FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42049

FusionGeneSummary for WNK2_FAM120A

check button Fusion gene summary
Fusion gene informationFusion gene name: WNK2_FAM120A
Fusion gene ID: 42049
HgeneTgene
Gene symbol

WNK2

FAM120A

Gene ID

65268

23196

Gene nameWNK lysine deficient protein kinase 2family with sequence similarity 120A
SynonymsNY-CO-43|P/OKcl.13|PRKWNK2|SDCCAG43C9orf10|HBVPTPAP|OSSA
Cytomap

9q22.31

9q22.31

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein kinase WNK2antigen NY-CO-43mitogen-activated protein kinase kinase kinaseprotein kinase lysine-deficient 2protein kinase with no lysine 2serologically defined colon cancer antigen 43constitutive coactivator of PPAR-gamma-like protein 1oxidative stess-associated Src activatoroxidative stress-associated Src activator
Modification date2018052320180523
UniProtAcc

Q9Y3S1

Q9NZB2

Ensembl transtripts involved in fusion geneENST00000427277, ENST00000297954, 
ENST00000395475, ENST00000356055, 
ENST00000349097, ENST00000395477, 
ENST00000471076, 
ENST00000277165, 
ENST00000375389, ENST00000340893, 
ENST00000333936, ENST00000475933, 
Fusion gene scores* DoF score6 X 7 X 8=3363 X 3 X 3=27
# samples 93
** MAII scorelog2(9/336*10)=-1.90046432644909
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: WNK2 [Title/Abstract] AND FAM120A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneWNK2

GO:0006468

protein phosphorylation

21733846

HgeneWNK2

GO:0046777

protein autophosphorylation

17667937


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSTADTCGA-VQ-A91Z-01AWNK2chr9

96021896

+FAM120Achr9

96259753

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000427277ENST00000277165WNK2chr9

96021896

+FAM120Achr9

96259753

+
In-frameENST00000427277ENST00000375389WNK2chr9

96021896

+FAM120Achr9

96259753

+
In-frameENST00000427277ENST00000340893WNK2chr9

96021896

+FAM120Achr9

96259753

+
In-frameENST00000427277ENST00000333936WNK2chr9

96021896

+FAM120Achr9

96259753

+
5CDS-intronENST00000427277ENST00000475933WNK2chr9

96021896

+FAM120Achr9

96259753

+
In-frameENST00000297954ENST00000277165WNK2chr9

96021896

+FAM120Achr9

96259753

+
In-frameENST00000297954ENST00000375389WNK2chr9

96021896

+FAM120Achr9

96259753

+
In-frameENST00000297954ENST00000340893WNK2chr9

96021896

+FAM120Achr9

96259753

+
In-frameENST00000297954ENST00000333936WNK2chr9

96021896

+FAM120Achr9

96259753

+
5CDS-intronENST00000297954ENST00000475933WNK2chr9

96021896

+FAM120Achr9

96259753

+
3UTR-3CDSENST00000395475ENST00000277165WNK2chr9

96021896

+FAM120Achr9

96259753

+
3UTR-3CDSENST00000395475ENST00000375389WNK2chr9

96021896

+FAM120Achr9

96259753

+
3UTR-3CDSENST00000395475ENST00000340893WNK2chr9

96021896

+FAM120Achr9

96259753

+
3UTR-3CDSENST00000395475ENST00000333936WNK2chr9

96021896

+FAM120Achr9

96259753

+
3UTR-intronENST00000395475ENST00000475933WNK2chr9

96021896

+FAM120Achr9

96259753

+
5UTR-3CDSENST00000356055ENST00000277165WNK2chr9

96021896

+FAM120Achr9

96259753

+
5UTR-3CDSENST00000356055ENST00000375389WNK2chr9

96021896

+FAM120Achr9

96259753

+
5UTR-3CDSENST00000356055ENST00000340893WNK2chr9

96021896

+FAM120Achr9

96259753

+
5UTR-3CDSENST00000356055ENST00000333936WNK2chr9

96021896

+FAM120Achr9

96259753

+
5UTR-intronENST00000356055ENST00000475933WNK2chr9

96021896

+FAM120Achr9

96259753

+
In-frameENST00000349097ENST00000277165WNK2chr9

96021896

+FAM120Achr9

96259753

+
In-frameENST00000349097ENST00000375389WNK2chr9

96021896

+FAM120Achr9

96259753

+
In-frameENST00000349097ENST00000340893WNK2chr9

96021896

+FAM120Achr9

96259753

+
In-frameENST00000349097ENST00000333936WNK2chr9

96021896

+FAM120Achr9

96259753

+
5CDS-intronENST00000349097ENST00000475933WNK2chr9

96021896

+FAM120Achr9

96259753

+
In-frameENST00000395477ENST00000277165WNK2chr9

96021896

+FAM120Achr9

96259753

+
In-frameENST00000395477ENST00000375389WNK2chr9

96021896

+FAM120Achr9

96259753

+
In-frameENST00000395477ENST00000340893WNK2chr9

96021896

+FAM120Achr9

96259753

+
In-frameENST00000395477ENST00000333936WNK2chr9

96021896

+FAM120Achr9

96259753

+
5CDS-intronENST00000395477ENST00000475933WNK2chr9

96021896

+FAM120Achr9

96259753

+
intron-3CDSENST00000471076ENST00000277165WNK2chr9

96021896

+FAM120Achr9

96259753

+
intron-3CDSENST00000471076ENST00000375389WNK2chr9

96021896

+FAM120Achr9

96259753

+
intron-3CDSENST00000471076ENST00000340893WNK2chr9

96021896

+FAM120Achr9

96259753

+
intron-3CDSENST00000471076ENST00000333936WNK2chr9

96021896

+FAM120Achr9

96259753

+
intron-intronENST00000471076ENST00000475933WNK2chr9

96021896

+FAM120Achr9

96259753

+

Top

FusionProtFeatures for WNK2_FAM120A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
WNK2

Q9Y3S1

FAM120A

Q9NZB2

Serine/threonine kinase which plays an important role inthe regulation of electrolyte homeostasis, cell signaling,survival, and proliferation. Acts as an activator and inhibitor ofsodium-coupled chloride cotransporters and potassium-coupledchloride cotransporters respectively. Activates SLC12A2, SCNN1A,SCNN1B, SCNN1D and SGK1 and inhibits SLC12A5. Negatively regulatesthe EGF-induced activation of the ERK/MAPK-pathway and thedownstream cell cycle progression. Affects MAPK3/MAPK1 activity bymodulating the activity of MAP2K1 and this modulation depends onphosphorylation of MAP2K1 by PAK1. WNK2 acts by interfering withthe activity of PAK1 by controlling the balance of the activity ofupstream regulators of PAK1 activity, RHOA and RAC1, which displayreciprocal activity. {ECO:0000269|PubMed:17667937,ECO:0000269|PubMed:18593598, ECO:0000269|PubMed:21733846}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneWNK2chr9:96021896chr9:96259753ENST00000297954+1130195_45310222298DomainProtein kinase
HgeneWNK2chr9:96021896chr9:96259753ENST00000297954+1130275_27810222298Nucleotide bindingATP
TgeneFAM120Achr9:96021896chr9:96259753ENST00000277165+218829_11182681119RegionNote=RNA binding
TgeneFAM120Achr9:96021896chr9:96259753ENST00000333936+219829_11182681147RegionNote=RNA binding
TgeneFAM120Achr9:96021896chr9:96259753ENST00000340893+217829_11182681073RegionNote=RNA binding
TgeneFAM120Achr9:96021896chr9:96259753ENST00000375389+29829_1118268629RegionNote=RNA binding

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for WNK2_FAM120A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_WNK2_ENST00000427277_chr9_96021896_+_FAM120A_ENST00000277165_chr9_96259753_+_1485aa
MATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGRKSTIALRL
WVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQWRRERIWPALQPKEQQDVGSPDKARGPP
VPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSDSQSSQQSVMLGSLADAAPSPAQCVCSPPVSE
GPVLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTGPGQPAPPGQQPPPLAQPTPLPQVLAPQP
VVPLQPVPPHLPPYLAPASQVGAPAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPLAGIDGLPPALPDLPTATVPPVPPPQYFSPAV
ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIHSAVAQLPGQPVYPAAFPQMAPTDVPPSP
HHTVQNMRATPPQPALPPQPTLPPQPVLPPQPTLPPQPVLPPQPTRPPQPVLPPQPMLPPQPVLPPQPALPVRPEPLQPHLPEQAAPAAT
PGSQVRAHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLAARPGPFGMPG
MVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQNSYSNIPHEGKHTPLYERSSPINPAQSGS
PNHVDSAYFPGSSTSSSSDNDEGSGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAEGKGSQMGTVQPIPCLLS
MPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLMYPYIFHVLTKGEIKIAVSIEDEANKDLPPAALLYRPVRQYVYGVLFSLAESRKKTE
RLAFRKNRLPPEFSPVIIKEWAAYKGKSPQTPELVEALAFREWTCPNLKRLWLGKAVEDKNRRMRAFLACMRSDTPAMLNPANVPTHLMV
LCCVLRYMVQWPGARILRRQELDAFLAQALSPKLYEPDQLQELKIENLDPRGIQLSALFMSGVDMALFANDACGQPIPWEHCCPWMYFDG
KLFQSKLLKASREKTPLIDLCDGQADQAAKVEKMRQSVLEGLSFSRQSHTLPFPPPPALPFYPASAYPRHFGPVPPSQGRGRGFAGVCGF
GGPYGETVATGPYRAFRVAAASGHCGAFSGSDSSRTSKSQGGVQPIPSQGGKLEIAGTVVGHWAGSRRGRGGRGPFPLQVVSVGGPARGR
PRGVISTPVIRTFGRGGRYYGRGYKNQAAIQGRPPYAASAEEVAKELKSKSGESKSSAMSSDGSLAENGVMAEEKPAPQMNGSTGDARAP

>In-frame_WNK2_ENST00000427277_chr9_96021896_+_FAM120A_ENST00000375389_chr9_96259753_+_995aa
MATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGRKSTIALRL
WVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQWRRERIWPALQPKEQQDVGSPDKARGPP
VPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSDSQSSQQSVMLGSLADAAPSPAQCVCSPPVSE
GPVLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTGPGQPAPPGQQPPPLAQPTPLPQVLAPQP
VVPLQPVPPHLPPYLAPASQVGAPAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPLAGIDGLPPALPDLPTATVPPVPPPQYFSPAV
ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIHSAVAQLPGQPVYPAAFPQMAPTDVPPSP
HHTVQNMRATPPQPALPPQPTLPPQPVLPPQPTLPPQPVLPPQPTRPPQPVLPPQPMLPPQPVLPPQPALPVRPEPLQPHLPEQAAPAAT
PGSQVRAHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLAARPGPFGMPG
MVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQNSYSNIPHEGKHTPLYERSSPINPAQSGS
PNHVDSAYFPGSSTSSSSDNDEGSGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAEGKGSQMGTVQPIPCLLS
MPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLMYPYIFHVLTKVLSKGPWSGFCYLMSGHSYGCFVLLSFFEPFFCLTNLLETKFTFPF

>In-frame_WNK2_ENST00000427277_chr9_96021896_+_FAM120A_ENST00000340893_chr9_96259753_+_1439aa
MATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGRKSTIALRL
WVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQWRRERIWPALQPKEQQDVGSPDKARGPP
VPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSDSQSSQQSVMLGSLADAAPSPAQCVCSPPVSE
GPVLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTGPGQPAPPGQQPPPLAQPTPLPQVLAPQP
VVPLQPVPPHLPPYLAPASQVGAPAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPLAGIDGLPPALPDLPTATVPPVPPPQYFSPAV
ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIHSAVAQLPGQPVYPAAFPQMAPTDVPPSP
HHTVQNMRATPPQPALPPQPTLPPQPVLPPQPTLPPQPVLPPQPTRPPQPVLPPQPMLPPQPVLPPQPALPVRPEPLQPHLPEQAAPAAT
PGSQVRAHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLAARPGPFGMPG
MVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQNSYSNIPHEGKHTPLYERSSPINPAQSGS
PNHVDSAYFPGSSTSSSSDNDEGSGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAEGKGSQMGTVQPIPCLLS
MPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLMYPYIFHVLTKGEIKIAVSIEDEANKDLPPAALLYRPVRQYVYGVLFSLAESRKKTE
RLAFRKNRLPPEFSPVIIKEWAAYKGKSPQTPELVEALAFREWTCPNLKRLWLGKAVEDKNRRMRAFLACMRSDTPAMLNPANVPTHLMV
LCCVLRYMVQWPGARILRRQELDAFLAQALSPKLYEPDQLQELKIENLDPRGIQLSALFMSGVDMALFANDACGQPIPWEHCCPWMYFDG
KLFQSKLLKASREKTPLIDLCDGQADQAAKVEKMRQSVLEGLSFSRQSHTLPFPPPPALPFYPASAYPRHFGPVPPSQGRGRGFAGVQPI
PSQGGKLEIAGTVVGHWAGSRRGRGGRGPFPLQVVSVGGPARGRPRGVISTPVIRTFGRGGRYYGRGYKNQAAIQGRPPYAASAEEVAKE

>In-frame_WNK2_ENST00000427277_chr9_96021896_+_FAM120A_ENST00000333936_chr9_96259753_+_1513aa
MATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGRKSTIALRL
WVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQWRRERIWPALQPKEQQDVGSPDKARGPP
VPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSDSQSSQQSVMLGSLADAAPSPAQCVCSPPVSE
GPVLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTGPGQPAPPGQQPPPLAQPTPLPQVLAPQP
VVPLQPVPPHLPPYLAPASQVGAPAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPLAGIDGLPPALPDLPTATVPPVPPPQYFSPAV
ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIHSAVAQLPGQPVYPAAFPQMAPTDVPPSP
HHTVQNMRATPPQPALPPQPTLPPQPVLPPQPTLPPQPVLPPQPTRPPQPVLPPQPMLPPQPVLPPQPALPVRPEPLQPHLPEQAAPAAT
PGSQVRAHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLAARPGPFGMPG
MVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQNSYSNIPHEGKHTPLYERSSPINPAQSGS
PNHVDSAYFPGSSTSSSSDNDEGSGGATKPFQLYLQKNFVFHKENSIVLCSRILRHGHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGS
STASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLMYPYIFHVLTKGEIKIAVSIEDEANKDLP
PAALLYRPVRQYVYGVLFSLAESRKKTERLAFRKNRLPPEFSPVIIKEWAAYKGKSPQTPELVEALAFREWTCPNLKRLWLGKAVEDKNR
RMRAFLACMRSDTPAMLNPANVPTHLMVLCCVLRYMVQWPGARILRRQELDAFLAQALSPKLYEPDQLQELKIENLDPRGIQLSALFMSG
VDMALFANDACGQPIPWEHCCPWMYFDGKLFQSKLLKASREKTPLIDLCDGQADQAAKVEKMRQSVLEGLSFSRQSHTLPFPPPPALPFY
PASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAFRVAAASGHCGAFSGSDSSRTSKSQGGVQPIPSQGGKLEIAGTVVGH
WAGSRRGRGGRGPFPLQVVSVGGPARGRPRGVISTPVIRTFGRGGRYYGRGYKNQAAIQGRPPYAASAEEVAKELKSKSGESKSSAMSSD

>In-frame_WNK2_ENST00000297954_chr9_96021896_+_FAM120A_ENST00000277165_chr9_96259753_+_1873aa
MDGDGGRRDVPGTLMEPGRGAGPAGMAEPRAKAARPGPQRFLRRSVVESDQEEPPGLEAAEAPGPQPPQPLQRRVLLLCKTRRLIAERAR
GRPAAPAPAALVAQPGAPGAPADAGPEPVGTQEPGPDPIAAAVETAPAPDGGPREEAAATVRKEDEGAAEAKPEPGRTRRDEPEEEEDDE
DDLKAVATSLDGRFLKFDIELGRGSFKTVYKGLDTETWVEVAWCELQDRKLTKLERQRFKEEAEMLKGLQHPNIVRFYDFWESSAKGKRC
IVLVTELMTSGTLKTYLKRFKVMKPKVLRSWCRQILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGT
PEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSH
AFFAEDTGVRVELAEEDHGRKSTIALRLWVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQ
WRRERIWPALQPKEQQDVGSPDKARGPPVPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSDSQS
SQQSVMLGSLADAAPSPAQCVCSPPVSEGPVLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTG
PGQPAPPGQQPPPLAQPTPLPQVLAPQPVVPLQPVPPHLPPYLAPASQVGAPAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPLAGI
DGLPPALPDLPTATVPPVPPPQYFSPAVILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIH
SAVAQLPGQPVYPAAFPQMAPTDVPPSPHHTVQNMRATPPQPALPPQPTLPPQPVLPPQPTLPPQPVLPPQPTRPPQPVLPPQPMLPPQP
VLPPQPALPVRPEPLQPHLPEQAAPAATPGSQVRAHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIG
YYSATSKPMSFHPPHYLAARPGPFGMPGMVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQN
SYSNIPHEGKHTPLYERSSPINPAQSGSPNHVDSAYFPGSSTSSSSDNDEGSGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGS
STASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLMYPYIFHVLTKGEIKIAVSIEDEANKDLP
PAALLYRPVRQYVYGVLFSLAESRKKTERLAFRKNRLPPEFSPVIIKEWAAYKGKSPQTPELVEALAFREWTCPNLKRLWLGKAVEDKNR
RMRAFLACMRSDTPAMLNPANVPTHLMVLCCVLRYMVQWPGARILRRQELDAFLAQALSPKLYEPDQLQELKIENLDPRGIQLSALFMSG
VDMALFANDACGQPIPWEHCCPWMYFDGKLFQSKLLKASREKTPLIDLCDGQADQAAKVEKMRQSVLEGLSFSRQSHTLPFPPPPALPFY
PASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAFRVAAASGHCGAFSGSDSSRTSKSQGGVQPIPSQGGKLEIAGTVVGH
WAGSRRGRGGRGPFPLQVVSVGGPARGRPRGVISTPVIRTFGRGGRYYGRGYKNQAAIQGRPPYAASAEEVAKELKSKSGESKSSAMSSD

