FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42073

FusionGeneSummary for WRB_ERG

check button Fusion gene summary
Fusion gene informationFusion gene name: WRB_ERG
Fusion gene ID: 42073
HgeneTgene
Gene symbol

WRB

ERG

Gene ID

7485

2078

Gene nametryptophan rich basic proteinERG, ETS transcription factor
SynonymsCHD5|GET1erg-3|p55
Cytomap

21q22.2

21q22.2

Type of geneprotein-codingprotein-coding
Descriptiontail-anchored protein insertion receptor WRBcongenital heart disease 5 proteintranscriptional regulator ERGFUS/ERG fusion proteinTMPRSS2/ERG fusionerythroblast transformation-specific transcription factor ERG variant 10ets-relatedtranscriptional regulator ERG (transforming protein ERG)v-ets avian erythroblastosis virus E26 on
Modification date2018051920180523
UniProtAcc

O00258

P11308

Ensembl transtripts involved in fusion geneENST00000333781, ENST00000541890, 
ENST00000398753, ENST00000380708, 
ENST00000466787, 
ENST00000398907, 
ENST00000398905, ENST00000288319, 
ENST00000398897, ENST00000398911, 
ENST00000398910, ENST00000417133, 
ENST00000442448, ENST00000453032, 
ENST00000398919, ENST00000429727, 
ENST00000485493, 
Fusion gene scores* DoF score4 X 3 X 4=4813 X 15 X 8=1560
# samples 4226
** MAII scorelog2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(226/1560*10)=0.53477674355294
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: WRB [Title/Abstract] AND ERG [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneERG

GO:0045944

positive regulation of transcription by RNA polymerase II

18195090|23913826


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPAADTCGA-3E-AAAY-01AWRBchr21

40752412

+ERGchr21

39817544

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000333781ENST00000398907WRBchr21

40752412

+ERGchr21

39817544

-
In-frameENST00000333781ENST00000398905WRBchr21

40752412

+ERGchr21

39817544

-
In-frameENST00000333781ENST00000288319WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000333781ENST00000398897WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000333781ENST00000398911WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000333781ENST00000398910WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000333781ENST00000417133WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000333781ENST00000442448WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000333781ENST00000453032WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000333781ENST00000398919WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000333781ENST00000429727WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000333781ENST00000485493WRBchr21

40752412

+ERGchr21

39817544

-
In-frameENST00000541890ENST00000398907WRBchr21

40752412

+ERGchr21

39817544

-
In-frameENST00000541890ENST00000398905WRBchr21

40752412

+ERGchr21

39817544

-
In-frameENST00000541890ENST00000288319WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000541890ENST00000398897WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000541890ENST00000398911WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000541890ENST00000398910WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000541890ENST00000417133WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000541890ENST00000442448WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000541890ENST00000453032WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000541890ENST00000398919WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000541890ENST00000429727WRBchr21

