTACCGAAATTTAGAGATTTTGGATGATACTGTGCAAAGGTTTGCTATAAATAAAGAGGAAGAAATCCTACTT
AGCGACATGAACAAACAGTTGACTTCAATCTCTGAGGAAGTGATGGATCTGGCTAAGCATCTTCCTCATGCTTTCAGTAAATTGGAAAAC
CCACGGAGGGTTTCTATCTTACTAAAGGATATTTCAGAAAATCTATATTCACTGAGGAGGATGATAATTGGGTCTACTAACATTGAGACT
GAACTGAGGCCCAGCAATAATTTAAACTTATTATCCTTTGAAGATTCAACTACTGGGGGAGTACAACAGAAACAAATTAGAGAACATGAA
GTTTTAATTCACGTTGAAGATGAAACATGGGACCCAACACTTGATCATTTAGCTAAACATGATGGAGAAGATGTACTTGGAAATAAAGTG
GAACGAAAAGAAGATGGATTTGAAGATGGAGTAGAAGACAACAAATTGAAAGAGAATATGGAAAGAGCTTGTTTGATGTCGTTAGATATT
ACAGAACATGAACTCCAAATTTTGGAACAGCAGTCTCAGGAAGAATATCTTAGTGATATTGCTTATAAATCTACTGAGCATTTATCTCCC
AATGATAATGAAAACGATACGTCCTATGTAATTGAGAGTGATGAAGATTTAGAAATGGAGATGCTTAAGCATTTATCTCCCAATGATAAT
GAAAACGATACGTCCTATGTAATTGAGAGTGATGAAGATTTAGAAATGGAGATGCTTAAGTCTTTAGAAAACCTCAATAGTGGCACGGTA
GAACCAACTCATTCTAAATGCTTAAAAATGGAAAGAAATCTGGGTCTTCCTACTAAAGAAGAAGAAGAAGATGATGAAAATGAAGCTAAT
GAAGGGGAAGAAGATGATGATAAGGACTTTTTGTGGCCAGCACCCAATGAAGAGCAAGTTACTTGCCTCAAGATGTACTTTGGCCATTCC
AGTTTTAAACCAGTTCAGTGGAAAGTGATTCATTCAGTATTAGAAGAAAGAAGAGATAATGTTGCTGTCATGGCAACTGGATATGGAAAG
AGTTTGTGCTTCCAGTATCCACCTGTTTATGTAGGCAAGATTGGCCTTGTTATCTCTCCCCTTATTTCTCTGATGGAAGACCAAGTGCTA
CAGCTTAAAATGTCCAACATCCCAGCTTGCTTCCTTGGATCAGCACAGTCAGAAAATGTTCTAACAGATATTAAATTAGGTAAATACCGG
ATTGTATACGTAACTCCAGAATACTGTTCAGGTAACATGGGCCTGCTCCAGCAACTTGAGGCTGATATTGGTATCACGCTCATTGCTGTG
GATGAGGCTCACTGTATTTCTGAGTGGGGGCATGATTTTAGGGATTCATTCAGGAAGTTGGGCTCCCTAAAGACAGCACTGCCAATGGTT
CCAATCGTTGCACTTACTGCTACTGCAAGTTCTTCAATCCGGGAAGACATTGTACGTTGCTTAAATCTGAGAAATCCTCAGATCACCTGT
ACTGGTTTTGATCGACCAAACCTGTATTTAGAAGTTAGGCGAAAAACAGGGAATATCCTTCAGGATCTGCAGCCATTTCTTGTCAAAACA
AGTTCCCACTGGGAATTTGAAGGTCCAACAATCATCTACTGTCCTTCTAGAAAAATGACACAACAAGTTACAGGTGAACTTAGGAAACTG
AATCTATCCTGTGGAACATACCATGCGGGCATGAGTTTTAGCACAAGGAAAGACATTCATCATAGGTTTGTAAGAGATGAAATTCAGTGT
GTCATAGCTACCATAGCTTTTGGAATGGGCATTAATAAAGCTGACATTCGCCAAGTCATTCATTACGGTGCTCCTAAGGACATGGAATCA