>In-frame_WNK2_ENST00000297954_chr9_96021896_+_FAM120A_ENST00000375389_chr9_96259753_+_1383aa
MDGDGGRRDVPGTLMEPGRGAGPAGMAEPRAKAARPGPQRFLRRSVVESDQEEPPGLEAAEAPGPQPPQPLQRRVLLLCKTRRLIAERAR
GRPAAPAPAALVAQPGAPGAPADAGPEPVGTQEPGPDPIAAAVETAPAPDGGPREEAAATVRKEDEGAAEAKPEPGRTRRDEPEEEEDDE
DDLKAVATSLDGRFLKFDIELGRGSFKTVYKGLDTETWVEVAWCELQDRKLTKLERQRFKEEAEMLKGLQHPNIVRFYDFWESSAKGKRC
IVLVTELMTSGTLKTYLKRFKVMKPKVLRSWCRQILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGT
PEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSH
AFFAEDTGVRVELAEEDHGRKSTIALRLWVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQ
WRRERIWPALQPKEQQDVGSPDKARGPPVPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSDSQS
SQQSVMLGSLADAAPSPAQCVCSPPVSEGPVLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTG
PGQPAPPGQQPPPLAQPTPLPQVLAPQPVVPLQPVPPHLPPYLAPASQVGAPAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPLAGI
DGLPPALPDLPTATVPPVPPPQYFSPAVILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIH
SAVAQLPGQPVYPAAFPQMAPTDVPPSPHHTVQNMRATPPQPALPPQPTLPPQPVLPPQPTLPPQPVLPPQPTRPPQPVLPPQPMLPPQP
VLPPQPALPVRPEPLQPHLPEQAAPAATPGSQVRAHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIG
YYSATSKPMSFHPPHYLAARPGPFGMPGMVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQN
SYSNIPHEGKHTPLYERSSPINPAQSGSPNHVDSAYFPGSSTSSSSDNDEGSGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGS
STASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLMYPYIFHVLTKVLSKGPWSGFCYLMSGHS

>In-frame_WNK2_ENST00000297954_chr9_96021896_+_FAM120A_ENST00000340893_chr9_96259753_+_1827aa
MDGDGGRRDVPGTLMEPGRGAGPAGMAEPRAKAARPGPQRFLRRSVVESDQEEPPGLEAAEAPGPQPPQPLQRRVLLLCKTRRLIAERAR
GRPAAPAPAALVAQPGAPGAPADAGPEPVGTQEPGPDPIAAAVETAPAPDGGPREEAAATVRKEDEGAAEAKPEPGRTRRDEPEEEEDDE
DDLKAVATSLDGRFLKFDIELGRGSFKTVYKGLDTETWVEVAWCELQDRKLTKLERQRFKEEAEMLKGLQHPNIVRFYDFWESSAKGKRC
IVLVTELMTSGTLKTYLKRFKVMKPKVLRSWCRQILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGT
PEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSH
AFFAEDTGVRVELAEEDHGRKSTIALRLWVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQ
WRRERIWPALQPKEQQDVGSPDKARGPPVPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSDSQS
SQQSVMLGSLADAAPSPAQCVCSPPVSEGPVLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTG
PGQPAPPGQQPPPLAQPTPLPQVLAPQPVVPLQPVPPHLPPYLAPASQVGAPAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPLAGI
DGLPPALPDLPTATVPPVPPPQYFSPAVILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIH
SAVAQLPGQPVYPAAFPQMAPTDVPPSPHHTVQNMRATPPQPALPPQPTLPPQPVLPPQPTLPPQPVLPPQPTRPPQPVLPPQPMLPPQP
VLPPQPALPVRPEPLQPHLPEQAAPAATPGSQVRAHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIG
YYSATSKPMSFHPPHYLAARPGPFGMPGMVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQN
SYSNIPHEGKHTPLYERSSPINPAQSGSPNHVDSAYFPGSSTSSSSDNDEGSGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGS
STASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLMYPYIFHVLTKGEIKIAVSIEDEANKDLP
PAALLYRPVRQYVYGVLFSLAESRKKTERLAFRKNRLPPEFSPVIIKEWAAYKGKSPQTPELVEALAFREWTCPNLKRLWLGKAVEDKNR
RMRAFLACMRSDTPAMLNPANVPTHLMVLCCVLRYMVQWPGARILRRQELDAFLAQALSPKLYEPDQLQELKIENLDPRGIQLSALFMSG
VDMALFANDACGQPIPWEHCCPWMYFDGKLFQSKLLKASREKTPLIDLCDGQADQAAKVEKMRQSVLEGLSFSRQSHTLPFPPPPALPFY
PASAYPRHFGPVPPSQGRGRGFAGVQPIPSQGGKLEIAGTVVGHWAGSRRGRGGRGPFPLQVVSVGGPARGRPRGVISTPVIRTFGRGGR
YYGRGYKNQAAIQGRPPYAASAEEVAKELKSKSGESKSSAMSSDGSLAENGVMAEEKPAPQMNGSTGDARAPSHSESALNNDSKTCNTNP

>In-frame_WNK2_ENST00000297954_chr9_96021896_+_FAM120A_ENST00000333936_chr9_96259753_+_1901aa
MDGDGGRRDVPGTLMEPGRGAGPAGMAEPRAKAARPGPQRFLRRSVVESDQEEPPGLEAAEAPGPQPPQPLQRRVLLLCKTRRLIAERAR
GRPAAPAPAALVAQPGAPGAPADAGPEPVGTQEPGPDPIAAAVETAPAPDGGPREEAAATVRKEDEGAAEAKPEPGRTRRDEPEEEEDDE
DDLKAVATSLDGRFLKFDIELGRGSFKTVYKGLDTETWVEVAWCELQDRKLTKLERQRFKEEAEMLKGLQHPNIVRFYDFWESSAKGKRC
IVLVTELMTSGTLKTYLKRFKVMKPKVLRSWCRQILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGT
PEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSH
AFFAEDTGVRVELAEEDHGRKSTIALRLWVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQ
WRRERIWPALQPKEQQDVGSPDKARGPPVPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSDSQS
SQQSVMLGSLADAAPSPAQCVCSPPVSEGPVLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTG
PGQPAPPGQQPPPLAQPTPLPQVLAPQPVVPLQPVPPHLPPYLAPASQVGAPAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPLAGI
DGLPPALPDLPTATVPPVPPPQYFSPAVILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIH
SAVAQLPGQPVYPAAFPQMAPTDVPPSPHHTVQNMRATPPQPALPPQPTLPPQPVLPPQPTLPPQPVLPPQPTRPPQPVLPPQPMLPPQP
VLPPQPALPVRPEPLQPHLPEQAAPAATPGSQVRAHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIG
YYSATSKPMSFHPPHYLAARPGPFGMPGMVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQN
SYSNIPHEGKHTPLYERSSPINPAQSGSPNHVDSAYFPGSSTSSSSDNDEGSGGATKPFQLYLQKNFVFHKENSIVLCSRILRHGHISGN
KIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLM
YPYIFHVLTKGEIKIAVSIEDEANKDLPPAALLYRPVRQYVYGVLFSLAESRKKTERLAFRKNRLPPEFSPVIIKEWAAYKGKSPQTPEL
VEALAFREWTCPNLKRLWLGKAVEDKNRRMRAFLACMRSDTPAMLNPANVPTHLMVLCCVLRYMVQWPGARILRRQELDAFLAQALSPKL
YEPDQLQELKIENLDPRGIQLSALFMSGVDMALFANDACGQPIPWEHCCPWMYFDGKLFQSKLLKASREKTPLIDLCDGQADQAAKVEKM
RQSVLEGLSFSRQSHTLPFPPPPALPFYPASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAFRVAAASGHCGAFSGSDSS
RTSKSQGGVQPIPSQGGKLEIAGTVVGHWAGSRRGRGGRGPFPLQVVSVGGPARGRPRGVISTPVIRTFGRGGRYYGRGYKNQAAIQGRP
PYAASAEEVAKELKSKSGESKSSAMSSDGSLAENGVMAEEKPAPQMNGSTGDARAPSHSESALNNDSKTCNTNPHLNALSTDSACRREAA

>In-frame_WNK2_ENST00000349097_chr9_96021896_+_FAM120A_ENST00000277165_chr9_96259753_+_1485aa
MATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGRKSTIALRL
WVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQWRRERIWPALQPKEQQDVGSPDKARGPP
VPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSDSQSSQQSVMLGSLADAAPSPAQCVCSPPVSE
GPVLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTGPGQPAPPGQQPPPLAQPTPLPQVLAPQP
VVPLQPVPPHLPPYLAPASQVGAPAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPLAGIDGLPPALPDLPTATVPPVPPPQYFSPAV
ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIHSAVAQLPGQPVYPAAFPQMAPTDVPPSP
HHTVQNMRATPPQPALPPQPTLPPQPVLPPQPTLPPQPVLPPQPTRPPQPVLPPQPMLPPQPVLPPQPALPVRPEPLQPHLPEQAAPAAT
PGSQVRAHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLAARPGPFGMPG
MVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQNSYSNIPHEGKHTPLYERSSPINPAQSGS
PNHVDSAYFPGSSTSSSSDNDEGSGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAEGKGSQMGTVQPIPCLLS
MPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLMYPYIFHVLTKGEIKIAVSIEDEANKDLPPAALLYRPVRQYVYGVLFSLAESRKKTE
RLAFRKNRLPPEFSPVIIKEWAAYKGKSPQTPELVEALAFREWTCPNLKRLWLGKAVEDKNRRMRAFLACMRSDTPAMLNPANVPTHLMV
LCCVLRYMVQWPGARILRRQELDAFLAQALSPKLYEPDQLQELKIENLDPRGIQLSALFMSGVDMALFANDACGQPIPWEHCCPWMYFDG
KLFQSKLLKASREKTPLIDLCDGQADQAAKVEKMRQSVLEGLSFSRQSHTLPFPPPPALPFYPASAYPRHFGPVPPSQGRGRGFAGVCGF
GGPYGETVATGPYRAFRVAAASGHCGAFSGSDSSRTSKSQGGVQPIPSQGGKLEIAGTVVGHWAGSRRGRGGRGPFPLQVVSVGGPARGR
PRGVISTPVIRTFGRGGRYYGRGYKNQAAIQGRPPYAASAEEVAKELKSKSGESKSSAMSSDGSLAENGVMAEEKPAPQMNGSTGDARAP

>In-frame_WNK2_ENST00000349097_chr9_96021896_+_FAM120A_ENST00000375389_chr9_96259753_+_995aa
MATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGRKSTIALRL
WVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQWRRERIWPALQPKEQQDVGSPDKARGPP
VPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSDSQSSQQSVMLGSLADAAPSPAQCVCSPPVSE
GPVLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTGPGQPAPPGQQPPPLAQPTPLPQVLAPQP
VVPLQPVPPHLPPYLAPASQVGAPAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPLAGIDGLPPALPDLPTATVPPVPPPQYFSPAV
ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIHSAVAQLPGQPVYPAAFPQMAPTDVPPSP
HHTVQNMRATPPQPALPPQPTLPPQPVLPPQPTLPPQPVLPPQPTRPPQPVLPPQPMLPPQPVLPPQPALPVRPEPLQPHLPEQAAPAAT
PGSQVRAHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLAARPGPFGMPG
MVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQNSYSNIPHEGKHTPLYERSSPINPAQSGS
PNHVDSAYFPGSSTSSSSDNDEGSGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAEGKGSQMGTVQPIPCLLS
MPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLMYPYIFHVLTKVLSKGPWSGFCYLMSGHSYGCFVLLSFFEPFFCLTNLLETKFTFPF

>In-frame_WNK2_ENST00000349097_chr9_96021896_+_FAM120A_ENST00000340893_chr9_96259753_+_1439aa
MATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGRKSTIALRL
WVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQWRRERIWPALQPKEQQDVGSPDKARGPP
VPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSDSQSSQQSVMLGSLADAAPSPAQCVCSPPVSE
GPVLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTGPGQPAPPGQQPPPLAQPTPLPQVLAPQP
VVPLQPVPPHLPPYLAPASQVGAPAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPLAGIDGLPPALPDLPTATVPPVPPPQYFSPAV
ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIHSAVAQLPGQPVYPAAFPQMAPTDVPPSP
HHTVQNMRATPPQPALPPQPTLPPQPVLPPQPTLPPQPVLPPQPTRPPQPVLPPQPMLPPQPVLPPQPALPVRPEPLQPHLPEQAAPAAT
PGSQVRAHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLAARPGPFGMPG
MVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQNSYSNIPHEGKHTPLYERSSPINPAQSGS
PNHVDSAYFPGSSTSSSSDNDEGSGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAEGKGSQMGTVQPIPCLLS
MPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLMYPYIFHVLTKGEIKIAVSIEDEANKDLPPAALLYRPVRQYVYGVLFSLAESRKKTE
RLAFRKNRLPPEFSPVIIKEWAAYKGKSPQTPELVEALAFREWTCPNLKRLWLGKAVEDKNRRMRAFLACMRSDTPAMLNPANVPTHLMV
LCCVLRYMVQWPGARILRRQELDAFLAQALSPKLYEPDQLQELKIENLDPRGIQLSALFMSGVDMALFANDACGQPIPWEHCCPWMYFDG
KLFQSKLLKASREKTPLIDLCDGQADQAAKVEKMRQSVLEGLSFSRQSHTLPFPPPPALPFYPASAYPRHFGPVPPSQGRGRGFAGVQPI
PSQGGKLEIAGTVVGHWAGSRRGRGGRGPFPLQVVSVGGPARGRPRGVISTPVIRTFGRGGRYYGRGYKNQAAIQGRPPYAASAEEVAKE

>In-frame_WNK2_ENST00000349097_chr9_96021896_+_FAM120A_ENST00000333936_chr9_96259753_+_1513aa
MATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSHAFFAEDTGVRVELAEEDHGRKSTIALRL
WVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQWRRERIWPALQPKEQQDVGSPDKARGPP
VPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSDSQSSQQSVMLGSLADAAPSPAQCVCSPPVSE
GPVLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTGPGQPAPPGQQPPPLAQPTPLPQVLAPQP
VVPLQPVPPHLPPYLAPASQVGAPAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPLAGIDGLPPALPDLPTATVPPVPPPQYFSPAV
ILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIHSAVAQLPGQPVYPAAFPQMAPTDVPPSP
HHTVQNMRATPPQPALPPQPTLPPQPVLPPQPTLPPQPVLPPQPTRPPQPVLPPQPMLPPQPVLPPQPALPVRPEPLQPHLPEQAAPAAT
PGSQVRAHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIGYYSATSKPMSFHPPHYLAARPGPFGMPG
MVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQNSYSNIPHEGKHTPLYERSSPINPAQSGS
PNHVDSAYFPGSSTSSSSDNDEGSGGATKPFQLYLQKNFVFHKENSIVLCSRILRHGHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGS
STASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLMYPYIFHVLTKGEIKIAVSIEDEANKDLP
PAALLYRPVRQYVYGVLFSLAESRKKTERLAFRKNRLPPEFSPVIIKEWAAYKGKSPQTPELVEALAFREWTCPNLKRLWLGKAVEDKNR
RMRAFLACMRSDTPAMLNPANVPTHLMVLCCVLRYMVQWPGARILRRQELDAFLAQALSPKLYEPDQLQELKIENLDPRGIQLSALFMSG
VDMALFANDACGQPIPWEHCCPWMYFDGKLFQSKLLKASREKTPLIDLCDGQADQAAKVEKMRQSVLEGLSFSRQSHTLPFPPPPALPFY
PASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAFRVAAASGHCGAFSGSDSSRTSKSQGGVQPIPSQGGKLEIAGTVVGH
WAGSRRGRGGRGPFPLQVVSVGGPARGRPRGVISTPVIRTFGRGGRYYGRGYKNQAAIQGRPPYAASAEEVAKELKSKSGESKSSAMSSD