40752412

+ERGchr21

39817544

-
5CDS-intronENST00000541890ENST00000485493WRBchr21

40752412

+ERGchr21

39817544

-
5UTR-3CDSENST00000398753ENST00000398907WRBchr21

40752412

+ERGchr21

39817544

-
5UTR-3CDSENST00000398753ENST00000398905WRBchr21

40752412

+ERGchr21

39817544

-
5UTR-3CDSENST00000398753ENST00000288319WRBchr21

40752412

+ERGchr21

39817544

-
5UTR-intronENST00000398753ENST00000398897WRBchr21

40752412

+ERGchr21

39817544

-
5UTR-intronENST00000398753ENST00000398911WRBchr21

40752412

+ERGchr21

39817544

-
5UTR-intronENST00000398753ENST00000398910WRBchr21

40752412

+ERGchr21

39817544

-
5UTR-intronENST00000398753ENST00000417133WRBchr21

40752412

+ERGchr21

39817544

-
5UTR-intronENST00000398753ENST00000442448WRBchr21

40752412

+ERGchr21

39817544

-
5UTR-intronENST00000398753ENST00000453032WRBchr21

40752412

+ERGchr21

39817544

-
5UTR-intronENST00000398753ENST00000398919WRBchr21

40752412

+ERGchr21

39817544

-
5UTR-intronENST00000398753ENST00000429727WRBchr21

40752412

+ERGchr21

39817544

-
5UTR-intronENST00000398753ENST00000485493WRBchr21

40752412

+ERGchr21

39817544

-
intron-3CDSENST00000380708ENST00000398907WRBchr21

40752412

+ERGchr21

39817544

-
intron-3CDSENST00000380708ENST00000398905WRBchr21

40752412

+ERGchr21

39817544

-
intron-3CDSENST00000380708ENST00000288319WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000380708ENST00000398897WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000380708ENST00000398911WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000380708ENST00000398910WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000380708ENST00000417133WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000380708ENST00000442448WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000380708ENST00000453032WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000380708ENST00000398919WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000380708ENST00000429727WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000380708ENST00000485493WRBchr21

40752412

+ERGchr21

39817544

-
intron-3CDSENST00000466787ENST00000398907WRBchr21

40752412

+ERGchr21

39817544

-
intron-3CDSENST00000466787ENST00000398905WRBchr21

40752412

+ERGchr21

39817544

-
intron-3CDSENST00000466787ENST00000288319WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000466787ENST00000398897WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000466787ENST00000398911WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000466787ENST00000398910WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000466787ENST00000417133WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000466787ENST00000442448WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000466787ENST00000453032WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000466787ENST00000398919WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000466787ENST00000429727WRBchr21

40752412

+ERGchr21

39817544

-
intron-intronENST00000466787ENST00000485493WRBchr21

40752412

+ERGchr21

39817544

-

Top

FusionProtFeatures for WRB_ERG


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
WRB

O00258

ERG

P11308

Receptor for ASNA1/TRC40-mediated insertion of tail-anchored (TA) proteins into the ER membrane.{ECO:0000269|PubMed:21444755}. Transcriptional regulator. May participate intranscriptional regulation through the recruitment of SETDB1histone methyltransferase and subsequent modification of localchromatin structure.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneWRBchr21:40752412chr21:39817544ENST00000333781+151_834175Topological domainLumenal
HgeneWRBchr21:40752412chr21:39817544ENST00000333781+159_2934175TransmembraneHelical
TgeneERGchr21:40752412chr21:39817544ENST00000288319-010318_3986480DNA bindingETS
TgeneERGchr21:40752412chr21:39817544ENST00000398897-09318_398-61364DNA bindingETS
TgeneERGchr21:40752412chr21:39817544ENST00000398911-110318_39813463DNA bindingETS
TgeneERGchr21:40752412chr21:39817544ENST00000398919-212318_39813487DNA bindingETS
TgeneERGchr21:40752412chr21:39817544ENST00000417133-212318_39813487DNA bindingETS
TgeneERGchr21:40752412chr21:39817544ENST00000442448-211318_39813463DNA bindingETS
TgeneERGchr21:40752412chr21:39817544ENST00000453032-09318_398-52388DNA bindingETS
TgeneERGchr21:40752412chr21:39817544ENST00000288319-010120_2066480DomainPNT
TgeneERGchr21:40752412chr21:39817544ENST00000398897-09120_206-61364DomainPNT
TgeneERGchr21:40752412chr21:39817544ENST00000398911-110120_20613463DomainPNT
TgeneERGchr21:40752412chr21:39817544ENST00000398919-212120_20613487DomainPNT
TgeneERGchr21:40752412chr21:39817544ENST00000417133-212120_20613487DomainPNT
TgeneERGchr21:40752412chr21:39817544ENST00000442448-211120_20613463DomainPNT
TgeneERGchr21:40752412chr21:39817544ENST00000453032-09120_206-52388DomainPNT