TATTATCAGGAGATTGGTAGAGCTGGTCGTGATGGACTTCAAAGTTCTTGTCACGTCCTCTGGGCTCCTGCAGACATTAACTTAAATAGG
CACCTTCTTACTGAGATACGTAATGAGAAGTTTCGATTATACAAATTAAAGATGATGGCAAAGATGGAAAAATATCTTCATTCTAGCAGA
TGTAGGAGACAAATCATCTTGTCTCATTTTGAGGACAAACAAGTACAAAAAGCCTCCTTGGGAATTATGGGAACTGAAAAATGCTGTGAT
AATTGCAGGTCCAGAGACCTTTTGCCTGAAGATTTTGTGGTTTATACTTACAACAAGGAAGGGACTTTAATCACTGACCATCCCAATATA
CAGAATCATTGTCATTATCGGGGCTATGTGGAGGGAGTTCATAATTCATCCATTGCTCTTAGCGACTGTTTTGGACTCAGAGGATTGCTG
CATTTAGAGAATGCGAGTTATGGGATTGAACCCCTGCAGAACAGCTCTCATTTTGAGCACATCATTTATCGAATGGATGATGTCTACAAA
GAGCCTCTGAAATGTGGAGTTTCCAACAAGGATATAGAGAAAGAAACTGCAAAGGATGAAGAGGAAGAGCCTCCCAGCATGACTCAGCTA
CTTCGAAGAAGAAGAGCTGTCTTGCCACAGACCCGGTATGTGGAGCTGTTCATTGTCGTAGACAAGGAAAGGTATGACATGATGGGAAGA
AATCAGACTGCTGTGAGAGAAGAGATGATTCTCCTGGCAAACTACTTGGATAGTATGTATATTATGTTAAATATTCGAATTGTGCTAGTT
GGACTGGAGATTTGGACCAATGGAAACCTGATCAACATAGTTGGGGGTGCTGGTGATGTGCTGGGGAACTTCGTGCAGTGGCGGGAAAAG
TTTCTTATCACACGTCGGAGACATGACAGTGCACAGCTAGTTCTAAAGAAAGGTTTTGGTGGAACTGCAGGAATGGCATTTGTGGGAACA
GTGTGTTCAAGGAGCCACGCAGGCGGGATTAATGTGTTTGGACAAATCACTGTGGAGACATTTGCTTCCATTGTTGCTCATGAATTGGGT
CATAATCTTGGAATGAATCACGATGATGGGAGAGATTGTTCCTGTGGAGCAAAGAGCTGCATCATGAATTCAGGAGCATCGGGTTCCAGA
AACTTTAGCAGTTGCAGTGCAGAGGACTTTGAGAAGTTAACTTTAAATAAAGGAGGAAACTGCCTTCTTAATATTCCAAAGCCTGATGAA
GCCTATAGTGCTCCCTCCTGTGGTAATAAGTTGGTGGACGCTGGGGAAGAGTGTGACTGTGGTACTCCAAAGGAATGTGAATTGGACCCT
TGCTGCGAAGGAAGTACCTGTAAGCTTAAATCATTTGCTGAGTGTGCATATGGTGACTGTTGTAAAGACTGTCGGTTCCTTCCAGGAGGT
ACTTTATGCCGAGGAAAAACCAGTGAGTGTGATGTTCCAGAGTACTGCAATGGTTCTTCTCAGTTCTGTCAGCCAGATGTTTTTATTCAG
AATGGATATCCTTGCCAGAATAACAAAGCCTATTGCTACAACGGCATGTGCCAGTATTATGATGCTCAATGTCAAGTCATCTTTGGCTCA
AAAGCCAAGGCTGCCCCCAAAGATTGTTTCATTGAAGTGAATTCTAAAGGTGACAGATTTGGCAATTGTGGTTTCTCTGGCAATGAATAC
AAGAAGTGTGCCACTGGGAATGCTTTGTGTGGAAAGCTTCAGTGTGAGAATGTACAAGAGATACCTGTATTTGGAATTGTGCCTGCTATT
ATTCAAACGCCTAGTCGAGGCACCAAATGTTGGGGTGTGGATTTCCAGCTAGGATCAGATGTTCCAGATCCTGGGATGGTTAACGAAGGC
ACAAAATGTGGTGCTGGAAAGATCTGTAGAAACTTCCAGTGTGTAGATGCTTCTGTTCTGAATTATGACTGTGATGTTCAGAAAAAGTGT