>In-frame_WNK2_ENST00000395477_chr9_96021896_+_FAM120A_ENST00000277165_chr9_96259753_+_1873aa
MDGDGGRRDVPGTLMEPGRGAGPAGMAEPRAKAARPGPQRFLRRSVVESDQEEPPGLEAAEAPGPQPPQPLQRRVLLLCKTRRLIAERAR
GRPAAPAPAALVAQPGAPGAPADAGPEPVGTQEPGPDPIAAAVETAPAPDGGPREEAAATVRKEDEGAAEAKPEPGRTRRDEPEEEEDDE
DDLKAVATSLDGRFLKFDIELGRGSFKTVYKGLDTETWVEVAWCELQDRKLTKLERQRFKEEAEMLKGLQHPNIVRFYDFWESSAKGKRC
IVLVTELMTSGTLKTYLKRFKVMKPKVLRSWCRQILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGT
PEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSH
AFFAEDTGVRVELAEEDHGRKSTIALRLWVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQ
WRRERIWPALQPKEQQDVGSPDKARGPPVPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSDSQS
SQQSVMLGSLADAAPSPAQCVCSPPVSEGPVLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTG
PGQPAPPGQQPPPLAQPTPLPQVLAPQPVVPLQPVPPHLPPYLAPASQVGAPAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPLAGI
DGLPPALPDLPTATVPPVPPPQYFSPAVILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIH
SAVAQLPGQPVYPAAFPQMAPTDVPPSPHHTVQNMRATPPQPALPPQPTLPPQPVLPPQPTLPPQPVLPPQPTRPPQPVLPPQPMLPPQP
VLPPQPALPVRPEPLQPHLPEQAAPAATPGSQVRAHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIG
YYSATSKPMSFHPPHYLAARPGPFGMPGMVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQN
SYSNIPHEGKHTPLYERSSPINPAQSGSPNHVDSAYFPGSSTSSSSDNDEGSGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGS
STASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLMYPYIFHVLTKGEIKIAVSIEDEANKDLP
PAALLYRPVRQYVYGVLFSLAESRKKTERLAFRKNRLPPEFSPVIIKEWAAYKGKSPQTPELVEALAFREWTCPNLKRLWLGKAVEDKNR
RMRAFLACMRSDTPAMLNPANVPTHLMVLCCVLRYMVQWPGARILRRQELDAFLAQALSPKLYEPDQLQELKIENLDPRGIQLSALFMSG
VDMALFANDACGQPIPWEHCCPWMYFDGKLFQSKLLKASREKTPLIDLCDGQADQAAKVEKMRQSVLEGLSFSRQSHTLPFPPPPALPFY
PASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAFRVAAASGHCGAFSGSDSSRTSKSQGGVQPIPSQGGKLEIAGTVVGH
WAGSRRGRGGRGPFPLQVVSVGGPARGRPRGVISTPVIRTFGRGGRYYGRGYKNQAAIQGRPPYAASAEEVAKELKSKSGESKSSAMSSD

>In-frame_WNK2_ENST00000395477_chr9_96021896_+_FAM120A_ENST00000375389_chr9_96259753_+_1383aa
MDGDGGRRDVPGTLMEPGRGAGPAGMAEPRAKAARPGPQRFLRRSVVESDQEEPPGLEAAEAPGPQPPQPLQRRVLLLCKTRRLIAERAR
GRPAAPAPAALVAQPGAPGAPADAGPEPVGTQEPGPDPIAAAVETAPAPDGGPREEAAATVRKEDEGAAEAKPEPGRTRRDEPEEEEDDE
DDLKAVATSLDGRFLKFDIELGRGSFKTVYKGLDTETWVEVAWCELQDRKLTKLERQRFKEEAEMLKGLQHPNIVRFYDFWESSAKGKRC
IVLVTELMTSGTLKTYLKRFKVMKPKVLRSWCRQILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGT
PEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSH
AFFAEDTGVRVELAEEDHGRKSTIALRLWVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQ
WRRERIWPALQPKEQQDVGSPDKARGPPVPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSDSQS
SQQSVMLGSLADAAPSPAQCVCSPPVSEGPVLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTG
PGQPAPPGQQPPPLAQPTPLPQVLAPQPVVPLQPVPPHLPPYLAPASQVGAPAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPLAGI
DGLPPALPDLPTATVPPVPPPQYFSPAVILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIH
SAVAQLPGQPVYPAAFPQMAPTDVPPSPHHTVQNMRATPPQPALPPQPTLPPQPVLPPQPTLPPQPVLPPQPTRPPQPVLPPQPMLPPQP
VLPPQPALPVRPEPLQPHLPEQAAPAATPGSQVRAHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIG
YYSATSKPMSFHPPHYLAARPGPFGMPGMVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQN
SYSNIPHEGKHTPLYERSSPINPAQSGSPNHVDSAYFPGSSTSSSSDNDEGSGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGS
STASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLMYPYIFHVLTKVLSKGPWSGFCYLMSGHS

>In-frame_WNK2_ENST00000395477_chr9_96021896_+_FAM120A_ENST00000340893_chr9_96259753_+_1827aa
MDGDGGRRDVPGTLMEPGRGAGPAGMAEPRAKAARPGPQRFLRRSVVESDQEEPPGLEAAEAPGPQPPQPLQRRVLLLCKTRRLIAERAR
GRPAAPAPAALVAQPGAPGAPADAGPEPVGTQEPGPDPIAAAVETAPAPDGGPREEAAATVRKEDEGAAEAKPEPGRTRRDEPEEEEDDE
DDLKAVATSLDGRFLKFDIELGRGSFKTVYKGLDTETWVEVAWCELQDRKLTKLERQRFKEEAEMLKGLQHPNIVRFYDFWESSAKGKRC
IVLVTELMTSGTLKTYLKRFKVMKPKVLRSWCRQILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGT
PEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSH
AFFAEDTGVRVELAEEDHGRKSTIALRLWVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQ
WRRERIWPALQPKEQQDVGSPDKARGPPVPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSDSQS
SQQSVMLGSLADAAPSPAQCVCSPPVSEGPVLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTG
PGQPAPPGQQPPPLAQPTPLPQVLAPQPVVPLQPVPPHLPPYLAPASQVGAPAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPLAGI
DGLPPALPDLPTATVPPVPPPQYFSPAVILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIH
SAVAQLPGQPVYPAAFPQMAPTDVPPSPHHTVQNMRATPPQPALPPQPTLPPQPVLPPQPTLPPQPVLPPQPTRPPQPVLPPQPMLPPQP
VLPPQPALPVRPEPLQPHLPEQAAPAATPGSQVRAHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIG
YYSATSKPMSFHPPHYLAARPGPFGMPGMVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQN
SYSNIPHEGKHTPLYERSSPINPAQSGSPNHVDSAYFPGSSTSSSSDNDEGSGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGS
STASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLMYPYIFHVLTKGEIKIAVSIEDEANKDLP
PAALLYRPVRQYVYGVLFSLAESRKKTERLAFRKNRLPPEFSPVIIKEWAAYKGKSPQTPELVEALAFREWTCPNLKRLWLGKAVEDKNR
RMRAFLACMRSDTPAMLNPANVPTHLMVLCCVLRYMVQWPGARILRRQELDAFLAQALSPKLYEPDQLQELKIENLDPRGIQLSALFMSG
VDMALFANDACGQPIPWEHCCPWMYFDGKLFQSKLLKASREKTPLIDLCDGQADQAAKVEKMRQSVLEGLSFSRQSHTLPFPPPPALPFY
PASAYPRHFGPVPPSQGRGRGFAGVQPIPSQGGKLEIAGTVVGHWAGSRRGRGGRGPFPLQVVSVGGPARGRPRGVISTPVIRTFGRGGR
YYGRGYKNQAAIQGRPPYAASAEEVAKELKSKSGESKSSAMSSDGSLAENGVMAEEKPAPQMNGSTGDARAPSHSESALNNDSKTCNTNP

>In-frame_WNK2_ENST00000395477_chr9_96021896_+_FAM120A_ENST00000333936_chr9_96259753_+_1901aa
MDGDGGRRDVPGTLMEPGRGAGPAGMAEPRAKAARPGPQRFLRRSVVESDQEEPPGLEAAEAPGPQPPQPLQRRVLLLCKTRRLIAERAR
GRPAAPAPAALVAQPGAPGAPADAGPEPVGTQEPGPDPIAAAVETAPAPDGGPREEAAATVRKEDEGAAEAKPEPGRTRRDEPEEEEDDE
DDLKAVATSLDGRFLKFDIELGRGSFKTVYKGLDTETWVEVAWCELQDRKLTKLERQRFKEEAEMLKGLQHPNIVRFYDFWESSAKGKRC
IVLVTELMTSGTLKTYLKRFKVMKPKVLRSWCRQILKGLLFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGT
PEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECICKNKEERYEIKDLLSH
AFFAEDTGVRVELAEEDHGRKSTIALRLWVEDPKKLKGKPKDNGAIEFTFDLEKETPDEVAQEMIESGFFHESDVKIVAKSIRDRVALIQ
WRRERIWPALQPKEQQDVGSPDKARGPPVPLQVQVTYHAQAGQPGPPEPEEPEADQHLLPPTLPTSATSLASDSTFDSGQGSTVYSDSQS
SQQSVMLGSLADAAPSPAQCVCSPPVSEGPVLPQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMPTG
PGQPAPPGQQPPPLAQPTPLPQVLAPQPVVPLQPVPPHLPPYLAPASQVGAPAQLKPLQMPQAPLQPLAQVPPQMPPIPVVPPITPLAGI
DGLPPALPDLPTATVPPVPPPQYFSPAVILPSLAAPLPPASPALPLQAVKLPHPPGAPLAMPCRTIVPNAPATIPLLAVAPPGVAALSIH
SAVAQLPGQPVYPAAFPQMAPTDVPPSPHHTVQNMRATPPQPALPPQPTLPPQPVLPPQPTLPPQPVLPPQPTRPPQPVLPPQPMLPPQP
VLPPQPALPVRPEPLQPHLPEQAAPAATPGSQVRAHQLVLPPCDVVIKAVADYVRNIQDTSDLDAIAKDVFQHSQSRTDDKVIRFKRAIG
YYSATSKPMSFHPPHYLAARPGPFGMPGMVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKNLTEQN
SYSNIPHEGKHTPLYERSSPINPAQSGSPNHVDSAYFPGSSTSSSSDNDEGSGGATKPFQLYLQKNFVFHKENSIVLCSRILRHGHISGN
KIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPLPPVAPEVLRVAEHRHKKGLM
YPYIFHVLTKGEIKIAVSIEDEANKDLPPAALLYRPVRQYVYGVLFSLAESRKKTERLAFRKNRLPPEFSPVIIKEWAAYKGKSPQTPEL
VEALAFREWTCPNLKRLWLGKAVEDKNRRMRAFLACMRSDTPAMLNPANVPTHLMVLCCVLRYMVQWPGARILRRQELDAFLAQALSPKL
YEPDQLQELKIENLDPRGIQLSALFMSGVDMALFANDACGQPIPWEHCCPWMYFDGKLFQSKLLKASREKTPLIDLCDGQADQAAKVEKM
RQSVLEGLSFSRQSHTLPFPPPPALPFYPASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAFRVAAASGHCGAFSGSDSS
RTSKSQGGVQPIPSQGGKLEIAGTVVGHWAGSRRGRGGRGPFPLQVVSVGGPARGRPRGVISTPVIRTFGRGGRYYGRGYKNQAAIQGRP
PYAASAEEVAKELKSKSGESKSSAMSSDGSLAENGVMAEEKPAPQMNGSTGDARAPSHSESALNNDSKTCNTNPHLNALSTDSACRREAA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_WNK2_ENST00000427277_chr9_96021896_+_FAM120A_ENST00000277165_chr9_96259753_+_4455nt
ATGGCCACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTT
GAGAAAGTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTG
AGCCACGCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTC
TGGGTGGAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGAT
GAGGTGGCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTG
ATCCAGTGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCG
GTGCCCCTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTC
CTGCCACCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCG
CAGAGCAGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAG
GGGCCCGTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCC
CCCGCCTGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCC
ACGGGCCCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCC
GTGGTCCCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTC
CAGATGCCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCG
GGAATCGACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTG
ATCTTGCCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCC
CTGGCCATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCC
ATTCATTCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCC
CATCACACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCG
CAACCCACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCA
CAACCTGTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACA
CCAGGGAGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAG
GACACCTCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCA
ATTGGATATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGG
ATGGTGCCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCA
GGGGGCGCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAG
CAGAACAGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGC
CCCAACCACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCAT
ATCAGCGGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAA
GGCTCGTCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCG
ATGCCCACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAG
AAGGGGCTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGAC
CTGCCTCCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAG
AGACTTGCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAA
ACCCCGGAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAG
AACCGCAGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTG
CTCTGCTGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTG
TCCCCCAAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATG
AGTGGAGTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGG
AAGCTCTTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAG
GTAGAGAAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCC
TTCTACCCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGCGTCTGTGGCTTT
GGAGGCCCCTATGGGGAAACGGTAGCAACAGGCCCTTACCGTGCCTTCCGTGTGGCGGCAGCATCGGGACACTGCGGAGCCTTCTCAGGC
AGTGACAGCAGCAGGACTAGCAAGTCCCAGGGCGGAGTCCAACCTATACCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTT
GGCCATTGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGT
CCAAGAGGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATT
CAGGGCAGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCT
TCAGACGGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCC
AGCCACTCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCTCATTTAAATGCACTAAGTACAGACAGCGCTTGCCGC

>In-frame_WNK2_ENST00000427277_chr9_96021896_+_FAM120A_ENST00000375389_chr9_96259753_+_2985nt
ATGGCCACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTT
GAGAAAGTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTG
AGCCACGCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTC
TGGGTGGAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGAT
GAGGTGGCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTG
ATCCAGTGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCG
GTGCCCCTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTC
CTGCCACCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCG
CAGAGCAGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAG
GGGCCCGTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCC
CCCGCCTGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCC
ACGGGCCCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCC
GTGGTCCCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTC
CAGATGCCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCG
GGAATCGACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTG
ATCTTGCCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCC
CTGGCCATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCC
ATTCATTCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCC
CATCACACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCG
CAACCCACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCA
CAACCTGTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACA
CCAGGGAGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAG
GACACCTCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCA
ATTGGATATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGG
ATGGTGCCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCA
GGGGGCGCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAG
CAGAACAGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGC
CCCAACCACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCAT
ATCAGCGGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAA
GGCTCGTCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCG
ATGCCCACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAG
AAGGGGCTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGTATTATCAAAGGGGCCCTGGAGTGGCTTCTGTTATTTGATGAGTGGC
CATTCCTATGGGTGTTTTGTCCTTTTGTCCTTTTTTGAACCATTTTTCTGTCTTACTAATCTACTTGAAACAAAGTTCACTTTCCCCTTT

>In-frame_WNK2_ENST00000427277_chr9_96021896_+_FAM120A_ENST00000340893_chr9_96259753_+_4317nt
ATGGCCACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTT
GAGAAAGTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTG
AGCCACGCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTC
TGGGTGGAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGAT
GAGGTGGCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTG
ATCCAGTGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCG
GTGCCCCTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTC
CTGCCACCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCG
CAGAGCAGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAG
GGGCCCGTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCC
CCCGCCTGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCC
ACGGGCCCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCC
GTGGTCCCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTC
CAGATGCCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCG
GGAATCGACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTG
ATCTTGCCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCC
CTGGCCATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCC
ATTCATTCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCC
CATCACACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCG
CAACCCACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCA
CAACCTGTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACA
CCAGGGAGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAG
GACACCTCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCA
ATTGGATATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGG
ATGGTGCCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCA
GGGGGCGCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAG
CAGAACAGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGC
CCCAACCACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCAT
ATCAGCGGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAA
GGCTCGTCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCG
ATGCCCACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAG
AAGGGGCTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGAC
CTGCCTCCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAG
AGACTTGCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAA
ACCCCGGAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAG
AACCGCAGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTG
CTCTGCTGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTG
TCCCCCAAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATG
AGTGGAGTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGG
AAGCTCTTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAG
GTAGAGAAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCC
TTCTACCCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGAGTCCAACCTATA
CCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCATTGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTC
CCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGAGGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGT
GGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGCAGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAA
CTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGACGGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCG
GCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCACTCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACA

>In-frame_WNK2_ENST00000427277_chr9_96021896_+_FAM120A_ENST00000333936_chr9_96259753_+_4539nt
ATGGCCACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTT
GAGAAAGTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTG
AGCCACGCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTC
TGGGTGGAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGAT
GAGGTGGCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTG
ATCCAGTGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCG
GTGCCCCTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTC
CTGCCACCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCG
CAGAGCAGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAG
GGGCCCGTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCC
CCCGCCTGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCC
ACGGGCCCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCC
GTGGTCCCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTC
CAGATGCCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCG
GGAATCGACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTG
ATCTTGCCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCC
CTGGCCATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCC
ATTCATTCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCC
CATCACACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCG
CAACCCACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCA
CAACCTGTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACA
CCAGGGAGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAG
GACACCTCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCA
ATTGGATATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGG
ATGGTGCCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCA
GGGGGCGCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAG
CAGAACAGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGC
CCCAACCACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAAGCCT
TTCCAACTCTACTTGCAAAAAAACTTTGTGTTTCACAAAGAGAATTCCATCGTGCTCTGCTCCAGGATCCTGAGGCATGGCCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCT
CCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTT
GCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCG
GAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGC
AGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGC
TGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCC
AAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGA
GTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTC
TTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAG
AAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTAC
CCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGCGTCTGTGGCTTTGGAGGC
CCCTATGGGGAAACGGTAGCAACAGGCCCTTACCGTGCCTTCCGTGTGGCGGCAGCATCGGGACACTGCGGAGCCTTCTCAGGCAGTGAC
AGCAGCAGGACTAGCAAGTCCCAGGGCGGAGTCCAACCTATACCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCAT
TGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGA
GGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGC
AGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGAC
GGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCAC
TCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCTCATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAA

>In-frame_WNK2_ENST00000297954_chr9_96021896_+_FAM120A_ENST00000277165_chr9_96259753_+_5619nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCT
CCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTT
GCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCG
GAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGC
AGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGC
TGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCC
AAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGA
GTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTC
TTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAG
AAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTAC
CCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGCGTCTGTGGCTTTGGAGGC
CCCTATGGGGAAACGGTAGCAACAGGCCCTTACCGTGCCTTCCGTGTGGCGGCAGCATCGGGACACTGCGGAGCCTTCTCAGGCAGTGAC
AGCAGCAGGACTAGCAAGTCCCAGGGCGGAGTCCAACCTATACCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCAT
TGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGA
GGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGC
AGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGAC
GGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCAC
TCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCTCATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAA

>In-frame_WNK2_ENST00000297954_chr9_96021896_+_FAM120A_ENST00000375389_chr9_96259753_+_4149nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGTATTATCAAAGGGGCCCTGGAGTGGCTTCTGTTATTTGATGAGTGGCCATTCC
TATGGGTGTTTTGTCCTTTTGTCCTTTTTTGAACCATTTTTCTGTCTTACTAATCTACTTGAAACAAAGTTCACTTTCCCCTTTCTAAAC

>In-frame_WNK2_ENST00000297954_chr9_96021896_+_FAM120A_ENST00000340893_chr9_96259753_+_5481nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCT
CCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTT
GCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCG
GAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGC
AGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGC
TGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCC
AAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGA
GTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTC
TTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAG
AAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTAC
CCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGAGTCCAACCTATACCTTCT
CAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCATTGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTG
CAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGAGGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGG
TACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGCAGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAG
TCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGACGGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCC
CAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCACTCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCT

>In-frame_WNK2_ENST00000297954_chr9_96021896_+_FAM120A_ENST00000333936_chr9_96259753_+_5703nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAAGCCTTTCCAA
CTCTACTTGCAAAAAAACTTTGTGTTTCACAAAGAGAATTCCATCGTGCTCTGCTCCAGGATCCTGAGGCATGGCCATATCAGCGGGAAC
AAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCGTCCACT
GCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCCACCAGG
AACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGGCTGATG
TACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCTCCGGCC
GCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTTGCTTTT
AGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCGGAACTG
GTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGCAGGATG
AGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGCTGCGTC
TTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCCAAACTC
TACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGAGTAGAC
ATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTCTTCCAA
TCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAGAAGATG
CGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTACCCTGCC
TCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGCGTCTGTGGCTTTGGAGGCCCCTAT
GGGGAAACGGTAGCAACAGGCCCTTACCGTGCCTTCCGTGTGGCGGCAGCATCGGGACACTGCGGAGCCTTCTCAGGCAGTGACAGCAGC
AGGACTAGCAAGTCCCAGGGCGGAGTCCAACCTATACCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCATTGGGCT
GGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGAGGAGTT
ATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGCAGACCT
CCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGACGGGTCC
CTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCACTCTGAA
AGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCTCATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAAGCTGCT

>In-frame_WNK2_ENST00000349097_chr9_96021896_+_FAM120A_ENST00000277165_chr9_96259753_+_4455nt
ATGGCCACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTT
GAGAAAGTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTG
AGCCACGCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTC
TGGGTGGAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGAT
GAGGTGGCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTG
ATCCAGTGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCG
GTGCCCCTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTC
CTGCCACCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCG
CAGAGCAGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAG
GGGCCCGTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCC
CCCGCCTGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCC
ACGGGCCCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCC
GTGGTCCCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTC
CAGATGCCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCG
GGAATCGACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTG
ATCTTGCCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCC
CTGGCCATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCC
ATTCATTCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCC
CATCACACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCG
CAACCCACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCA
CAACCTGTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACA
CCAGGGAGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAG
GACACCTCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCA
ATTGGATATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGG
ATGGTGCCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCA
GGGGGCGCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAG
CAGAACAGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGC
CCCAACCACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCAT
ATCAGCGGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAA
GGCTCGTCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCG
ATGCCCACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAG
AAGGGGCTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGAC
CTGCCTCCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAG
AGACTTGCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAA
ACCCCGGAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAG
AACCGCAGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTG
CTCTGCTGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTG
TCCCCCAAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATG
AGTGGAGTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGG
AAGCTCTTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAG
GTAGAGAAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCC
TTCTACCCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGCGTCTGTGGCTTT
GGAGGCCCCTATGGGGAAACGGTAGCAACAGGCCCTTACCGTGCCTTCCGTGTGGCGGCAGCATCGGGACACTGCGGAGCCTTCTCAGGC
AGTGACAGCAGCAGGACTAGCAAGTCCCAGGGCGGAGTCCAACCTATACCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTT
GGCCATTGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGT
CCAAGAGGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATT
CAGGGCAGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCT
TCAGACGGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCC
AGCCACTCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCTCATTTAAATGCACTAAGTACAGACAGCGCTTGCCGC

>In-frame_WNK2_ENST00000349097_chr9_96021896_+_FAM120A_ENST00000375389_chr9_96259753_+_2985nt
ATGGCCACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTT
GAGAAAGTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTG
AGCCACGCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTC
TGGGTGGAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGAT
GAGGTGGCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTG
ATCCAGTGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCG
GTGCCCCTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTC
CTGCCACCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCG
CAGAGCAGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAG
GGGCCCGTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCC
CCCGCCTGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCC
ACGGGCCCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCC
GTGGTCCCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTC
CAGATGCCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCG
GGAATCGACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTG
ATCTTGCCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCC
CTGGCCATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCC
ATTCATTCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCC
CATCACACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCG
CAACCCACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCA
CAACCTGTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACA
CCAGGGAGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAG
GACACCTCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCA
ATTGGATATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGG
ATGGTGCCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCA
GGGGGCGCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAG
CAGAACAGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGC
CCCAACCACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCAT
ATCAGCGGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAA
GGCTCGTCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCG
ATGCCCACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAG
AAGGGGCTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGTATTATCAAAGGGGCCCTGGAGTGGCTTCTGTTATTTGATGAGTGGC
CATTCCTATGGGTGTTTTGTCCTTTTGTCCTTTTTTGAACCATTTTTCTGTCTTACTAATCTACTTGAAACAAAGTTCACTTTCCCCTTT

>In-frame_WNK2_ENST00000349097_chr9_96021896_+_FAM120A_ENST00000340893_chr9_96259753_+_4317nt
ATGGCCACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTT
GAGAAAGTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTG
AGCCACGCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTC
TGGGTGGAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGAT
GAGGTGGCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTG
ATCCAGTGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCG
GTGCCCCTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTC
CTGCCACCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCG
CAGAGCAGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAG
GGGCCCGTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCC
CCCGCCTGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCC
ACGGGCCCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCC
GTGGTCCCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTC
CAGATGCCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCG
GGAATCGACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTG
ATCTTGCCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCC
CTGGCCATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCC
ATTCATTCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCC
CATCACACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCG
CAACCCACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCA
CAACCTGTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACA
CCAGGGAGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAG
GACACCTCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCA
ATTGGATATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGG
ATGGTGCCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCA
GGGGGCGCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAG
CAGAACAGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGC
CCCAACCACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCAT
ATCAGCGGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAA
GGCTCGTCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCG
ATGCCCACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAG
AAGGGGCTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGAC
CTGCCTCCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAG
AGACTTGCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAA
ACCCCGGAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAG
AACCGCAGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTG
CTCTGCTGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTG
TCCCCCAAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATG
AGTGGAGTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGG
AAGCTCTTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAG
GTAGAGAAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCC
TTCTACCCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGAGTCCAACCTATA
CCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCATTGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTC
CCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGAGGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGT
GGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGCAGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAA
CTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGACGGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCG
GCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCACTCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACA

>In-frame_WNK2_ENST00000349097_chr9_96021896_+_FAM120A_ENST00000333936_chr9_96259753_+_4539nt
ATGGCCACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTT
GAGAAAGTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTG
AGCCACGCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTC
TGGGTGGAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGAT
GAGGTGGCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTG
ATCCAGTGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCG
GTGCCCCTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTC
CTGCCACCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCG
CAGAGCAGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAG
GGGCCCGTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCC
CCCGCCTGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCC
ACGGGCCCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCC
GTGGTCCCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTC
CAGATGCCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCG
GGAATCGACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTG
ATCTTGCCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCC
CTGGCCATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCC
ATTCATTCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCC
CATCACACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCG
CAACCCACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCA
CAACCTGTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACA
CCAGGGAGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAG
GACACCTCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCA
ATTGGATATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGG
ATGGTGCCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCA
GGGGGCGCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAG
CAGAACAGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGC
CCCAACCACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAAGCCT
TTCCAACTCTACTTGCAAAAAAACTTTGTGTTTCACAAAGAGAATTCCATCGTGCTCTGCTCCAGGATCCTGAGGCATGGCCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCT
CCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTT
GCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCG
GAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGC
AGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGC
TGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCC
AAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGA
GTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTC
TTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAG
AAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTAC
CCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGCGTCTGTGGCTTTGGAGGC
CCCTATGGGGAAACGGTAGCAACAGGCCCTTACCGTGCCTTCCGTGTGGCGGCAGCATCGGGACACTGCGGAGCCTTCTCAGGCAGTGAC
AGCAGCAGGACTAGCAAGTCCCAGGGCGGAGTCCAACCTATACCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCAT
TGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGA
GGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGC
AGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGAC
GGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCAC
TCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCTCATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAA

>In-frame_WNK2_ENST00000395477_chr9_96021896_+_FAM120A_ENST00000277165_chr9_96259753_+_5619nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCT
CCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTT
GCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCG
GAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGC
AGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGC
TGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCC
AAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGA
GTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTC
TTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAG
AAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTAC
CCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGCGTCTGTGGCTTTGGAGGC
CCCTATGGGGAAACGGTAGCAACAGGCCCTTACCGTGCCTTCCGTGTGGCGGCAGCATCGGGACACTGCGGAGCCTTCTCAGGCAGTGAC
AGCAGCAGGACTAGCAAGTCCCAGGGCGGAGTCCAACCTATACCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCAT
TGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGA
GGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGC
AGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGAC
GGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCAC
TCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCTCATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAA

>In-frame_WNK2_ENST00000395477_chr9_96021896_+_FAM120A_ENST00000375389_chr9_96259753_+_4149nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGTATTATCAAAGGGGCCCTGGAGTGGCTTCTGTTATTTGATGAGTGGCCATTCC
TATGGGTGTTTTGTCCTTTTGTCCTTTTTTGAACCATTTTTCTGTCTTACTAATCTACTTGAAACAAAGTTCACTTTCCCCTTTCTAAAC

>In-frame_WNK2_ENST00000395477_chr9_96021896_+_FAM120A_ENST00000340893_chr9_96259753_+_5481nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCT
CCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTT
GCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCG
GAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGC
AGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGC
TGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCC
AAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGA
GTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTC
TTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAG
AAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTAC
CCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGAGTCCAACCTATACCTTCT
CAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCATTGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTG
CAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGAGGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGG
TACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGCAGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAG
TCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGACGGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCC
CAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCACTCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCT

>In-frame_WNK2_ENST00000395477_chr9_96021896_+_FAM120A_ENST00000333936_chr9_96259753_+_5703nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAAGCCTTTCCAA
CTCTACTTGCAAAAAAACTTTGTGTTTCACAAAGAGAATTCCATCGTGCTCTGCTCCAGGATCCTGAGGCATGGCCATATCAGCGGGAAC
AAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCGTCCACT
GCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCCACCAGG
AACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGGCTGATG
TACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCTCCGGCC
GCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTTGCTTTT
AGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCGGAACTG
GTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGCAGGATG
AGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGCTGCGTC
TTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCCAAACTC
TACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGAGTAGAC
ATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTCTTCCAA
TCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAGAAGATG
CGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTACCCTGCC
TCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGCGTCTGTGGCTTTGGAGGCCCCTAT
GGGGAAACGGTAGCAACAGGCCCTTACCGTGCCTTCCGTGTGGCGGCAGCATCGGGACACTGCGGAGCCTTCTCAGGCAGTGACAGCAGC
AGGACTAGCAAGTCCCAGGGCGGAGTCCAACCTATACCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCATTGGGCT
GGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGAGGAGTT
ATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGCAGACCT
CCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGACGGGTCC
CTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCACTCTGAA
AGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCTCATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAAGCTGCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_WNK2_ENST00000427277_chr9_96021896_+_FAM120A_ENST00000277165_chr9_96259753_+_7186nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCT
CCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTT
GCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCG
GAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGC
AGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGC
TGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCC
AAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGA
GTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTC
TTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAG
AAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTAC
CCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGCGTCTGTGGCTTTGGAGGC
CCCTATGGGGAAACGGTAGCAACAGGCCCTTACCGTGCCTTCCGTGTGGCGGCAGCATCGGGACACTGCGGAGCCTTCTCAGGCAGTGAC
AGCAGCAGGACTAGCAAGTCCCAGGGCGGAGTCCAACCTATACCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCAT
TGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGA
GGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGC
AGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGAC
GGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCAC
TCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCTCATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAA
GCTGCTCTGGAGGCAGCTGTCTTAAATAAAGAAGAGTAAACTTATTTTTTATAGAGGGTGAAGGATGCTGGAAGGGTAAGGATTTAGGAA
TATCTGGAGAGAAAGAGAGCCTGCAGTTATGTACATTTTGTCCTTTCCGTAAGAGAAAAATGAGGACTTTGGAAATTCAGATCCCTCTTT
GATATCAGAGATTTAAACAACACATTTTTAGTTTTAACCAGTTGTAGTCAAAATGCTACAATAAAACAAAAAAGAGAAAGAAAATGAAGA
GCATTTGACTCCCGCACTTAAAATGAAGTACACATAAAGTTTAAACTGGTTATGACAAAAGCCTTTAGTTGTGTTTCTTGAACTATAAAG
AAAACAAATTTTGGCAGTCTTTAAGTATATATAGCTTAAAATATAATTTTTAGCATTTGGCACCATATGTATGCCATTATATTTGATTTT
GCATTACTGTTTCACAATGAAGCTTTCTTTAAGGCTTTGATTTTTATGATTATGAAAGAAATAAGGCACAACCACAGTTTTTCTTTCTTA
AATTTCATCACTGTTGATGTGGTTCTTTTGTGTTAAAAAAAAAAAGTGCAACTATCAAAACTAAAAAATTATAGAGTAATATTGCCGTTC
TGCTGATTTTAAATATACAATACATCATACATACTTTACAAGCAAGTTAAATGGAGATAAAGTTGAAATCATAGAAGATGCAAATGACCT
TTCAAAATCAACACAATGTGTTCTGAAACTTTCGTGACTAATACCATGCATCTGTGATCAATGAACTATGTGGTTTTGAATCGGATGTAG
ACCATTAGTACTACTACTTGAGCTAAACTTCTGCATGGTTCATAATTTTTAAAGTGTGTAGTTAATATGCATGTTATCGTCCTTTCTTCC
ATTCTTAACAGTATGTGCCCATTTGCAAAACAAAAATGCTAATAATCAGTAATAGTCCTATAAAAGATGTTAACTCTGTTTAGTCATTGA
CTGATCTTGCTCTAACCTTAAAATTTTGTGATTATTGACCTCTGTTGCATTTATTCTAAAGCCCCCCAAAAATTATCTAGCCGTTTCGAA
TATCAACATTACCCTGGTGTATTCACTGCTGTATGCATTATTGTTCTTTGTTGCTGTTTTATGCCTTCATATTAGCAAATATGAAATTCT
GTGAAAAAAAACCCTTTGATCTTAAAAAAAAAAAAACCACCCCCCCCTTCTGTAGCAGGAAACAAATTGCTTGTTCTTGAGAACTTTCCC
ATCAAGAATTTAGTAGAAGCAGGTATACTTCTATCATTTTGATGTTTTTGTTAATGTTTCCAAACAATGTACTTTGAAATCAGAATCACT
TCTTATCGTTTTCATATACTTCTGATGCTCTTCATCACATTAGTGATCAGAAATGAGGTGTAATTCCCCAACCCCTGCCCGCAAGAGCTA
AGTAGGATCTTACTGTAAGTTGAAGGGAGTTTTGCCCTAACTCATGGATTGTGCAAGAATGAACTGCTGTTGGGTTTGATTGACTGTCGA

>In-frame_WNK2_ENST00000427277_chr9_96021896_+_FAM120A_ENST00000375389_chr9_96259753_+_5822nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGTATTATCAAAGGGGCCCTGGAGTGGCTTCTGTTATTTGATGAGTGGCCATTCC
TATGGGTGTTTTGTCCTTTTGTCCTTTTTTGAACCATTTTTCTGTCTTACTAATCTACTTGAAACAAAGTTCACTTTCCCCTTTCTAAAC
ATTGAATGAAAGATGAACATTTATAACTGTAAATAGTTTTAAAATAACTCGTGAAAAGTCTCACTTTTTTCCTTCAACTTAGTATAGAAT
ATTTTATACTTCTAATGAAATAATGCATCACATTATTTTATGACTTGTAATTTTATTCTTTTTACTTCAATTTCAGAATTTTCTTAAACC
ATATTTGTGCTGTAATGTCAGGTTTAATTCTGATGTCAGATACAATATCTGGTTCCTTTATCATTTGTGCTTAGAAAATAATGTTTCCCC
CTTTGAATGGCTCATAGTGCTTCATGTGTTTTGACTTGTTCATGACCTCATTGAGTGCAGTTTTAATAGTGCTAAGAACAAAAAATATAA
TACAGGATTTTGTTAACATACGCATAGTCAGAAAATGAAACTATCATTTTATACAGTGTCATAATTTCACTTTATTAGTGTCTTAATGTA
TGCTTAAATATATACATATAGTGTGGCATCAATTATTTTTTAATCTTGGTGTCTCAAATGTATCTATGTGTATTTAAATTTCCTCAGTGA
TTTGTAGTCTTTATGTTGGCACTTTTAATCTTAGCCCCACAATTTAACAAGTTACCTCAGTTACTAGATTAATCCTGCAGAACTGGTTTA
TTGCTATCATGTATTATTAACATGAATACCTATATGACCATATATAACCAGACTTTTCTGTCTATTCTCTACAACCCATCTGTGGTTTGT
AAAATGGAGTCAATAAATGCAATAATGAACTCCTGTTCTCAAATACTCCTGAGGTGGACTTCAACTGTTAACTGACTAATCCAAATATTG
CTTACTTTTATTAATTAAAGGACATGGAAAACATGTAGCCAGTACTATTTGCTCAGATCCTTTAATTTATTTTTTAGTTGTAATGCCTCC
AAATCTCATCTATTATTTGATATGGGTATGCATTTATAGTATCACTTTTCAGATTATGGTTGTAAGGTGAACATTTTATTTTTCAGGTTC
AACATAAATTATAAAGGGTAAGTGAAAAGTAATTGTTGTGGGGAAAACATTTTGCTAAGTTTAAGGAACCAAAGTTTTGGGAAGACATCT
TTCAAAATAAGGTGTGAAGAAACAACACTCATTCCTCGTGGGGCTGTTTGAAATGTAAGGTCCCCAGGAGCTACCTGTTATGTCCACACT
GCTGGATCTGATGCGTGGATAGTCGGTTAGATCTATATGAGGGTTGCAAATTGTACCGACATGCTTTCTTATTTCTTATGAATTTCAAGG
GCAAATACTGATAAAATGACCATGGTTGAGAAAATTGTCTTTTCACATTTTAAAATGCTACTTAAGTTTTTTCAGTTTATCCTATAAGCT
GAATGGCTCTGGTATTAATTGCCCAGGCTAAGACATTTACAGTGAGATGCATCTTTATGGTAATGAAGAGAATTTGCAAAGCATCATATT
ATTGAGATAAATATTCCCTAGATGAGAGTGTTAGAACACATGTAGCTACTGGATTAATGAATATGAAAGTATGGAGGGTAAGGGGAAAGA
CCAGTTTTTAAATTAAACTTATGTGAATGAAAGAAACAGCAAATATTACAAAATTATTATTTAAAGCATATATATCAATGAACTTCATAG