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneWRBchr21:40752412chr21:39817544ENST00000333781+1539_9434175Coiled coilOntology_term=ECO:0000255
HgeneWRBchr21:40752412chr21:39817544ENST00000380708+1539_94-31141Coiled coilOntology_term=ECO:0000255
HgeneWRBchr21:40752412chr21:39817544ENST00000398753+1539_94-33141Coiled coilOntology_term=ECO:0000255
HgeneWRBchr21:40752412chr21:39817544ENST00000333781+15121_14834175Topological domainLumenal
HgeneWRBchr21:40752412chr21:39817544ENST00000333781+15170_17434175Topological domainCytoplasmic
HgeneWRBchr21:40752412chr21:39817544ENST00000333781+1530_9934175Topological domainCytoplasmic
HgeneWRBchr21:40752412chr21:39817544ENST00000380708+15121_148-31141Topological domainLumenal
HgeneWRBchr21:40752412chr21:39817544ENST00000380708+15170_174-31141Topological domainCytoplasmic
HgeneWRBchr21:40752412chr21:39817544ENST00000380708+151_8-31141Topological domainLumenal
HgeneWRBchr21:40752412chr21:39817544ENST00000380708+1530_99-31141Topological domainCytoplasmic
HgeneWRBchr21:40752412chr21:39817544ENST00000398753+15121_148-33141Topological domainLumenal
HgeneWRBchr21:40752412chr21:39817544ENST00000398753+15170_174-33141Topological domainCytoplasmic
HgeneWRBchr21:40752412chr21:39817544ENST00000398753+151_8-33141Topological domainLumenal
HgeneWRBchr21:40752412chr21:39817544ENST00000398753+1530_99-33141Topological domainCytoplasmic
HgeneWRBchr21:40752412chr21:39817544ENST00000333781+15100_12034175TransmembraneHelical
HgeneWRBchr21:40752412chr21:39817544ENST00000333781+15149_16934175TransmembraneHelical
HgeneWRBchr21:40752412chr21:39817544ENST00000380708+15100_120-31141TransmembraneHelical
HgeneWRBchr21:40752412chr21:39817544ENST00000380708+15149_169-31141TransmembraneHelical
HgeneWRBchr21:40752412chr21:39817544ENST00000380708+159_29-31141TransmembraneHelical
HgeneWRBchr21:40752412chr21:39817544ENST00000398753+15100_120-33141TransmembraneHelical
HgeneWRBchr21:40752412chr21:39817544ENST00000398753+15149_169-33141TransmembraneHelical
HgeneWRBchr21:40752412chr21:39817544ENST00000398753+159_29-33141TransmembraneHelical


Top

FusionGeneSequence for WRB_ERG


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_WRB_ENST00000333781_chr21_40752412_+_ERG_ENST00000398907_chr21_39817544_-_485aa
MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPA
RVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGL
PDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQ
RITTRPAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERK
SKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSF

>In-frame_WRB_ENST00000333781_chr21_40752412_+_ERG_ENST00000398905_chr21_39817544_-_484aa
MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPA
RVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGL
PDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTDLPTEPPRRSAWTGHGHP
TPQSKAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKS
KPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFF

>In-frame_WRB_ENST00000333781_chr21_40752412_+_ERG_ENST00000288319_chr21_39817544_-_508aa
MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPA
RVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGL
PDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQ
RITTRPDLPTEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITW
EGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTH

>In-frame_WRB_ENST00000541890_chr21_40752412_+_ERG_ENST00000398907_chr21_39817544_-_485aa
MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPA
RVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGL
PDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQ
RITTRPAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERK
SKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSF

>In-frame_WRB_ENST00000541890_chr21_40752412_+_ERG_ENST00000398905_chr21_39817544_-_484aa
MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPA
RVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGL
PDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTDLPTEPPRRSAWTGHGHP
TPQSKAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKS
KPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTHAHPQKMNFVAPHPPALPVTSSSFF