CATGGACATGGGGTATGTAATAGCAATAAGAATTGTCACTGTGAAAATGGCTGGGCTCCCCCAAATTGTGAGACTAAAGGATACGGAGGA
AGTGTGGACAGTGGACCTACATACAATGAAATGAATACTGCATTGAGGGACGGACTTCTGGTCTTCTTCTTCCTAATTGTTCCCCTTATT
GTCTGTGCTATTTTTATCTTCATCAAGAGGGATCAACTGTGGAGAAGCTACTTCAGAAAGAAGAGATCACAAACATATGAGTCAGATGGC
AAAAATCAAGCAAACCCTTCTAGACAGCCGGGGAGTGTTCCTCGACATGTTTCTCCAGTGACACCTCCCAGAGAAGTTCCTATATATGCA
AACAGATTTGCAGTACCAACCTATGCAGCCAAGCAACCTCAGCAGTTCCCATCAAGGCCACCTCCACCACAACCGAAAGTATCATCTCAG
GGAAACTTAATTCCTGCCCGTCCTGCTCCTGCACCTCCTTTATATAGTTCCCTCACTTGATTTTTTTAACCTTCTTTTTGCAAATGTCTT
CAGGGAACTGAGCTAATACTTTTTTTTTTTCTTGATGTTTTCTTGAAAAGCCTTTCTGTTGCAACTATGAATGAAAACAAAACACCACAA
AACAGACTTCACTAACACAGAAAAACAGAAACTGAGTGTGAGAGTTGTGAAATACAAGGAAATGCAGTAAAGCCAGGGAATTTACAATAA
CATTTCCGTTTCCATCATTGAATAAGTCTTATTCAGTCATCGGTGAGGTTAATGCACTAATCATGGATTTTTTGAACATGTTATTGCAGT
GATTCTCAAATTAACTGTATTGGTGTAAGAGTTTTGTCATTAAGTGTTTAAGTGTTATTCTGAATTTTCTACCTTAGTTATCATTAATGT
AGTTCCTCATTGAACATGTGATAATCTAATACCTGTGAAAACTGACTAATCAGCTGCCAATAATATCTAATATTTTTCATCATGCACGAA
TTAATAATCATCATACTCTAGAATCTTGTCTGTCACTCACTACATGAATAAGCAAATATTGTCTTCAAAAGAATGCACAAGAACCACAAT
TAAGATGTCATATTATTTTGAAAGTACAAAATATACTAAAAGAGTGTGTGTGTATTCACGCAGTTACTCGCTTCCATTTTTATGACCTTT
CAACTATAGGTAATAACTCTTAGAGAAATTAATTTAATATTAGAATTTCTATTATGAATCATGTGAAAGCATGACATTCGTTCACAATAG
CACTATTTTAAATAAATTATAAGCTTTAAGGTACGAAGTATTTAATAGATCTAATCAAATATGTTGATTCATGGCTATAATAAAGCAGGA
GCAATTATAAAATCTTCAATCAATTGAACTTTTACAAAACCACTTGAGAATTTCATGAGCACTTTAAAATCTGAACTTTCAAAGCTTGCT
ATTAAATCATTTAGAATGTTTACATTTACTAAGGTGTGCTGGGTCATGTAAAATATTAGACACTAATATTTTCATAGAAATTAGGCTGGA
GAAAGAAGGAAGAAATGGTTTTCTTAAATACCTACAAAAAAGTTACTGTGGTATCTATGAGTTATCATCTTAGCTGTGTTAAAAATGAAT
TTTTACTATGGCAGATATGGTATGGATCGTAAAATTTTAAGCACTAAAAATTTTTTCATAACCTTTCATAATAAAGTTTAATAATAGGTT
TATTAACTGAATTTCATTAGTTTTTTAAAAGTGTTTTTGGTTTGTGTATATATACATATACAAATACAACATTTACAATAAATAAAATAC

>In-frame_WRN_ENST00000298139_chr8_30982516_+_ADAM9_ENST00000466936_chr8_38871484_+_4678nt