>In-frame_WNK2_ENST00000427277_chr9_96021896_+_FAM120A_ENST00000340893_chr9_96259753_+_7056nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCT
CCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTT
GCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCG
GAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGC
AGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGC
TGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCC
AAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGA
GTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTC
TTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAG
AAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTAC
CCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGAGTCCAACCTATACCTTCT
CAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCATTGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTG
CAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGAGGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGG
TACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGCAGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAG
TCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGACGGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCC
CAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCACTCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCT
CATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAAGCTGCTCTGGAGGCAGCTGTCTTAAATAAAGAAGAGTAAACTTATTTT
TTATAGAGGGTGAAGGATGCTGGAAGGGTAAGGATTTAGGAATATCTGGAGAGAAAGAGAGCCTGCAGTTATGTACATTTTGTCCTTTCC
GTAAGAGAAAAATGAGGACTTTGGAAATTCAGATCCCTCTTTGATATCAGAGATTTAAACAACACATTTTTAGTTTTAACCAGTTGTAGT
CAAAATGCTACAATAAAACAAAAAAGAGAAAGAAAATGAAGAGCATTTGACTCCCGCACTTAAAATGAAGTACACATAAAGTTTAAACTG
GTTATGACAAAAGCCTTTAGTTGTGTTTCTTGAACTATAAAGAAAACAAATTTTGGCAGTCTTTAAGTATATATAGCTTAAAATATAATT
TTTAGCATTTGGCACCATATGTATGCCATTATATTTGATTTTGCATTACTGTTTCACAATGAAGCTTTCTTTAAGGCTTTGATTTTTATG
ATTATGAAAGAAATAAGGCACAACCACAGTTTTTCTTTCTTAAATTTCATCACTGTTGATGTGGTTCTTTTGTGTTAAAAAAAAAAAGTG
CAACTATCAAAACTAAAAAATTATAGAGTAATATTGCCGTTCTGCTGATTTTAAATATACAATACATCATACATACTTTACAAGCAAGTT
AAATGGAGATAAAGTTGAAATCATAGAAGATGCAAATGACCTTTCAAAATCAACACAATGTGTTCTGAAACTTTCGTGACTAATACCATG
CATCTGTGATCAATGAACTATGTGGTTTTGAATCGGATGTAGACCATTAGTACTACTACTTGAGCTAAACTTCTGCATGGTTCATAATTT
TTAAAGTGTGTAGTTAATATGCATGTTATCGTCCTTTCTTCCATTCTTAACAGTATGTGCCCATTTGCAAAACAAAAATGCTAATAATCA
GTAATAGTCCTATAAAAGATGTTAACTCTGTTTAGTCATTGACTGATCTTGCTCTAACCTTAAAATTTTGTGATTATTGACCTCTGTTGC
ATTTATTCTAAAGCCCCCCAAAAATTATCTAGCCGTTTCGAATATCAACATTACCCTGGTGTATTCACTGCTGTATGCATTATTGTTCTT
TGTTGCTGTTTTATGCCTTCATATTAGCAAATATGAAATTCTGTGAAAAAAAACCCTTTGATCTTAAAAAAAAAAAAACCACCCCCCCCT
TCTGTAGCAGGAAACAAATTGCTTGTTCTTGAGAACTTTCCCATCAAGAATTTAGTAGAAGCAGGTATACTTCTATCATTTTGATGTTTT
TGTTAATGTTTCCAAACAATGTACTTTGAAATCAGAATCACTTCTTATCGTTTTCATATACTTCTGATGCTCTTCATCACATTAGTGATC
AGAAATGAGGTGTAATTCCCCAACCCCTGCCCGCAAGAGCTAAGTAGGATCTTACTGTAAGTTGAAGGGAGTTTTGCCCTAACTCATGGA
TTGTGCAAGAATGAACTGCTGTTGGGTTTGATTGACTGTCGATGGATTGTGGTGTGGTGTATCTGAAGGCTATTGAATGCAACTTACAAT

>In-frame_WNK2_ENST00000427277_chr9_96021896_+_FAM120A_ENST00000333936_chr9_96259753_+_7278nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAAGCCTTTCCAA
CTCTACTTGCAAAAAAACTTTGTGTTTCACAAAGAGAATTCCATCGTGCTCTGCTCCAGGATCCTGAGGCATGGCCATATCAGCGGGAAC
AAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCGTCCACT
GCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCCACCAGG
AACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGGCTGATG
TACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCTCCGGCC
GCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTTGCTTTT
AGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCGGAACTG
GTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGCAGGATG
AGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGCTGCGTC
TTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCCAAACTC
TACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGAGTAGAC
ATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTCTTCCAA
TCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAGAAGATG
CGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTACCCTGCC
TCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGCGTCTGTGGCTTTGGAGGCCCCTAT
GGGGAAACGGTAGCAACAGGCCCTTACCGTGCCTTCCGTGTGGCGGCAGCATCGGGACACTGCGGAGCCTTCTCAGGCAGTGACAGCAGC
AGGACTAGCAAGTCCCAGGGCGGAGTCCAACCTATACCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCATTGGGCT
GGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGAGGAGTT
ATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGCAGACCT
CCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGACGGGTCC
CTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCACTCTGAA
AGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCTCATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAAGCTGCT
CTGGAGGCAGCTGTCTTAAATAAAGAAGAGTAAACTTATTTTTTATAGAGGGTGAAGGATGCTGGAAGGGTAAGGATTTAGGAATATCTG
GAGAGAAAGAGAGCCTGCAGTTATGTACATTTTGTCCTTTCCGTAAGAGAAAAATGAGGACTTTGGAAATTCAGATCCCTCTTTGATATC
AGAGATTTAAACAACACATTTTTAGTTTTAACCAGTTGTAGTCAAAATGCTACAATAAAACAAAAAAGAGAAAGAAAATGAAGAGCATTT
GACTCCCGCACTTAAAATGAAGTACACATAAAGTTTAAACTGGTTATGACAAAAGCCTTTAGTTGTGTTTCTTGAACTATAAAGAAAACA
AATTTTGGCAGTCTTTAAGTATATATAGCTTAAAATATAATTTTTAGCATTTGGCACCATATGTATGCCATTATATTTGATTTTGCATTA
CTGTTTCACAATGAAGCTTTCTTTAAGGCTTTGATTTTTATGATTATGAAAGAAATAAGGCACAACCACAGTTTTTCTTTCTTAAATTTC
ATCACTGTTGATGTGGTTCTTTTGTGTTAAAAAAAAAAAGTGCAACTATCAAAACTAAAAAATTATAGAGTAATATTGCCGTTCTGCTGA
TTTTAAATATACAATACATCATACATACTTTACAAGCAAGTTAAATGGAGATAAAGTTGAAATCATAGAAGATGCAAATGACCTTTCAAA
ATCAACACAATGTGTTCTGAAACTTTCGTGACTAATACCATGCATCTGTGATCAATGAACTATGTGGTTTTGAATCGGATGTAGACCATT
AGTACTACTACTTGAGCTAAACTTCTGCATGGTTCATAATTTTTAAAGTGTGTAGTTAATATGCATGTTATCGTCCTTTCTTCCATTCTT
AACAGTATGTGCCCATTTGCAAAACAAAAATGCTAATAATCAGTAATAGTCCTATAAAAGATGTTAACTCTGTTTAGTCATTGACTGATC
TTGCTCTAACCTTAAAATTTTGTGATTATTGACCTCTGTTGCATTTATTCTAAAGCCCCCCAAAAATTATCTAGCCGTTTCGAATATCAA
CATTACCCTGGTGTATTCACTGCTGTATGCATTATTGTTCTTTGTTGCTGTTTTATGCCTTCATATTAGCAAATATGAAATTCTGTGAAA
AAAAACCCTTTGATCTTAAAAAAAAAAAAACCACCCCCCCCTTCTGTAGCAGGAAACAAATTGCTTGTTCTTGAGAACTTTCCCATCAAG
AATTTAGTAGAAGCAGGTATACTTCTATCATTTTGATGTTTTTGTTAATGTTTCCAAACAATGTACTTTGAAATCAGAATCACTTCTTAT
CGTTTTCATATACTTCTGATGCTCTTCATCACATTAGTGATCAGAAATGAGGTGTAATTCCCCAACCCCTGCCCGCAAGAGCTAAGTAGG
ATCTTACTGTAAGTTGAAGGGAGTTTTGCCCTAACTCATGGATTGTGCAAGAATGAACTGCTGTTGGGTTTGATTGACTGTCGATGGATT

>In-frame_WNK2_ENST00000297954_chr9_96021896_+_FAM120A_ENST00000277165_chr9_96259753_+_7186nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCT
CCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTT
GCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCG
GAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGC
AGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGC
TGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCC
AAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGA
GTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTC
TTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAG
AAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTAC
CCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGCGTCTGTGGCTTTGGAGGC
CCCTATGGGGAAACGGTAGCAACAGGCCCTTACCGTGCCTTCCGTGTGGCGGCAGCATCGGGACACTGCGGAGCCTTCTCAGGCAGTGAC
AGCAGCAGGACTAGCAAGTCCCAGGGCGGAGTCCAACCTATACCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCAT
TGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGA
GGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGC
AGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGAC
GGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCAC
TCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCTCATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAA
GCTGCTCTGGAGGCAGCTGTCTTAAATAAAGAAGAGTAAACTTATTTTTTATAGAGGGTGAAGGATGCTGGAAGGGTAAGGATTTAGGAA
TATCTGGAGAGAAAGAGAGCCTGCAGTTATGTACATTTTGTCCTTTCCGTAAGAGAAAAATGAGGACTTTGGAAATTCAGATCCCTCTTT
GATATCAGAGATTTAAACAACACATTTTTAGTTTTAACCAGTTGTAGTCAAAATGCTACAATAAAACAAAAAAGAGAAAGAAAATGAAGA
GCATTTGACTCCCGCACTTAAAATGAAGTACACATAAAGTTTAAACTGGTTATGACAAAAGCCTTTAGTTGTGTTTCTTGAACTATAAAG
AAAACAAATTTTGGCAGTCTTTAAGTATATATAGCTTAAAATATAATTTTTAGCATTTGGCACCATATGTATGCCATTATATTTGATTTT
GCATTACTGTTTCACAATGAAGCTTTCTTTAAGGCTTTGATTTTTATGATTATGAAAGAAATAAGGCACAACCACAGTTTTTCTTTCTTA
AATTTCATCACTGTTGATGTGGTTCTTTTGTGTTAAAAAAAAAAAGTGCAACTATCAAAACTAAAAAATTATAGAGTAATATTGCCGTTC
TGCTGATTTTAAATATACAATACATCATACATACTTTACAAGCAAGTTAAATGGAGATAAAGTTGAAATCATAGAAGATGCAAATGACCT
TTCAAAATCAACACAATGTGTTCTGAAACTTTCGTGACTAATACCATGCATCTGTGATCAATGAACTATGTGGTTTTGAATCGGATGTAG
ACCATTAGTACTACTACTTGAGCTAAACTTCTGCATGGTTCATAATTTTTAAAGTGTGTAGTTAATATGCATGTTATCGTCCTTTCTTCC
ATTCTTAACAGTATGTGCCCATTTGCAAAACAAAAATGCTAATAATCAGTAATAGTCCTATAAAAGATGTTAACTCTGTTTAGTCATTGA
CTGATCTTGCTCTAACCTTAAAATTTTGTGATTATTGACCTCTGTTGCATTTATTCTAAAGCCCCCCAAAAATTATCTAGCCGTTTCGAA
TATCAACATTACCCTGGTGTATTCACTGCTGTATGCATTATTGTTCTTTGTTGCTGTTTTATGCCTTCATATTAGCAAATATGAAATTCT
GTGAAAAAAAACCCTTTGATCTTAAAAAAAAAAAAACCACCCCCCCCTTCTGTAGCAGGAAACAAATTGCTTGTTCTTGAGAACTTTCCC
ATCAAGAATTTAGTAGAAGCAGGTATACTTCTATCATTTTGATGTTTTTGTTAATGTTTCCAAACAATGTACTTTGAAATCAGAATCACT
TCTTATCGTTTTCATATACTTCTGATGCTCTTCATCACATTAGTGATCAGAAATGAGGTGTAATTCCCCAACCCCTGCCCGCAAGAGCTA
AGTAGGATCTTACTGTAAGTTGAAGGGAGTTTTGCCCTAACTCATGGATTGTGCAAGAATGAACTGCTGTTGGGTTTGATTGACTGTCGA

>In-frame_WNK2_ENST00000297954_chr9_96021896_+_FAM120A_ENST00000375389_chr9_96259753_+_5822nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGTATTATCAAAGGGGCCCTGGAGTGGCTTCTGTTATTTGATGAGTGGCCATTCC
TATGGGTGTTTTGTCCTTTTGTCCTTTTTTGAACCATTTTTCTGTCTTACTAATCTACTTGAAACAAAGTTCACTTTCCCCTTTCTAAAC
ATTGAATGAAAGATGAACATTTATAACTGTAAATAGTTTTAAAATAACTCGTGAAAAGTCTCACTTTTTTCCTTCAACTTAGTATAGAAT
ATTTTATACTTCTAATGAAATAATGCATCACATTATTTTATGACTTGTAATTTTATTCTTTTTACTTCAATTTCAGAATTTTCTTAAACC
ATATTTGTGCTGTAATGTCAGGTTTAATTCTGATGTCAGATACAATATCTGGTTCCTTTATCATTTGTGCTTAGAAAATAATGTTTCCCC
CTTTGAATGGCTCATAGTGCTTCATGTGTTTTGACTTGTTCATGACCTCATTGAGTGCAGTTTTAATAGTGCTAAGAACAAAAAATATAA
TACAGGATTTTGTTAACATACGCATAGTCAGAAAATGAAACTATCATTTTATACAGTGTCATAATTTCACTTTATTAGTGTCTTAATGTA
TGCTTAAATATATACATATAGTGTGGCATCAATTATTTTTTAATCTTGGTGTCTCAAATGTATCTATGTGTATTTAAATTTCCTCAGTGA
TTTGTAGTCTTTATGTTGGCACTTTTAATCTTAGCCCCACAATTTAACAAGTTACCTCAGTTACTAGATTAATCCTGCAGAACTGGTTTA
TTGCTATCATGTATTATTAACATGAATACCTATATGACCATATATAACCAGACTTTTCTGTCTATTCTCTACAACCCATCTGTGGTTTGT
AAAATGGAGTCAATAAATGCAATAATGAACTCCTGTTCTCAAATACTCCTGAGGTGGACTTCAACTGTTAACTGACTAATCCAAATATTG
CTTACTTTTATTAATTAAAGGACATGGAAAACATGTAGCCAGTACTATTTGCTCAGATCCTTTAATTTATTTTTTAGTTGTAATGCCTCC
AAATCTCATCTATTATTTGATATGGGTATGCATTTATAGTATCACTTTTCAGATTATGGTTGTAAGGTGAACATTTTATTTTTCAGGTTC
AACATAAATTATAAAGGGTAAGTGAAAAGTAATTGTTGTGGGGAAAACATTTTGCTAAGTTTAAGGAACCAAAGTTTTGGGAAGACATCT
TTCAAAATAAGGTGTGAAGAAACAACACTCATTCCTCGTGGGGCTGTTTGAAATGTAAGGTCCCCAGGAGCTACCTGTTATGTCCACACT
GCTGGATCTGATGCGTGGATAGTCGGTTAGATCTATATGAGGGTTGCAAATTGTACCGACATGCTTTCTTATTTCTTATGAATTTCAAGG
GCAAATACTGATAAAATGACCATGGTTGAGAAAATTGTCTTTTCACATTTTAAAATGCTACTTAAGTTTTTTCAGTTTATCCTATAAGCT
GAATGGCTCTGGTATTAATTGCCCAGGCTAAGACATTTACAGTGAGATGCATCTTTATGGTAATGAAGAGAATTTGCAAAGCATCATATT
ATTGAGATAAATATTCCCTAGATGAGAGTGTTAGAACACATGTAGCTACTGGATTAATGAATATGAAAGTATGGAGGGTAAGGGGAAAGA
CCAGTTTTTAAATTAAACTTATGTGAATGAAAGAAACAGCAAATATTACAAAATTATTATTTAAAGCATATATATCAATGAACTTCATAG