>In-frame_WRB_ENST00000541890_chr21_40752412_+_ERG_ENST00000288319_chr21_39817544_-_508aa
MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDTGQTSKMSPRVPQQDWLSQPPA
RVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKETGL
PDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVTPEATQ
RITTRPDLPTEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPTQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITW
EGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSTH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_WRB_ENST00000333781_chr21_40752412_+_ERG_ENST00000398907_chr21_39817544_-_1455nt
ATGAGCTCAGCCGCGGCCGACCACTGGGCGTGGTTGCTGGTGCTCAGCTTCGTGTTTGGATGCAATGTTCTTAGGATCCTCCTCCCGTCC
TTCTCATCCTTCGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAG
ATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCC
AGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAG
ATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAG
CGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTT
CCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGC
TACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTA
CAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAA
AGAATTACAACTAGGCCAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATT
CTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCC
AACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAG
AGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGC
TACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTC
CCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTT
TTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTG

>In-frame_WRB_ENST00000333781_chr21_40752412_+_ERG_ENST00000398905_chr21_39817544_-_1452nt
ATGAGCTCAGCCGCGGCCGACCACTGGGCGTGGTTGCTGGTGCTCAGCTTCGTGTTTGGATGCAATGTTCTTAGGATCCTCCTCCCGTCC
TTCTCATCCTTCGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAG
ATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCC
AGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAG
ATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAG
CGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTT
CCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGC
TACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTA
CAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCC
ACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTT
GGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAAC
TCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGC
AAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTAC
GCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCG
TACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTT
GCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGC

>In-frame_WRB_ENST00000333781_chr21_40752412_+_ERG_ENST00000288319_chr21_39817544_-_1524nt
ATGAGCTCAGCCGCGGCCGACCACTGGGCGTGGTTGCTGGTGCTCAGCTTCGTGTTTGGATGCAATGTTCTTAGGATCCTCCTCCCGTCC
TTCTCATCCTTCGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAG
ATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCC
AGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAG
ATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAG
CGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTT
CCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGC
TACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTA
CAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAA
AGAATTACAACTAGGCCAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCT
GCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGC
CTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGG
GAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTAC
GATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTC
CACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCAC
GCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATAC

>In-frame_WRB_ENST00000541890_chr21_40752412_+_ERG_ENST00000398907_chr21_39817544_-_1455nt
ATGAGCTCAGCCGCGGCCGACCACTGGGCGTGGTTGCTGGTGCTCAGCTTCGTGTTTGGATGCAATGTTCTTAGGATCCTCCTCCCGTCC
TTCTCATCCTTCGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAG
ATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCC
AGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAG
ATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAG
CGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTT
CCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGC
TACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTA
CAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAA
AGAATTACAACTAGGCCAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATT
CTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCC
AACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAG
AGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGC
TACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTC
CCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTT
TTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTG

>In-frame_WRB_ENST00000541890_chr21_40752412_+_ERG_ENST00000398905_chr21_39817544_-_1452nt
ATGAGCTCAGCCGCGGCCGACCACTGGGCGTGGTTGCTGGTGCTCAGCTTCGTGTTTGGATGCAATGTTCTTAGGATCCTCCTCCCGTCC
TTCTCATCCTTCGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAG
ATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCC
AGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAG
ATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAG
CGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTT
CCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGC
TACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTA
CAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCC
ACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTT
GGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAAC
TCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGC
AAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTAC
GCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCG
TACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTT
GCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGC

>In-frame_WRB_ENST00000541890_chr21_40752412_+_ERG_ENST00000288319_chr21_39817544_-_1524nt
ATGAGCTCAGCCGCGGCCGACCACTGGGCGTGGTTGCTGGTGCTCAGCTTCGTGTTTGGATGCAATGTTCTTAGGATCCTCCTCCCGTCC
TTCTCATCCTTCGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAG
ATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCC
AGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAG
ATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAG
CGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTT
CCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGC
TACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTA
CAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAA
AGAATTACAACTAGGCCAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCT
GCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGC
CTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGG
GAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTAC
GATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTC
CACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCAC
GCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_WRB_ENST00000333781_chr21_40752412_+_ERG_ENST00000398907_chr21_39817544_-_4972nt
CGCGAGGGCGACGCAGTTCGCAGGCGCGTCGGCGCGCCTGTTCTGGGGCGCTTGGCTTCACCGCGCAGGCGCGGTCGCCGCTGTTGTTGT
GGTCCCCATGGAGCTGCCGTAGCGGACCCAGCACAGCCAGGAGCGTCCGGGATGAGCTCAGCCGCGGCCGACCACTGGGCGTGGTTGCTG
GTGCTCAGCTTCGTGTTTGGATGCAATGTTCTTAGGATCCTCCTCCCGTCCTTCTCATCCTTCGAAGCCTTATCAGTTGTGAGTGAGGAC
CAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCC
AAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTG
AATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGC
AGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGT
ACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGG
AAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTC
AGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGG
GGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGCTGCTCAACCATCTCCTTCC
ACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGT
GGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAG
TTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCC
CTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCC
CTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATG
AACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGG
GGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCAT
CAGCGTGCATTCACCAGCCCATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGG
GCTGGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAAT
GTCACGAATATGGACATATCATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGA
AAGTGGTCTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACA
CAGTTTTGACCTAACATACCGTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAG
ACACGAGAGAGACTGTGGCCCATCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTG
ATGGACAGCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTG
GGACTGAGGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGC
TGGGAAAGAAACTTCTCAAGCAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCA
GTCAGTGTTATACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCA
TCTCTTTCTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCT
TTGTTCTCCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTT
TCCTTTGAGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTA
TGCATTTATACACTACGAGTTGATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCT
GTATGCTTAATGTTTACAATATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAG
ATTTATACAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATA
ATTTACTTTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTT
GCCTCCCCTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATG
GAAAGAGGCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAA
TACATTTGTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCT
CACTTTACAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTA
CATCAGAGTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCA
TAATCTAGAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAA
ATACAAGGTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTG
TTTTTTTCACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCG
GCAGGACACGATTACCAATGCTCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAG
GCCCACAAAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGA
AAAGATCAGTCATTTTTATTTTGGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGT
TCTCTCTTCAAGACTGTCTCATGAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCC
TCAACCCTCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAA
ATACATAATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATA
ATTGCATGAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGC
AAGAGATTTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTG
TTCCTAGTTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAG
CCTTCTGCACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCT
CAGGAGCTGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAA
TATTTTTTAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAAAATTACTTTG

>In-frame_WRB_ENST00000333781_chr21_40752412_+_ERG_ENST00000398905_chr21_39817544_-_4969nt
CGCGAGGGCGACGCAGTTCGCAGGCGCGTCGGCGCGCCTGTTCTGGGGCGCTTGGCTTCACCGCGCAGGCGCGGTCGCCGCTGTTGTTGT
GGTCCCCATGGAGCTGCCGTAGCGGACCCAGCACAGCCAGGAGCGTCCGGGATGAGCTCAGCCGCGGCCGACCACTGGGCGTGGTTGCTG
GTGCTCAGCTTCGTGTTTGGATGCAATGTTCTTAGGATCCTCCTCCCGTCCTTCTCATCCTTCGAAGCCTTATCAGTTGTGAGTGAGGAC
CAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCC
AAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTG
AATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGC
AGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGT
ACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGG
AAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTC
AGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGAT
TTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACA
GTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGC
CAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTC
AAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTC
CGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTC
CAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAAC
TTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGT
ATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAG
CGTGCATTCACCAGCCCATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCT
GGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTC
ACGAATATGGACATATCATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAG
TGGTCTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAG
TTTTGACCTAACATACCGTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACA
CGAGAGAGACTGTGGCCCATCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATG
GACAGCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGA
CTGAGGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGG
GAAAGAAACTTCTCAAGCAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTC
AGTGTTATACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCT
CTTTCTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTG
TTCTCCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCC
TTTGAGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGC
ATTTATACACTACGAGTTGATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTA
TGCTTAATGTTTACAATATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATT
TATACAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATT
TACTTTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCC
TCCCCTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAA
AGAGGCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATAC
ATTTGTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCAC
TTTACAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACAT
CAGAGTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAA
TCTAGAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATA
CAAGGTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTT
TTTTCACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCA
GGACACGATTACCAATGCTCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCC
CACAAAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAA
GATCAGTCATTTTTATTTTGGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCT
CTCTTCAAGACTGTCTCATGAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCA
ACCCTCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATA
CATAATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATT
GCATGAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAG
AGATTTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTC
CTAGTTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCT
TCTGCACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAG
GAGCTGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATAT
TTTTTAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAAAATTACTTTGGAC

>In-frame_WRB_ENST00000333781_chr21_40752412_+_ERG_ENST00000288319_chr21_39817544_-_5041nt
CGCGAGGGCGACGCAGTTCGCAGGCGCGTCGGCGCGCCTGTTCTGGGGCGCTTGGCTTCACCGCGCAGGCGCGGTCGCCGCTGTTGTTGT
GGTCCCCATGGAGCTGCCGTAGCGGACCCAGCACAGCCAGGAGCGTCCGGGATGAGCTCAGCCGCGGCCGACCACTGGGCGTGGTTGCTG
GTGCTCAGCTTCGTGTTTGGATGCAATGTTCTTAGGATCCTCCTCCCGTCCTTCTCATCCTTCGAAGCCTTATCAGTTGTGAGTGAGGAC
CAGTCGTTGTTTGAGTGTGCCTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCC
AAGATGAGCCCACGCGTCCCTCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTG
AATGGCTCAAGGAACTCTCCTGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGC
AGCTACATGGAGGAGAAGCACATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGT
ACAGACCATGTGCGGCAGTGGCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGG
AAGGAACTGTGCAAGATGACCAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTC
AGAGAGACTCCTCTTCCACATTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGG
GGTGCAGCTTTTATTTTCCCAAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGATTTACCATATGAGCCCCCC
AGGAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGAC
CAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAG
TTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGAC
GAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAG
AACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAG
TCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCT
CCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGG
CTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCA
TCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGA
AGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCA
TCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTAT
AAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCG
TTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCC
ATCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCT
CAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAG
TGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGC
AATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCA
GTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAA
TGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGT
AAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTG
TGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTT
GATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATA
TGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATT
TGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTT
GTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTAT
TTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGG
GGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAAC
AAGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGAT
AACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACT
GTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCT
GGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAG
GCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCT
TTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGC
TCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCT
CCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTT
TGGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCA
TGAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCC
AGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTT
TCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTC
TGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCT
TGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTAT
GTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCAC
CTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGG
GGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTT
ATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAAAATTACTTTGGACTACTCAAAAATACACCAA

>In-frame_WRB_ENST00000541890_chr21_40752412_+_ERG_ENST00000398907_chr21_39817544_-_4862nt
AGCGGACCCAGCACAGCCAGGAGCGTCCGGGATGAGCTCAGCCGCGGCCGACCACTGGGCGTGGTTGCTGGTGCTCAGCTTCGTGTTTGG
ATGCAATGTTCTTAGGATCCTCCTCCCGTCCTTCTCATCCTTCGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGC
CTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCC
TCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCC
TGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCA
CATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTG
GCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGAC
CAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACA
TTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCC
AAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGA
CCAGCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCA
GTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGA
CGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAA
GAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGA
GTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCC
TCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAG
GCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCC
ATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGG
AAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATC
ATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTA
TAAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACC
GTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCC
CATCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTC
TCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGA
GTGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAG
CAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCC
AGTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAA
ATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGG
TAAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCT
GTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGT
TGATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAAT
ATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCAT
TTGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACT
TGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTA
TTTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTG
GGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAA
CAAGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGA
TAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCAC
TGTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCC
TGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAA
GGCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCC
TTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATG
CTCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATC
TCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATT
TTGGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTC
ATGAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTC
CAGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGT
TTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCT
CTGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTC
TTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTA
TGTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCA
CCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATG
GGGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTT
TATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAAAATTACTTTGGACTACTCAAAAATACACCA