GGAGCTGATGTGTACTGTGTGCGCCGGGGAGGCGCCGGCTTGTACTCGGCAGCGCGGGAATAAAGTTTGCTGATTTGGTGTCTAGCCTGG
ATGCCTGGGTTGCAGGCCCTGCTTGTGGTGGCGCTCCACAGTCATCCGGCTGAAGAAGACCTGTTGGACTGGATCTTCTCGGGTTTTCTT
TCAGATATTGTTTTGTATTTACCCATGAAGACATTGTTTTTTGGACTCTGCAAATAGGACATTTCAAAGATGAGTGAAAAAAAATTGGAA
ACAACTGCACAGCAGCGGAAATGTCCTGAATGGATGAATGTGCAGAATAAAAGATGTGCTGTAGAAGAAAGAAAGGCATGTGTTCGGAAG
AGTGTTTTTGAAGATGACCTCCCCTTCTTAGAATTCACTGGATCCATTGTGTATAGTTACGATGCTAGTGATTGCTCTTTCCTGTCAGAA
GATATTAGCATGAGTCTATCAGATGGGGATGTGGTGGGATTTGACATGGAGTGGCCACCATTATACAATAGAGGGAAACTTGGCAAAGTT
GCACTAATTCAGTTGTGTGTTTCTGAGAGCAAATGTTACTTGTTCCACGTTTCTTCCATGTCAGTTTTTCCCCAGGGATTAAAAATGTTG
CTTGAAAATAAAGCAGTTAAAAAGGCAGGTGTAGGAATTGAAGGAGATCAGTGGAAACTTCTACGTGACTTTGATATCAAATTGAAGAAT
TTTGTGGAGTTGACAGATGTTGCCAATAAAAAGCTGAAATGCACAGAGACCTGGAGCCTTAACAGTCTGGTTAAACACCTCTTAGGTAAA
CAGCTCCTGAAAGACAAGTCTATCCGCTGTAGCAATTGGAGTAAATTTCCTCTCACTGAGGACCAGAAACTGTATGCAGCCACTGATGCT
TATGCTGGTTTTATTATTTACCGAAATTTAGAGATTTTGGATGATACTGTGCAAAGGTTTGCTATAAATAAAGAGGAAGAAATCCTACTT
AGCGACATGAACAAACAGTTGACTTCAATCTCTGAGGAAGTGATGGATCTGGCTAAGCATCTTCCTCATGCTTTCAGTAAATTGGAAAAC
CCACGGAGGGTTTCTATCTTACTAAAGGATATTTCAGAAAATCTATATTCACTGAGGAGGATGATAATTGGGTCTACTAACATTGAGACT
GAACTGAGGCCCAGCAATAATTTAAACTTATTATCCTTTGAAGATTCAACTACTGGGGGAGTACAACAGAAACAAATTAGAGAACATGAA
GTTTTAATTCACGTTGAAGATGAAACATGGGACCCAACACTTGATCATTTAGCTAAACATGATGGAGAAGATGTACTTGGAAATAAAGTG
GAACGAAAAGAAGATGGATTTGAAGATGGAGTAGAAGACAACAAATTGAAAGAGAATATGGAAAGAGCTTGTTTGATGTCGTTAGATATT
ACAGAACATGAACTCCAAATTTTGGAACAGCAGTCTCAGGAAGAATATCTTAGTGATATTGCTTATAAATCTACTGAGCATTTATCTCCC
AATGATAATGAAAACGATACGTCCTATGTAATTGAGAGTGATGAAGATTTAGAAATGGAGATGCTTAAGCATTTATCTCCCAATGATAAT
GAAAACGATACGTCCTATGTAATTGAGAGTGATGAAGATTTAGAAATGGAGATGCTTAAGTCTTTAGAAAACCTCAATAGTGGCACGGTA
GAACCAACTCATTCTAAATGCTTAAAAATGGAAAGAAATCTGGGTCTTCCTACTAAAGAAGAAGAAGAAGATGATGAAAATGAAGCTAAT
GAAGGGGAAGAAGATGATGATAAGGACTTTTTGTGGCCAGCACCCAATGAAGAGCAAGTTACTTGCCTCAAGATGTACTTTGGCCATTCC