>In-frame_WNK2_ENST00000297954_chr9_96021896_+_FAM120A_ENST00000340893_chr9_96259753_+_7056nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCT
CCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTT
GCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCG
GAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGC
AGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGC
TGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCC
AAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGA
GTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTC
TTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAG
AAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTAC
CCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGAGTCCAACCTATACCTTCT
CAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCATTGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTG
CAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGAGGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGG
TACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGCAGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAG
TCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGACGGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCC
CAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCACTCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCT
CATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAAGCTGCTCTGGAGGCAGCTGTCTTAAATAAAGAAGAGTAAACTTATTTT
TTATAGAGGGTGAAGGATGCTGGAAGGGTAAGGATTTAGGAATATCTGGAGAGAAAGAGAGCCTGCAGTTATGTACATTTTGTCCTTTCC
GTAAGAGAAAAATGAGGACTTTGGAAATTCAGATCCCTCTTTGATATCAGAGATTTAAACAACACATTTTTAGTTTTAACCAGTTGTAGT
CAAAATGCTACAATAAAACAAAAAAGAGAAAGAAAATGAAGAGCATTTGACTCCCGCACTTAAAATGAAGTACACATAAAGTTTAAACTG
GTTATGACAAAAGCCTTTAGTTGTGTTTCTTGAACTATAAAGAAAACAAATTTTGGCAGTCTTTAAGTATATATAGCTTAAAATATAATT
TTTAGCATTTGGCACCATATGTATGCCATTATATTTGATTTTGCATTACTGTTTCACAATGAAGCTTTCTTTAAGGCTTTGATTTTTATG
ATTATGAAAGAAATAAGGCACAACCACAGTTTTTCTTTCTTAAATTTCATCACTGTTGATGTGGTTCTTTTGTGTTAAAAAAAAAAAGTG
CAACTATCAAAACTAAAAAATTATAGAGTAATATTGCCGTTCTGCTGATTTTAAATATACAATACATCATACATACTTTACAAGCAAGTT
AAATGGAGATAAAGTTGAAATCATAGAAGATGCAAATGACCTTTCAAAATCAACACAATGTGTTCTGAAACTTTCGTGACTAATACCATG
CATCTGTGATCAATGAACTATGTGGTTTTGAATCGGATGTAGACCATTAGTACTACTACTTGAGCTAAACTTCTGCATGGTTCATAATTT
TTAAAGTGTGTAGTTAATATGCATGTTATCGTCCTTTCTTCCATTCTTAACAGTATGTGCCCATTTGCAAAACAAAAATGCTAATAATCA
GTAATAGTCCTATAAAAGATGTTAACTCTGTTTAGTCATTGACTGATCTTGCTCTAACCTTAAAATTTTGTGATTATTGACCTCTGTTGC
ATTTATTCTAAAGCCCCCCAAAAATTATCTAGCCGTTTCGAATATCAACATTACCCTGGTGTATTCACTGCTGTATGCATTATTGTTCTT
TGTTGCTGTTTTATGCCTTCATATTAGCAAATATGAAATTCTGTGAAAAAAAACCCTTTGATCTTAAAAAAAAAAAAACCACCCCCCCCT
TCTGTAGCAGGAAACAAATTGCTTGTTCTTGAGAACTTTCCCATCAAGAATTTAGTAGAAGCAGGTATACTTCTATCATTTTGATGTTTT
TGTTAATGTTTCCAAACAATGTACTTTGAAATCAGAATCACTTCTTATCGTTTTCATATACTTCTGATGCTCTTCATCACATTAGTGATC
AGAAATGAGGTGTAATTCCCCAACCCCTGCCCGCAAGAGCTAAGTAGGATCTTACTGTAAGTTGAAGGGAGTTTTGCCCTAACTCATGGA
TTGTGCAAGAATGAACTGCTGTTGGGTTTGATTGACTGTCGATGGATTGTGGTGTGGTGTATCTGAAGGCTATTGAATGCAACTTACAAT

>In-frame_WNK2_ENST00000297954_chr9_96021896_+_FAM120A_ENST00000333936_chr9_96259753_+_7278nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAAGCCTTTCCAA
CTCTACTTGCAAAAAAACTTTGTGTTTCACAAAGAGAATTCCATCGTGCTCTGCTCCAGGATCCTGAGGCATGGCCATATCAGCGGGAAC
AAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCGTCCACT
GCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCCACCAGG
AACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGGCTGATG
TACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCTCCGGCC
GCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTTGCTTTT
AGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCGGAACTG
GTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGCAGGATG
AGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGCTGCGTC
TTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCCAAACTC
TACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGAGTAGAC
ATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTCTTCCAA
TCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAGAAGATG
CGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTACCCTGCC
TCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGCGTCTGTGGCTTTGGAGGCCCCTAT
GGGGAAACGGTAGCAACAGGCCCTTACCGTGCCTTCCGTGTGGCGGCAGCATCGGGACACTGCGGAGCCTTCTCAGGCAGTGACAGCAGC
AGGACTAGCAAGTCCCAGGGCGGAGTCCAACCTATACCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCATTGGGCT
GGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGAGGAGTT
ATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGCAGACCT
CCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGACGGGTCC
CTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCACTCTGAA
AGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCTCATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAAGCTGCT
CTGGAGGCAGCTGTCTTAAATAAAGAAGAGTAAACTTATTTTTTATAGAGGGTGAAGGATGCTGGAAGGGTAAGGATTTAGGAATATCTG
GAGAGAAAGAGAGCCTGCAGTTATGTACATTTTGTCCTTTCCGTAAGAGAAAAATGAGGACTTTGGAAATTCAGATCCCTCTTTGATATC
AGAGATTTAAACAACACATTTTTAGTTTTAACCAGTTGTAGTCAAAATGCTACAATAAAACAAAAAAGAGAAAGAAAATGAAGAGCATTT
GACTCCCGCACTTAAAATGAAGTACACATAAAGTTTAAACTGGTTATGACAAAAGCCTTTAGTTGTGTTTCTTGAACTATAAAGAAAACA
AATTTTGGCAGTCTTTAAGTATATATAGCTTAAAATATAATTTTTAGCATTTGGCACCATATGTATGCCATTATATTTGATTTTGCATTA
CTGTTTCACAATGAAGCTTTCTTTAAGGCTTTGATTTTTATGATTATGAAAGAAATAAGGCACAACCACAGTTTTTCTTTCTTAAATTTC
ATCACTGTTGATGTGGTTCTTTTGTGTTAAAAAAAAAAAGTGCAACTATCAAAACTAAAAAATTATAGAGTAATATTGCCGTTCTGCTGA
TTTTAAATATACAATACATCATACATACTTTACAAGCAAGTTAAATGGAGATAAAGTTGAAATCATAGAAGATGCAAATGACCTTTCAAA
ATCAACACAATGTGTTCTGAAACTTTCGTGACTAATACCATGCATCTGTGATCAATGAACTATGTGGTTTTGAATCGGATGTAGACCATT
AGTACTACTACTTGAGCTAAACTTCTGCATGGTTCATAATTTTTAAAGTGTGTAGTTAATATGCATGTTATCGTCCTTTCTTCCATTCTT
AACAGTATGTGCCCATTTGCAAAACAAAAATGCTAATAATCAGTAATAGTCCTATAAAAGATGTTAACTCTGTTTAGTCATTGACTGATC
TTGCTCTAACCTTAAAATTTTGTGATTATTGACCTCTGTTGCATTTATTCTAAAGCCCCCCAAAAATTATCTAGCCGTTTCGAATATCAA
CATTACCCTGGTGTATTCACTGCTGTATGCATTATTGTTCTTTGTTGCTGTTTTATGCCTTCATATTAGCAAATATGAAATTCTGTGAAA
AAAAACCCTTTGATCTTAAAAAAAAAAAAACCACCCCCCCCTTCTGTAGCAGGAAACAAATTGCTTGTTCTTGAGAACTTTCCCATCAAG
AATTTAGTAGAAGCAGGTATACTTCTATCATTTTGATGTTTTTGTTAATGTTTCCAAACAATGTACTTTGAAATCAGAATCACTTCTTAT
CGTTTTCATATACTTCTGATGCTCTTCATCACATTAGTGATCAGAAATGAGGTGTAATTCCCCAACCCCTGCCCGCAAGAGCTAAGTAGG
ATCTTACTGTAAGTTGAAGGGAGTTTTGCCCTAACTCATGGATTGTGCAAGAATGAACTGCTGTTGGGTTTGATTGACTGTCGATGGATT

>In-frame_WNK2_ENST00000349097_chr9_96021896_+_FAM120A_ENST00000277165_chr9_96259753_+_7186nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCT
CCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTT
GCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCG
GAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGC
AGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGC
TGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCC
AAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGA
GTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTC
TTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAG
AAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTAC
CCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGCGTCTGTGGCTTTGGAGGC
CCCTATGGGGAAACGGTAGCAACAGGCCCTTACCGTGCCTTCCGTGTGGCGGCAGCATCGGGACACTGCGGAGCCTTCTCAGGCAGTGAC
AGCAGCAGGACTAGCAAGTCCCAGGGCGGAGTCCAACCTATACCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCAT
TGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGA
GGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGC
AGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGAC
GGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCAC
TCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCTCATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAA
GCTGCTCTGGAGGCAGCTGTCTTAAATAAAGAAGAGTAAACTTATTTTTTATAGAGGGTGAAGGATGCTGGAAGGGTAAGGATTTAGGAA
TATCTGGAGAGAAAGAGAGCCTGCAGTTATGTACATTTTGTCCTTTCCGTAAGAGAAAAATGAGGACTTTGGAAATTCAGATCCCTCTTT
GATATCAGAGATTTAAACAACACATTTTTAGTTTTAACCAGTTGTAGTCAAAATGCTACAATAAAACAAAAAAGAGAAAGAAAATGAAGA
GCATTTGACTCCCGCACTTAAAATGAAGTACACATAAAGTTTAAACTGGTTATGACAAAAGCCTTTAGTTGTGTTTCTTGAACTATAAAG
AAAACAAATTTTGGCAGTCTTTAAGTATATATAGCTTAAAATATAATTTTTAGCATTTGGCACCATATGTATGCCATTATATTTGATTTT
GCATTACTGTTTCACAATGAAGCTTTCTTTAAGGCTTTGATTTTTATGATTATGAAAGAAATAAGGCACAACCACAGTTTTTCTTTCTTA
AATTTCATCACTGTTGATGTGGTTCTTTTGTGTTAAAAAAAAAAAGTGCAACTATCAAAACTAAAAAATTATAGAGTAATATTGCCGTTC
TGCTGATTTTAAATATACAATACATCATACATACTTTACAAGCAAGTTAAATGGAGATAAAGTTGAAATCATAGAAGATGCAAATGACCT
TTCAAAATCAACACAATGTGTTCTGAAACTTTCGTGACTAATACCATGCATCTGTGATCAATGAACTATGTGGTTTTGAATCGGATGTAG
ACCATTAGTACTACTACTTGAGCTAAACTTCTGCATGGTTCATAATTTTTAAAGTGTGTAGTTAATATGCATGTTATCGTCCTTTCTTCC
ATTCTTAACAGTATGTGCCCATTTGCAAAACAAAAATGCTAATAATCAGTAATAGTCCTATAAAAGATGTTAACTCTGTTTAGTCATTGA
CTGATCTTGCTCTAACCTTAAAATTTTGTGATTATTGACCTCTGTTGCATTTATTCTAAAGCCCCCCAAAAATTATCTAGCCGTTTCGAA
TATCAACATTACCCTGGTGTATTCACTGCTGTATGCATTATTGTTCTTTGTTGCTGTTTTATGCCTTCATATTAGCAAATATGAAATTCT
GTGAAAAAAAACCCTTTGATCTTAAAAAAAAAAAAACCACCCCCCCCTTCTGTAGCAGGAAACAAATTGCTTGTTCTTGAGAACTTTCCC
ATCAAGAATTTAGTAGAAGCAGGTATACTTCTATCATTTTGATGTTTTTGTTAATGTTTCCAAACAATGTACTTTGAAATCAGAATCACT
TCTTATCGTTTTCATATACTTCTGATGCTCTTCATCACATTAGTGATCAGAAATGAGGTGTAATTCCCCAACCCCTGCCCGCAAGAGCTA
AGTAGGATCTTACTGTAAGTTGAAGGGAGTTTTGCCCTAACTCATGGATTGTGCAAGAATGAACTGCTGTTGGGTTTGATTGACTGTCGA

>In-frame_WNK2_ENST00000349097_chr9_96021896_+_FAM120A_ENST00000375389_chr9_96259753_+_5822nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGTATTATCAAAGGGGCCCTGGAGTGGCTTCTGTTATTTGATGAGTGGCCATTCC
TATGGGTGTTTTGTCCTTTTGTCCTTTTTTGAACCATTTTTCTGTCTTACTAATCTACTTGAAACAAAGTTCACTTTCCCCTTTCTAAAC
ATTGAATGAAAGATGAACATTTATAACTGTAAATAGTTTTAAAATAACTCGTGAAAAGTCTCACTTTTTTCCTTCAACTTAGTATAGAAT
ATTTTATACTTCTAATGAAATAATGCATCACATTATTTTATGACTTGTAATTTTATTCTTTTTACTTCAATTTCAGAATTTTCTTAAACC
ATATTTGTGCTGTAATGTCAGGTTTAATTCTGATGTCAGATACAATATCTGGTTCCTTTATCATTTGTGCTTAGAAAATAATGTTTCCCC
CTTTGAATGGCTCATAGTGCTTCATGTGTTTTGACTTGTTCATGACCTCATTGAGTGCAGTTTTAATAGTGCTAAGAACAAAAAATATAA
TACAGGATTTTGTTAACATACGCATAGTCAGAAAATGAAACTATCATTTTATACAGTGTCATAATTTCACTTTATTAGTGTCTTAATGTA
TGCTTAAATATATACATATAGTGTGGCATCAATTATTTTTTAATCTTGGTGTCTCAAATGTATCTATGTGTATTTAAATTTCCTCAGTGA
TTTGTAGTCTTTATGTTGGCACTTTTAATCTTAGCCCCACAATTTAACAAGTTACCTCAGTTACTAGATTAATCCTGCAGAACTGGTTTA
TTGCTATCATGTATTATTAACATGAATACCTATATGACCATATATAACCAGACTTTTCTGTCTATTCTCTACAACCCATCTGTGGTTTGT
AAAATGGAGTCAATAAATGCAATAATGAACTCCTGTTCTCAAATACTCCTGAGGTGGACTTCAACTGTTAACTGACTAATCCAAATATTG
CTTACTTTTATTAATTAAAGGACATGGAAAACATGTAGCCAGTACTATTTGCTCAGATCCTTTAATTTATTTTTTAGTTGTAATGCCTCC
AAATCTCATCTATTATTTGATATGGGTATGCATTTATAGTATCACTTTTCAGATTATGGTTGTAAGGTGAACATTTTATTTTTCAGGTTC
AACATAAATTATAAAGGGTAAGTGAAAAGTAATTGTTGTGGGGAAAACATTTTGCTAAGTTTAAGGAACCAAAGTTTTGGGAAGACATCT
TTCAAAATAAGGTGTGAAGAAACAACACTCATTCCTCGTGGGGCTGTTTGAAATGTAAGGTCCCCAGGAGCTACCTGTTATGTCCACACT
GCTGGATCTGATGCGTGGATAGTCGGTTAGATCTATATGAGGGTTGCAAATTGTACCGACATGCTTTCTTATTTCTTATGAATTTCAAGG
GCAAATACTGATAAAATGACCATGGTTGAGAAAATTGTCTTTTCACATTTTAAAATGCTACTTAAGTTTTTTCAGTTTATCCTATAAGCT
GAATGGCTCTGGTATTAATTGCCCAGGCTAAGACATTTACAGTGAGATGCATCTTTATGGTAATGAAGAGAATTTGCAAAGCATCATATT
ATTGAGATAAATATTCCCTAGATGAGAGTGTTAGAACACATGTAGCTACTGGATTAATGAATATGAAAGTATGGAGGGTAAGGGGAAAGA
CCAGTTTTTAAATTAAACTTATGTGAATGAAAGAAACAGCAAATATTACAAAATTATTATTTAAAGCATATATATCAATGAACTTCATAG