>In-frame_WRB_ENST00000541890_chr21_40752412_+_ERG_ENST00000398905_chr21_39817544_-_4859nt
AGCGGACCCAGCACAGCCAGGAGCGTCCGGGATGAGCTCAGCCGCGGCCGACCACTGGGCGTGGTTGCTGGTGCTCAGCTTCGTGTTTGG
ATGCAATGTTCTTAGGATCCTCCTCCCGTCCTTCTCATCCTTCGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGC
CTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCC
TCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCC
TGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCA
CATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTG
GCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGAC
CAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACA
TTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGATTTACCATATGAGCCCCCCAG
GAGATCAGCCTGGACCGGTCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCA
GCGTCCTCAGTTAGATCCTTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTT
CCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGA
GGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAA
CATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTC
ATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCC
AGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCT
CCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATC
GCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAG
AGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATC
TGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAA
ACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTT
TATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCAT
CAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCA
AACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTG
AGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAA
TGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGT
GTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATG
AAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAA
GAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTG
CGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGA
TCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATG
AAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTG
CACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGT
GCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTT
CTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGG
TTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAA
GCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAA
CGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGT
GGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGG
GCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGC
GCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTT
TGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTC
CTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCC
TTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTG
GAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATG
AGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAG
GTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTC
AAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTG
TTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTG
TCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGT
CCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCT
GCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGG
CACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTAT

>In-frame_WRB_ENST00000541890_chr21_40752412_+_ERG_ENST00000288319_chr21_39817544_-_4931nt
AGCGGACCCAGCACAGCCAGGAGCGTCCGGGATGAGCTCAGCCGCGGCCGACCACTGGGCGTGGTTGCTGGTGCTCAGCTTCGTGTTTGG
ATGCAATGTTCTTAGGATCCTCCTCCCGTCCTTCTCATCCTTCGAAGCCTTATCAGTTGTGAGTGAGGACCAGTCGTTGTTTGAGTGTGC
CTACGGAACGCCACACCTGGCTAAGACAGAGATGACCGCGTCCTCCTCCAGCGACTATGGACAGACTTCCAAGATGAGCCCACGCGTCCC
TCAGCAGGATTGGCTGTCTCAACCCCCAGCCAGGGTCACCATCAAAATGGAATGTAACCCTAGCCAGGTGAATGGCTCAAGGAACTCTCC
TGATGAATGCAGTGTGGCCAAAGGCGGGAAGATGGTGGGCAGCCCAGACACCGTTGGGATGAACTACGGCAGCTACATGGAGGAGAAGCA
CATGCCACCCCCAAACATGACCACGAACGAGCGCAGAGTTATCGTGCCAGCAGATCCTACGCTATGGAGTACAGACCATGTGCGGCAGTG
GCTGGAGTGGGCGGTGAAAGAATATGGCCTTCCAGACGTCAACATCTTGTTATTCCAGAACATCGATGGGAAGGAACTGTGCAAGATGAC
CAAGGACGACTTCCAGAGGCTCACCCCCAGCTACAACGCCGACATCCTTCTCTCACATCTCCACTACCTCAGAGAGACTCCTCTTCCACA
TTTGACTTCAGATGATGTTGATAAAGCCTTACAAAACTCTCCACGGTTAATGCATGCTAGAAACACAGGGGGTGCAGCTTTTATTTTCCC
AAATACTTCAGTATATCCTGAAGCTACGCAAAGAATTACAACTAGGCCAGATTTACCATATGAGCCCCCCAGGAGATCAGCCTGGACCGG
TCACGGCCACCCCACGCCCCAGTCGAAAGCTGCTCAACCATCTCCTTCCACAGTGCCCAAAACTGAAGACCAGCGTCCTCAGTTAGATCC
TTATCAGATTCTTGGACCAACAAGTAGCCGCCTTGCAAATCCAGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTC
GGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGG
AGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCA
TGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCC
CTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATC
TTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCC
TTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAACTCTATCGGA
GAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGG
GAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTGACCTTGTAA
AAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAGTAGAGTTTG
GAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCCATTTTAAGG
AAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACGTTGATATGC
AACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAAGATGACCCA
AAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGATTGTAGACA
GAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTGGACTCAGGA
CATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGAAAGGACACA
GCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTAACTGGAATT
GTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCT
GCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGT
ATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCAGCCAAAGAC
ACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTAGTTCTTAGA
ATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTTTAGTGACTA
AAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGA
AATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACA
GAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTGAGAAATTCT
AGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACTCGTAAGGCA
AACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGATTTGCTGCGG
GGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGATTCACTAGC
CCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATC
ACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGAAACATCTTA
GCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGATTATGTGAAG
TTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCCCGTGTCATT
TGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAAATAAATAAA
TACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAAGTCAAGACA
CACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATCATAAAAACA
AGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGCAAGTCTTAT
GAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCATTAACTCTC
TGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGG
CTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGG
GCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGGGTTCACAAA
GTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAGGAGCAGGAG
CCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAAAGCACAGAT
GTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCTCATTAATTC


Top

FusionGenePPI for WRB_ERG


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
WRBCAMLG, MCOLN3, FAS, SERPINA6, LPAR6, TOR3A, DPEP2, ERGIC3, ITGB8, HTR3C, CNDP1, DUSP6, ASNA1, SLC39A12, SLC22A9ERGJUN, ETS2, AR, HSPA4, HSPA8, NEDD4, PRKDC, XRCC5, XRCC6, PARP1, XRCC4, NME1, DDX3X, PCBP1, HNRNPA2B1, DDX5, TRIM21, TPM1, HNRNPM, EIF2S1, RPLP0, PRPF8, RPL7A, HNRNPDL, TUBB, CAD, ACTB, ATP5A1, RPS18, HNRNPU, SPTAN1, DNAJA1, DNAJA2, DNAJA4, APP, USP9X, ADAR, CDC5L, CLTC, DDX21, DDX23, DKC1, EEF1A2, ELAVL1, FBL, HNRNPA1, HNRNPAB, HNRNPC, HNRNPD, HNRNPF, HNRNPH1, HNRNPH3, HNRNPUL1, HNRNPUL2, HSPD1, ILF2, ILF3, LANCL1, MATR3, NCL, NOLC1, NONO, NPM1, NUMA1, POLR2A, PRPF40A, PUF60, RCC2, SF3B1, SF3B2, SF3B3, SFPQ, SNRNP200, SYN1, TOP1, TOP2B, XRN2, CUL3, SPOP, TRIM25, UBR5, TRIM33, RING1, UBR4, RNF2, TRIP12, HUWE1, STUB1, UHRF1, HERC2, BRD4, BRD2, BRD3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneWRBchr21:40752412chr21:39817544ENST00000333781+1539_9734175ASNA1/TRC40
HgeneWRBchr21:40752412chr21:39817544ENST00000380708+1539_97-31141ASNA1/TRC40
HgeneWRBchr21:40752412chr21:39817544ENST00000398753+1539_97-33141ASNA1/TRC40


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for WRB_ERG


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for WRB_ERG


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneWRBC0023893Liver Cirrhosis, Experimental1CTD_human
TgeneERGC0033578Prostatic Neoplasms5CTD_human
TgeneERGC0023418leukemia1CTD_human
TgeneERGC0023467Leukemia, Myelocytic, Acute1CTD_human
TgeneERGC1961102Precursor Cell Lymphoblastic Leukemia Lymphoma1CTD_human