AGTTTTAAACCAGTTCAGTGGAAAGTGATTCATTCAGTATTAGAAGAAAGAAGAGATAATGTTGCTGTCATGGCAACTGGATATGGAAAG
AGTTTGTGCTTCCAGTATCCACCTGTTTATGTAGGCAAGATTGGCCTTGTTATCTCTCCCCTTATTTCTCTGATGGAAGACCAAGTGCTA
CAGCTTAAAATGTCCAACATCCCAGCTTGCTTCCTTGGATCAGCACAGTCAGAAAATGTTCTAACAGATATTAAATTAGGTAAATACCGG
ATTGTATACGTAACTCCAGAATACTGTTCAGGTAACATGGGCCTGCTCCAGCAACTTGAGGCTGATATTGGTATCACGCTCATTGCTGTG
GATGAGGCTCACTGTATTTCTGAGTGGGGGCATGATTTTAGGGATTCATTCAGGAAGTTGGGCTCCCTAAAGACAGCACTGCCAATGGTT
CCAATCGTTGCACTTACTGCTACTGCAAGTTCTTCAATCCGGGAAGACATTGTACGTTGCTTAAATCTGAGAAATCCTCAGATCACCTGT
ACTGGTTTTGATCGACCAAACCTGTATTTAGAAGTTAGGCGAAAAACAGGGAATATCCTTCAGGATCTGCAGCCATTTCTTGTCAAAACA
AGTTCCCACTGGGAATTTGAAGGTCCAACAATCATCTACTGTCCTTCTAGAAAAATGACACAACAAGTTACAGGTGAACTTAGGAAACTG
AATCTATCCTGTGGAACATACCATGCGGGCATGAGTTTTAGCACAAGGAAAGACATTCATCATAGGTTTGTAAGAGATGAAATTCAGTGT
GTCATAGCTACCATAGCTTTTGGAATGGGCATTAATAAAGCTGACATTCGCCAAGTCATTCATTACGGTGCTCCTAAGGACATGGAATCA
TATTATCAGGAGATTGGTAGAGCTGGTCGTGATGGACTTCAAAGTTCTTGTCACGTCCTCTGGGCTCCTGCAGACATTAACTTAAATAGG
CACCTTCTTACTGAGATACGTAATGAGAAGTTTCGATTATACAAATTAAAGATGATGGCAAAGATGGAAAAATATCTTCATTCTAGCAGA
TGTAGGAGACAAATCATCTTGTCTCATTTTGAGGACAAACAAGTACAAAAAGCCTCCTTGGGAATTATGGGAACTGAAAAATGCTGTGAT
AATTGCAGGTCCAGAGACCTTTTGCCTGAAGATTTTGTGGTTTATACTTACAACAAGGAAGGGACTTTAATCACTGACCATCCCAATATA
CAGAGGTGTGGTCCTCTCTGCATCAGAGAACAGAGTACTCCTGGGGACAGAGCTGGCCAGAATACCCAAAATAATTGGCAGATGTCAAAT
TTGGCTTTCTGTGTTTATTACTAGAGCATAAACATTTCTAGTTTTGTTTGAGTGTTTTACAGTCCTTTTTGGCAGTTAGGTATTATACCT
TTTTTTCTTTTGCAATGGTTTTCATGAGAAATCTTTATTCCCATTACATGTGTATGTTTTATTTTTCTTCTGAACTTTGTAATACTTTGC
TATGTTGAATTGTTTCTGTTGGTAGCGCACTTTTGCAGCATTCTTCAAATAGGAGGCAAAAAAATCTTTAGATTAATTATTAGTACTTAC
AAAAACCAAGGAAATGCTGACTTAGGCCTATCTTCTGGTCCACTATCTGATTTCTTTATCTTAGTGTGTTGTTGGTCCATTGTTTAATAG
AAAATTAGTAGAGGAGTTTGAATTTACCTTACAGCATAAACCAGATAGAAAATAACGCATTCATCCAGTCATGCATCCAATGATTACCAA
GGCAGAAGGCCAAACACCACATAATTTGTGTCACTTGACAAAAGCAGTAATGTTAAAAGGCATTTTTTTCCTCATAGAGGTTTCTTGGCA
TACTTTCTTCAGACATACACTGTTTGGGCTTGAGTTTTGACTCATTATTTGCTGATGAAGCTACTTTAATCTGTTTGTGCCTTGGTATCT