>In-frame_WNK2_ENST00000349097_chr9_96021896_+_FAM120A_ENST00000340893_chr9_96259753_+_7056nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCT
CCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTT
GCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCG
GAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGC
AGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGC
TGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCC
AAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGA
GTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTC
TTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAG
AAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTAC
CCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGAGTCCAACCTATACCTTCT
CAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCATTGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTG
CAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGAGGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGG
TACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGCAGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAG
TCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGACGGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCC
CAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCACTCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCT
CATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAAGCTGCTCTGGAGGCAGCTGTCTTAAATAAAGAAGAGTAAACTTATTTT
TTATAGAGGGTGAAGGATGCTGGAAGGGTAAGGATTTAGGAATATCTGGAGAGAAAGAGAGCCTGCAGTTATGTACATTTTGTCCTTTCC
GTAAGAGAAAAATGAGGACTTTGGAAATTCAGATCCCTCTTTGATATCAGAGATTTAAACAACACATTTTTAGTTTTAACCAGTTGTAGT
CAAAATGCTACAATAAAACAAAAAAGAGAAAGAAAATGAAGAGCATTTGACTCCCGCACTTAAAATGAAGTACACATAAAGTTTAAACTG
GTTATGACAAAAGCCTTTAGTTGTGTTTCTTGAACTATAAAGAAAACAAATTTTGGCAGTCTTTAAGTATATATAGCTTAAAATATAATT
TTTAGCATTTGGCACCATATGTATGCCATTATATTTGATTTTGCATTACTGTTTCACAATGAAGCTTTCTTTAAGGCTTTGATTTTTATG
ATTATGAAAGAAATAAGGCACAACCACAGTTTTTCTTTCTTAAATTTCATCACTGTTGATGTGGTTCTTTTGTGTTAAAAAAAAAAAGTG
CAACTATCAAAACTAAAAAATTATAGAGTAATATTGCCGTTCTGCTGATTTTAAATATACAATACATCATACATACTTTACAAGCAAGTT
AAATGGAGATAAAGTTGAAATCATAGAAGATGCAAATGACCTTTCAAAATCAACACAATGTGTTCTGAAACTTTCGTGACTAATACCATG
CATCTGTGATCAATGAACTATGTGGTTTTGAATCGGATGTAGACCATTAGTACTACTACTTGAGCTAAACTTCTGCATGGTTCATAATTT
TTAAAGTGTGTAGTTAATATGCATGTTATCGTCCTTTCTTCCATTCTTAACAGTATGTGCCCATTTGCAAAACAAAAATGCTAATAATCA
GTAATAGTCCTATAAAAGATGTTAACTCTGTTTAGTCATTGACTGATCTTGCTCTAACCTTAAAATTTTGTGATTATTGACCTCTGTTGC
ATTTATTCTAAAGCCCCCCAAAAATTATCTAGCCGTTTCGAATATCAACATTACCCTGGTGTATTCACTGCTGTATGCATTATTGTTCTT
TGTTGCTGTTTTATGCCTTCATATTAGCAAATATGAAATTCTGTGAAAAAAAACCCTTTGATCTTAAAAAAAAAAAAACCACCCCCCCCT
TCTGTAGCAGGAAACAAATTGCTTGTTCTTGAGAACTTTCCCATCAAGAATTTAGTAGAAGCAGGTATACTTCTATCATTTTGATGTTTT
TGTTAATGTTTCCAAACAATGTACTTTGAAATCAGAATCACTTCTTATCGTTTTCATATACTTCTGATGCTCTTCATCACATTAGTGATC
AGAAATGAGGTGTAATTCCCCAACCCCTGCCCGCAAGAGCTAAGTAGGATCTTACTGTAAGTTGAAGGGAGTTTTGCCCTAACTCATGGA
TTGTGCAAGAATGAACTGCTGTTGGGTTTGATTGACTGTCGATGGATTGTGGTGTGGTGTATCTGAAGGCTATTGAATGCAACTTACAAT

>In-frame_WNK2_ENST00000349097_chr9_96021896_+_FAM120A_ENST00000333936_chr9_96259753_+_7278nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAAGCCTTTCCAA
CTCTACTTGCAAAAAAACTTTGTGTTTCACAAAGAGAATTCCATCGTGCTCTGCTCCAGGATCCTGAGGCATGGCCATATCAGCGGGAAC
AAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCGTCCACT
GCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCCACCAGG
AACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGGCTGATG
TACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCTCCGGCC
GCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTTGCTTTT
AGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCGGAACTG
GTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGCAGGATG
AGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGCTGCGTC
TTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCCAAACTC
TACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGAGTAGAC
ATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTCTTCCAA
TCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAGAAGATG
CGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTACCCTGCC
TCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGCGTCTGTGGCTTTGGAGGCCCCTAT
GGGGAAACGGTAGCAACAGGCCCTTACCGTGCCTTCCGTGTGGCGGCAGCATCGGGACACTGCGGAGCCTTCTCAGGCAGTGACAGCAGC
AGGACTAGCAAGTCCCAGGGCGGAGTCCAACCTATACCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCATTGGGCT
GGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGAGGAGTT
ATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGCAGACCT
CCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGACGGGTCC
CTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCACTCTGAA
AGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCTCATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAAGCTGCT
CTGGAGGCAGCTGTCTTAAATAAAGAAGAGTAAACTTATTTTTTATAGAGGGTGAAGGATGCTGGAAGGGTAAGGATTTAGGAATATCTG
GAGAGAAAGAGAGCCTGCAGTTATGTACATTTTGTCCTTTCCGTAAGAGAAAAATGAGGACTTTGGAAATTCAGATCCCTCTTTGATATC
AGAGATTTAAACAACACATTTTTAGTTTTAACCAGTTGTAGTCAAAATGCTACAATAAAACAAAAAAGAGAAAGAAAATGAAGAGCATTT
GACTCCCGCACTTAAAATGAAGTACACATAAAGTTTAAACTGGTTATGACAAAAGCCTTTAGTTGTGTTTCTTGAACTATAAAGAAAACA
AATTTTGGCAGTCTTTAAGTATATATAGCTTAAAATATAATTTTTAGCATTTGGCACCATATGTATGCCATTATATTTGATTTTGCATTA
CTGTTTCACAATGAAGCTTTCTTTAAGGCTTTGATTTTTATGATTATGAAAGAAATAAGGCACAACCACAGTTTTTCTTTCTTAAATTTC
ATCACTGTTGATGTGGTTCTTTTGTGTTAAAAAAAAAAAGTGCAACTATCAAAACTAAAAAATTATAGAGTAATATTGCCGTTCTGCTGA
TTTTAAATATACAATACATCATACATACTTTACAAGCAAGTTAAATGGAGATAAAGTTGAAATCATAGAAGATGCAAATGACCTTTCAAA
ATCAACACAATGTGTTCTGAAACTTTCGTGACTAATACCATGCATCTGTGATCAATGAACTATGTGGTTTTGAATCGGATGTAGACCATT
AGTACTACTACTTGAGCTAAACTTCTGCATGGTTCATAATTTTTAAAGTGTGTAGTTAATATGCATGTTATCGTCCTTTCTTCCATTCTT
AACAGTATGTGCCCATTTGCAAAACAAAAATGCTAATAATCAGTAATAGTCCTATAAAAGATGTTAACTCTGTTTAGTCATTGACTGATC
TTGCTCTAACCTTAAAATTTTGTGATTATTGACCTCTGTTGCATTTATTCTAAAGCCCCCCAAAAATTATCTAGCCGTTTCGAATATCAA
CATTACCCTGGTGTATTCACTGCTGTATGCATTATTGTTCTTTGTTGCTGTTTTATGCCTTCATATTAGCAAATATGAAATTCTGTGAAA
AAAAACCCTTTGATCTTAAAAAAAAAAAAACCACCCCCCCCTTCTGTAGCAGGAAACAAATTGCTTGTTCTTGAGAACTTTCCCATCAAG
AATTTAGTAGAAGCAGGTATACTTCTATCATTTTGATGTTTTTGTTAATGTTTCCAAACAATGTACTTTGAAATCAGAATCACTTCTTAT
CGTTTTCATATACTTCTGATGCTCTTCATCACATTAGTGATCAGAAATGAGGTGTAATTCCCCAACCCCTGCCCGCAAGAGCTAAGTAGG
ATCTTACTGTAAGTTGAAGGGAGTTTTGCCCTAACTCATGGATTGTGCAAGAATGAACTGCTGTTGGGTTTGATTGACTGTCGATGGATT

>In-frame_WNK2_ENST00000395477_chr9_96021896_+_FAM120A_ENST00000277165_chr9_96259753_+_7186nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCT
CCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTT
GCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCG
GAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGC
AGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGC
TGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCC
AAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGA
GTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTC
TTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAG
AAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTAC
CCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGCGTCTGTGGCTTTGGAGGC
CCCTATGGGGAAACGGTAGCAACAGGCCCTTACCGTGCCTTCCGTGTGGCGGCAGCATCGGGACACTGCGGAGCCTTCTCAGGCAGTGAC
AGCAGCAGGACTAGCAAGTCCCAGGGCGGAGTCCAACCTATACCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCAT
TGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGA
GGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGC
AGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGAC
GGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCAC
TCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCTCATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAA
GCTGCTCTGGAGGCAGCTGTCTTAAATAAAGAAGAGTAAACTTATTTTTTATAGAGGGTGAAGGATGCTGGAAGGGTAAGGATTTAGGAA
TATCTGGAGAGAAAGAGAGCCTGCAGTTATGTACATTTTGTCCTTTCCGTAAGAGAAAAATGAGGACTTTGGAAATTCAGATCCCTCTTT
GATATCAGAGATTTAAACAACACATTTTTAGTTTTAACCAGTTGTAGTCAAAATGCTACAATAAAACAAAAAAGAGAAAGAAAATGAAGA
GCATTTGACTCCCGCACTTAAAATGAAGTACACATAAAGTTTAAACTGGTTATGACAAAAGCCTTTAGTTGTGTTTCTTGAACTATAAAG
AAAACAAATTTTGGCAGTCTTTAAGTATATATAGCTTAAAATATAATTTTTAGCATTTGGCACCATATGTATGCCATTATATTTGATTTT
GCATTACTGTTTCACAATGAAGCTTTCTTTAAGGCTTTGATTTTTATGATTATGAAAGAAATAAGGCACAACCACAGTTTTTCTTTCTTA
AATTTCATCACTGTTGATGTGGTTCTTTTGTGTTAAAAAAAAAAAGTGCAACTATCAAAACTAAAAAATTATAGAGTAATATTGCCGTTC
TGCTGATTTTAAATATACAATACATCATACATACTTTACAAGCAAGTTAAATGGAGATAAAGTTGAAATCATAGAAGATGCAAATGACCT
TTCAAAATCAACACAATGTGTTCTGAAACTTTCGTGACTAATACCATGCATCTGTGATCAATGAACTATGTGGTTTTGAATCGGATGTAG
ACCATTAGTACTACTACTTGAGCTAAACTTCTGCATGGTTCATAATTTTTAAAGTGTGTAGTTAATATGCATGTTATCGTCCTTTCTTCC
ATTCTTAACAGTATGTGCCCATTTGCAAAACAAAAATGCTAATAATCAGTAATAGTCCTATAAAAGATGTTAACTCTGTTTAGTCATTGA
CTGATCTTGCTCTAACCTTAAAATTTTGTGATTATTGACCTCTGTTGCATTTATTCTAAAGCCCCCCAAAAATTATCTAGCCGTTTCGAA
TATCAACATTACCCTGGTGTATTCACTGCTGTATGCATTATTGTTCTTTGTTGCTGTTTTATGCCTTCATATTAGCAAATATGAAATTCT
GTGAAAAAAAACCCTTTGATCTTAAAAAAAAAAAAACCACCCCCCCCTTCTGTAGCAGGAAACAAATTGCTTGTTCTTGAGAACTTTCCC
ATCAAGAATTTAGTAGAAGCAGGTATACTTCTATCATTTTGATGTTTTTGTTAATGTTTCCAAACAATGTACTTTGAAATCAGAATCACT
TCTTATCGTTTTCATATACTTCTGATGCTCTTCATCACATTAGTGATCAGAAATGAGGTGTAATTCCCCAACCCCTGCCCGCAAGAGCTA
AGTAGGATCTTACTGTAAGTTGAAGGGAGTTTTGCCCTAACTCATGGATTGTGCAAGAATGAACTGCTGTTGGGTTTGATTGACTGTCGA

>In-frame_WNK2_ENST00000395477_chr9_96021896_+_FAM120A_ENST00000375389_chr9_96259753_+_5822nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGTATTATCAAAGGGGCCCTGGAGTGGCTTCTGTTATTTGATGAGTGGCCATTCC
TATGGGTGTTTTGTCCTTTTGTCCTTTTTTGAACCATTTTTCTGTCTTACTAATCTACTTGAAACAAAGTTCACTTTCCCCTTTCTAAAC
ATTGAATGAAAGATGAACATTTATAACTGTAAATAGTTTTAAAATAACTCGTGAAAAGTCTCACTTTTTTCCTTCAACTTAGTATAGAAT
ATTTTATACTTCTAATGAAATAATGCATCACATTATTTTATGACTTGTAATTTTATTCTTTTTACTTCAATTTCAGAATTTTCTTAAACC
ATATTTGTGCTGTAATGTCAGGTTTAATTCTGATGTCAGATACAATATCTGGTTCCTTTATCATTTGTGCTTAGAAAATAATGTTTCCCC
CTTTGAATGGCTCATAGTGCTTCATGTGTTTTGACTTGTTCATGACCTCATTGAGTGCAGTTTTAATAGTGCTAAGAACAAAAAATATAA
TACAGGATTTTGTTAACATACGCATAGTCAGAAAATGAAACTATCATTTTATACAGTGTCATAATTTCACTTTATTAGTGTCTTAATGTA
TGCTTAAATATATACATATAGTGTGGCATCAATTATTTTTTAATCTTGGTGTCTCAAATGTATCTATGTGTATTTAAATTTCCTCAGTGA
TTTGTAGTCTTTATGTTGGCACTTTTAATCTTAGCCCCACAATTTAACAAGTTACCTCAGTTACTAGATTAATCCTGCAGAACTGGTTTA
TTGCTATCATGTATTATTAACATGAATACCTATATGACCATATATAACCAGACTTTTCTGTCTATTCTCTACAACCCATCTGTGGTTTGT
AAAATGGAGTCAATAAATGCAATAATGAACTCCTGTTCTCAAATACTCCTGAGGTGGACTTCAACTGTTAACTGACTAATCCAAATATTG
CTTACTTTTATTAATTAAAGGACATGGAAAACATGTAGCCAGTACTATTTGCTCAGATCCTTTAATTTATTTTTTAGTTGTAATGCCTCC
AAATCTCATCTATTATTTGATATGGGTATGCATTTATAGTATCACTTTTCAGATTATGGTTGTAAGGTGAACATTTTATTTTTCAGGTTC
AACATAAATTATAAAGGGTAAGTGAAAAGTAATTGTTGTGGGGAAAACATTTTGCTAAGTTTAAGGAACCAAAGTTTTGGGAAGACATCT
TTCAAAATAAGGTGTGAAGAAACAACACTCATTCCTCGTGGGGCTGTTTGAAATGTAAGGTCCCCAGGAGCTACCTGTTATGTCCACACT
GCTGGATCTGATGCGTGGATAGTCGGTTAGATCTATATGAGGGTTGCAAATTGTACCGACATGCTTTCTTATTTCTTATGAATTTCAAGG
GCAAATACTGATAAAATGACCATGGTTGAGAAAATTGTCTTTTCACATTTTAAAATGCTACTTAAGTTTTTTCAGTTTATCCTATAAGCT
GAATGGCTCTGGTATTAATTGCCCAGGCTAAGACATTTACAGTGAGATGCATCTTTATGGTAATGAAGAGAATTTGCAAAGCATCATATT
ATTGAGATAAATATTCCCTAGATGAGAGTGTTAGAACACATGTAGCTACTGGATTAATGAATATGAAAGTATGGAGGGTAAGGGGAAAGA
CCAGTTTTTAAATTAAACTTATGTGAATGAAAGAAACAGCAAATATTACAAAATTATTATTTAAAGCATATATATCAATGAACTTCATAG

>In-frame_WNK2_ENST00000395477_chr9_96021896_+_FAM120A_ENST00000340893_chr9_96259753_+_7056nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAACCATATCAGC
GGGAACAAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCG
TCCACTGCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCC
ACCAGGAACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGG
CTGATGTACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCT
CCGGCCGCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTT
GCTTTTAGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCG
GAACTGGTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGC
AGGATGAGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGC
TGCGTCTTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCC
AAACTCTACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGA
GTAGACATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTC
TTCCAATCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAG
AAGATGCGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTAC
CCTGCCTCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGAGTCCAACCTATACCTTCT
CAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCATTGGGCTGGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTG
CAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGAGGAGTTATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGG
TACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGCAGACCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAG
TCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGACGGGTCCCTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCC
CAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCACTCTGAAAGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCT
CATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAAGCTGCTCTGGAGGCAGCTGTCTTAAATAAAGAAGAGTAAACTTATTTT
TTATAGAGGGTGAAGGATGCTGGAAGGGTAAGGATTTAGGAATATCTGGAGAGAAAGAGAGCCTGCAGTTATGTACATTTTGTCCTTTCC
GTAAGAGAAAAATGAGGACTTTGGAAATTCAGATCCCTCTTTGATATCAGAGATTTAAACAACACATTTTTAGTTTTAACCAGTTGTAGT
CAAAATGCTACAATAAAACAAAAAAGAGAAAGAAAATGAAGAGCATTTGACTCCCGCACTTAAAATGAAGTACACATAAAGTTTAAACTG
GTTATGACAAAAGCCTTTAGTTGTGTTTCTTGAACTATAAAGAAAACAAATTTTGGCAGTCTTTAAGTATATATAGCTTAAAATATAATT
TTTAGCATTTGGCACCATATGTATGCCATTATATTTGATTTTGCATTACTGTTTCACAATGAAGCTTTCTTTAAGGCTTTGATTTTTATG
ATTATGAAAGAAATAAGGCACAACCACAGTTTTTCTTTCTTAAATTTCATCACTGTTGATGTGGTTCTTTTGTGTTAAAAAAAAAAAGTG
CAACTATCAAAACTAAAAAATTATAGAGTAATATTGCCGTTCTGCTGATTTTAAATATACAATACATCATACATACTTTACAAGCAAGTT
AAATGGAGATAAAGTTGAAATCATAGAAGATGCAAATGACCTTTCAAAATCAACACAATGTGTTCTGAAACTTTCGTGACTAATACCATG
CATCTGTGATCAATGAACTATGTGGTTTTGAATCGGATGTAGACCATTAGTACTACTACTTGAGCTAAACTTCTGCATGGTTCATAATTT
TTAAAGTGTGTAGTTAATATGCATGTTATCGTCCTTTCTTCCATTCTTAACAGTATGTGCCCATTTGCAAAACAAAAATGCTAATAATCA
GTAATAGTCCTATAAAAGATGTTAACTCTGTTTAGTCATTGACTGATCTTGCTCTAACCTTAAAATTTTGTGATTATTGACCTCTGTTGC
ATTTATTCTAAAGCCCCCCAAAAATTATCTAGCCGTTTCGAATATCAACATTACCCTGGTGTATTCACTGCTGTATGCATTATTGTTCTT
TGTTGCTGTTTTATGCCTTCATATTAGCAAATATGAAATTCTGTGAAAAAAAACCCTTTGATCTTAAAAAAAAAAAAACCACCCCCCCCT
TCTGTAGCAGGAAACAAATTGCTTGTTCTTGAGAACTTTCCCATCAAGAATTTAGTAGAAGCAGGTATACTTCTATCATTTTGATGTTTT
TGTTAATGTTTCCAAACAATGTACTTTGAAATCAGAATCACTTCTTATCGTTTTCATATACTTCTGATGCTCTTCATCACATTAGTGATC
AGAAATGAGGTGTAATTCCCCAACCCCTGCCCGCAAGAGCTAAGTAGGATCTTACTGTAAGTTGAAGGGAGTTTTGCCCTAACTCATGGA
TTGTGCAAGAATGAACTGCTGTTGGGTTTGATTGACTGTCGATGGATTGTGGTGTGGTGTATCTGAAGGCTATTGAATGCAACTTACAAT