TCGCTTTAAAATGTAATAATAGTTACCACTTTATGGATATACTGGGAAACTTAACTGAGTTAATACTTACAAGATGCTTAGAACAGTCTG
ACAATTTTTAACTCAACGAATGTTATTATTTGTTGCTATTATTGACAGCGTATGTTCTTAAAACTGCCAAAAATTGATTTAATTATATAG
AAACTTATGTAACTATTATCTTATATAATACTTAAGTATCATAAGTATGATAGAGTTATGCTTTTCTGGGTGTTTGAAAAATGTCAACTA
AGACAGATGGTGTCTCACTTATTTCTTGGTTATTTAATATTGTTCAGTTAGATGAAAGTGTGATTGTAGATTTGAAATACAAAATAAAAC
TTGGATACTGTGATTTTTTTAACATGGCCAGACTGTCATGTATTATAATGACATATACTTTTGTCCATAAAATGAAATTAAGTTTCACTG
AAAAATTTACATACTTTCCCCTGGGGATTCTATTGCTTCAGATTAAAGTTTATAAAGTATCATTAGTGTCTTCCACAGGGTCATTTTACA
CAAACACAGTTTTAGTGAGATGTCAACTGGCTTTTGTTGGTTGTTGGATTGACTGTGATTTAAAATGTTAAAGATGATATAATGCATCTT
GTTCTGCTTCTAGGCTGAAAGGTCACTGAGGCAGAGCTGTTTGTACCTTGTATCCCCTGGAATTTTGCCTAAACATTTGTGTACTCATAG


Top

FusionGenePPI for WRN_ADAM9


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
WRNMDC1, TERF2, BLM, ATM, ATR, PRKDC, FEN1, PCNA, WRNIP1, POLR1C, XRCC5, XRCC6, TP53, WDR48, CHAF1A, POLB, POT1, H2AFX, NBN, DHX9, RAD51, RAD52, ATRX, RAD54B, SIRT1, WRN, PARP1, VCP, CDKN2A, CDC5L, PML, SUMO1, SUMO2, RPA1, RPA2, RPA3, CREBBP, KIAA0930, SKAP1, NTRK1, MUS81, PTTG1, TINF2, POLK, POLL, SUPT16H, ARL3, CHEK2, CHEK1, WEE1, TUBA1AADAM9MAD2L2, SH3GL2, SNX9, PRKCD, CDH1, RNF2, CD1B, FIGF, TMEM25, PTPRK, GPHA2, CLPSL1, NUDC, KIF2C, ITGAV, ITGB5, SCGB1D4, ADAM32, LYZL2, INSL5, SLAMF1, LYZL1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneWRNchr8:30982516chr8:38871484ENST00000298139+23352_2779411433WRNIP1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneWRNchr8:30982516chr8:38871484ENST00000298139+2335987_9939411433DNA


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for WRN_ADAM9


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for WRN_ADAM9


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneWRNC0043119Werner Syndrome3CTD_human;ORPHANET;UNIPROT
HgeneWRNC0231341Premature aging syndrome1CTD_human
TgeneADAM9C0033578Prostatic Neoplasms1CTD_human