>In-frame_WNK2_ENST00000395477_chr9_96021896_+_FAM120A_ENST00000333936_chr9_96259753_+_7278nt
ATGGACGGCGATGGCGGCCGCCGAGACGTCCCCGGCACGCTGATGGAGCCCGGGCGCGGCGCGGGGCCCGCGGGCATGGCGGAGCCTCGG
GCGAAGGCGGCGCGGCCGGGGCCCCAGCGCTTTCTGCGGCGCAGCGTGGTAGAGTCGGACCAGGAGGAGCCGCCGGGCTTGGAGGCAGCC
GAGGCGCCGGGCCCGCAGCCCCCGCAGCCCCTGCAGCGCCGGGTGCTTCTGCTCTGCAAGACGCGCCGCCTCATCGCGGAGCGCGCCCGC
GGACGCCCCGCCGCCCCCGCGCCCGCAGCGCTGGTAGCGCAGCCGGGAGCCCCCGGAGCCCCCGCGGACGCCGGCCCCGAGCCCGTGGGC
ACGCAGGAGCCCGGCCCGGACCCCATCGCAGCCGCTGTCGAAACCGCGCCTGCCCCCGACGGCGGCCCCAGGGAGGAGGCGGCGGCGACC
GTGAGGAAGGAGGATGAGGGGGCGGCCGAGGCGAAGCCTGAGCCCGGGCGCACTCGCCGGGACGAGCCCGAAGAGGAGGAGGACGACGAG
GACGACCTCAAGGCCGTGGCCACCTCTCTGGACGGCCGCTTCCTCAAGTTCGACATCGAGCTGGGCCGCGGTTCCTTCAAGACGGTCTAC
AAGGGGCTGGACACGGAGACCTGGGTGGAGGTGGCCTGGTGTGAGCTGCAGGACCGGAAGCTCACCAAGCTGGAGCGGCAGCGGTTCAAG
GAAGAGGCTGAGATGCTGAAAGGCCTGCAGCACCCCAACATCGTGCGCTTCTACGACTTCTGGGAGTCCAGCGCCAAGGGCAAGCGGTGC
ATTGTGCTGGTGACGGAGCTGATGACCTCAGGGACGCTGAAGACATACCTGAAGCGGTTCAAGGTGATGAAGCCCAAGGTTCTCCGCAGC
TGGTGCCGGCAGATCCTGAAGGGCCTGCTGTTCCTGCACACAAGGACGCCACCCATCATCCACCGAGACCTGAAATGTGACAATATTTTC
ATCACCGGACCAACTGGGTCTGTGAAGATTGGCGACTTGGGCCTGGCCACTCTGAAAAGAGCGTCATTTGCCAAAAGTGTGATAGGTACT
CCCGAGTTCATGGCGCCCGAGATGTACGAGGAGCACTACGATGAGTCCGTGGACGTCTATGCCTTTGGGATGTGCATGCTGGAGATGGCC
ACCTCGGAGTACCCCTACTCGGAGTGCCAGAATGCGGCCCAGATCTACCGCAAGGTCACCTGTGGTATCAAGCCGGCCAGCTTTGAGAAA
GTGCACGATCCTGAAATCAAGGAGATTATTGGGGAGTGTATCTGCAAAAACAAGGAGGAAAGGTACGAGATCAAAGACCTGCTGAGCCAC
GCCTTCTTCGCAGAGGACACAGGCGTGAGGGTGGAGCTCGCGGAGGAGGACCACGGCAGGAAGTCCACCATCGCCCTGAGGCTCTGGGTG
GAAGACCCCAAGAAACTGAAGGGAAAGCCCAAGGACAATGGAGCCATAGAGTTCACCTTCGACCTGGAGAAGGAGACGCCGGATGAGGTG
GCCCAAGAGATGATTGAGTCTGGATTCTTCCACGAGAGTGACGTCAAGATCGTGGCCAAGTCCATCCGTGACCGCGTGGCCTTGATCCAG
TGGCGGCGGGAGAGGATCTGGCCCGCGCTGCAGCCCAAGGAGCAGCAGGATGTGGGCAGCCCGGACAAGGCCAGGGGTCCGCCGGTGCCC
CTGCAGGTCCAGGTGACCTACCATGCACAGGCTGGGCAGCCCGGGCCACCAGAGCCCGAGGAGCCGGAGGCCGACCAGCACCTCCTGCCA
CCTACGTTGCCGACCAGCGCCACCTCCCTGGCCTCGGACAGCACCTTCGACAGCGGCCAGGGCTCTACCGTGTACTCAGACTCGCAGAGC
AGCCAGCAGAGCGTGATGCTTGGCTCCCTTGCCGACGCAGCGCCGTCCCCGGCCCAGTGTGTGTGCAGCCCCCCTGTGAGCGAGGGGCCC
GTCCTGCCGCAGAGCCTGCCCTCGCTGGGGGCCTACCAGCAGCCCACGGCTGCACCTGGCTTGCCGGTGGGCTCTGTCCCGGCCCCCGCC
TGCCCTCCGTCCCTCCAGCAGCACTTCCCGGATCCGGCCATGAGCTTCGCCCCCGTGCTGCCGCCGCCCAGCACCCCCATGCCCACGGGC
CCAGGCCAGCCAGCACCCCCCGGCCAGCAGCCTCCTCCGCTGGCCCAGCCGACACCCCTGCCGCAGGTCCTGGCCCCACAGCCCGTGGTC
CCCCTCCAGCCGGTTCCCCCCCACCTGCCACCGTACCTGGCTCCAGCCTCCCAGGTGGGGGCCCCCGCTCAGCTGAAGCCCCTCCAGATG
CCACAGGCGCCCCTGCAGCCGCTTGCTCAAGTCCCTCCGCAGATGCCCCCGATTCCTGTTGTGCCCCCCATCACGCCCCTGGCGGGAATC
GACGGCCTCCCTCCGGCCCTCCCAGACCTGCCGACCGCGACTGTGCCTCCCGTGCCACCACCTCAGTATTTCTCTCCAGCCGTGATCTTG
CCGAGCCTCGCTGCCCCACTCCCCCCTGCGTCCCCAGCCTTGCCTCTGCAGGCTGTGAAGCTGCCCCACCCCCCTGGGGCGCCCCTGGCC
ATGCCCTGCCGGACCATTGTGCCAAATGCACCGGCCACTATCCCCCTGCTGGCCGTAGCCCCACCGGGCGTGGCTGCCCTGTCCATTCAT
TCTGCCGTGGCCCAGCTCCCAGGCCAACCTGTGTACCCAGCGGCCTTCCCACAGATGGCGCCTACTGACGTCCCTCCTTCCCCCCATCAC
ACGGTGCAGAATATGAGGGCCACCCCTCCACAGCCGGCACTGCCTCCACAACCCACACTGCCCCCACAACCCGTGCTGCCCCCGCAACCC
ACGCTGCCCCCTCAACCTGTGTTGCCCCCGCAACCCACACGGCCCCCTCAACCTGTGCTGCCCCCGCAACCCATGCTGCCCCCACAACCT
GTGCTGCCCCCGCAGCCGGCACTGCCTGTGCGCCCTGAGCCCCTCCAGCCCCACCTTCCTGAACAAGCTGCTCCAGCTGCTACACCAGGG
AGCCAGGTCCGGGCCCACCAGCTGGTCTTGCCACCTTGCGACGTAGTGATCAAAGCCGTTGCTGACTATGTACGCAACATTCAGGACACC
TCTGACTTGGATGCCATAGCTAAAGATGTTTTCCAGCATTCACAGTCTAGAACAGATGACAAAGTTATTCGATTTAAGAGAGCAATTGGA
TATTATTCAGCGACTAGTAAGCCTATGTCATTTCATCCACCACATTACTTAGCAGCCAGACCCGGTCCGTTTGGAATGCCTGGGATGGTG
CCGCCGCATGTTCCTCCTCAGATGCTCAACATTCCGCAGACCTCTCTGCAAGCAAAGCCCGTGGCCCCACAGGTGCCCAGCCCAGGGGGC
GCCCCGGGCCAGGGTCCATACCCGTACAGCCTCTCTGAGCCAGCACCTCTCACTTTGGACACGAGCGGGAAGAATCTGACGGAGCAGAAC
AGCTACAGCAACATTCCTCACGAAGGGAAGCACACGCCGCTGTATGAGCGGTCCTCGCCCATCAACCCGGCCCAGAGCGGCAGCCCCAAC
CACGTGGATTCCGCCTACTTCCCTGGCTCTTCTACATCGTCATCTTCCGACAACGACGAGGGCAGCGGAGGGGCGACAAAGCCTTTCCAA
CTCTACTTGCAAAAAAACTTTGTGTTTCACAAAGAGAATTCCATCGTGCTCTGCTCCAGGATCCTGAGGCATGGCCATATCAGCGGGAAC
AAGATTGGCTGGGAGAAGACGGGAAGCCACTCAGAGCCTCAGGCACGAGGAGACCCAGGAGACCAAACAAAGGCAGAAGGCTCGTCCACT
GCCTCTTCAGGAAGCCAACTAGCCGAAGGCAAGGGAAGCCAGATGGGCACTGTCCAGCCAATCCCGTGCCTCCTGTCGATGCCCACCAGG
AACCACATGGACATCACCACACCTCCCCTGCCCCCCGTCGCACCTGAGGTGCTGAGAGTGGCCGAGCACAGGCACAAGAAGGGGCTGATG
TACCCCTACATCTTCCATGTCCTGACGAAGGGTGAAATCAAAATTGCTGTTTCTATTGAAGATGAAGCCAACAAGGACCTGCCTCCGGCC
GCTCTGCTCTATAGGCCAGTTCGTCAGTATGTTTACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTTGCTTTT
AGAAAGAACAGACTTCCACCAGAATTTTCACCAGTGATCATTAAAGAATGGGCAGCTTACAAAGGAAAGTCTCCTCAAACCCCGGAACTG
GTTGAAGCTCTTGCCTTCAGGGAGTGGACCTGCCCCAACCTGAAGAGGCTGTGGTTGGGTAAGGCGGTAGAGGACAAGAACCGCAGGATG
AGGGCCTTCCTGGCCTGCATGAGGTCGGACACCCCAGCCATGCTCAACCCTGCCAACGTGCCCACTCACCTCATGGTGCTCTGCTGCGTC
TTACGGTACATGGTGCAGTGGCCGGGAGCACGCATCCTTCGGCGTCAGGAGCTAGATGCCTTCCTGGCTCAGGCGCTGTCCCCCAAACTC
TACGAGCCTGATCAGCTCCAGGAGCTCAAGATTGAGAACCTAGATCCCCGAGGAATTCAGCTATCAGCTCTCTTCATGAGTGGAGTAGAC
ATGGCCTTGTTTGCAAATGATGCATGCGGACAGCCAATCCCCTGGGAACACTGTTGTCCTTGGATGTATTTTGATGGGAAGCTCTTCCAA
TCCAAACTCCTCAAAGCCAGCCGGGAAAAGACCCCACTCATTGACCTCTGTGATGGTCAGGCTGATCAGGCTGCCAAGGTAGAGAAGATG
CGCCAGAGCGTCCTCGAGGGGCTCAGCTTCTCCAGGCAGAGCCACACGCTCCCTTTCCCGCCGCCACCTGCCCTGCCCTTCTACCCTGCC
TCTGCGTACCCCCGGCACTTTGGGCCTGTCCCACCCTCTCAGGGCAGGGGCAGAGGCTTTGCAGGCGTCTGTGGCTTTGGAGGCCCCTAT
GGGGAAACGGTAGCAACAGGCCCTTACCGTGCCTTCCGTGTGGCGGCAGCATCGGGACACTGCGGAGCCTTCTCAGGCAGTGACAGCAGC
AGGACTAGCAAGTCCCAGGGCGGAGTCCAACCTATACCTTCTCAGGGAGGCAAACTAGAAATAGCTGGCACTGTGGTTGGCCATTGGGCT
GGGAGCAGGCGGGGCCGTGGGGGCCGGGGGCCTTTCCCCCTGCAGGTGGTTTCTGTCGGAGGACCAGCTAGAGGGCGTCCAAGAGGAGTT
ATTTCCACCCCAGTGATTAGAACATTTGGAAGAGGTGGAAGGTACTATGGCAGAGGTTACAAAAACCAGGCAGCAATTCAGGGCAGACCT
CCTTATGCTGCTTCAGCAGAAGAAGTGGCCAAAGAACTTAAGTCAAAATCTGGGGAATCGAAGTCCTCTGCTATGTCTTCAGACGGGTCC
CTGGCTGAAAACGGAGTGATGGCCGAGGAGAAGCCGGCTCCCCAGATGAACGGGAGCACGGGTGACGCCAGGGCCCCCAGCCACTCTGAA
AGTGCCTTGAATAATGACTCTAAAACGTGCAATACAAATCCTCATTTAAATGCACTAAGTACAGACAGCGCTTGCCGCAGAGAAGCTGCT
CTGGAGGCAGCTGTCTTAAATAAAGAAGAGTAAACTTATTTTTTATAGAGGGTGAAGGATGCTGGAAGGGTAAGGATTTAGGAATATCTG
GAGAGAAAGAGAGCCTGCAGTTATGTACATTTTGTCCTTTCCGTAAGAGAAAAATGAGGACTTTGGAAATTCAGATCCCTCTTTGATATC
AGAGATTTAAACAACACATTTTTAGTTTTAACCAGTTGTAGTCAAAATGCTACAATAAAACAAAAAAGAGAAAGAAAATGAAGAGCATTT
GACTCCCGCACTTAAAATGAAGTACACATAAAGTTTAAACTGGTTATGACAAAAGCCTTTAGTTGTGTTTCTTGAACTATAAAGAAAACA
AATTTTGGCAGTCTTTAAGTATATATAGCTTAAAATATAATTTTTAGCATTTGGCACCATATGTATGCCATTATATTTGATTTTGCATTA
CTGTTTCACAATGAAGCTTTCTTTAAGGCTTTGATTTTTATGATTATGAAAGAAATAAGGCACAACCACAGTTTTTCTTTCTTAAATTTC
ATCACTGTTGATGTGGTTCTTTTGTGTTAAAAAAAAAAAGTGCAACTATCAAAACTAAAAAATTATAGAGTAATATTGCCGTTCTGCTGA
TTTTAAATATACAATACATCATACATACTTTACAAGCAAGTTAAATGGAGATAAAGTTGAAATCATAGAAGATGCAAATGACCTTTCAAA
ATCAACACAATGTGTTCTGAAACTTTCGTGACTAATACCATGCATCTGTGATCAATGAACTATGTGGTTTTGAATCGGATGTAGACCATT
AGTACTACTACTTGAGCTAAACTTCTGCATGGTTCATAATTTTTAAAGTGTGTAGTTAATATGCATGTTATCGTCCTTTCTTCCATTCTT
AACAGTATGTGCCCATTTGCAAAACAAAAATGCTAATAATCAGTAATAGTCCTATAAAAGATGTTAACTCTGTTTAGTCATTGACTGATC
TTGCTCTAACCTTAAAATTTTGTGATTATTGACCTCTGTTGCATTTATTCTAAAGCCCCCCAAAAATTATCTAGCCGTTTCGAATATCAA
CATTACCCTGGTGTATTCACTGCTGTATGCATTATTGTTCTTTGTTGCTGTTTTATGCCTTCATATTAGCAAATATGAAATTCTGTGAAA
AAAAACCCTTTGATCTTAAAAAAAAAAAAACCACCCCCCCCTTCTGTAGCAGGAAACAAATTGCTTGTTCTTGAGAACTTTCCCATCAAG
AATTTAGTAGAAGCAGGTATACTTCTATCATTTTGATGTTTTTGTTAATGTTTCCAAACAATGTACTTTGAAATCAGAATCACTTCTTAT
CGTTTTCATATACTTCTGATGCTCTTCATCACATTAGTGATCAGAAATGAGGTGTAATTCCCCAACCCCTGCCCGCAAGAGCTAAGTAGG
ATCTTACTGTAAGTTGAAGGGAGTTTTGCCCTAACTCATGGATTGTGCAAGAATGAACTGCTGTTGGGTTTGATTGACTGTCGATGGATT


Top

FusionGenePPI for WNK2_FAM120A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
WNK2YWHAZ, WNK1, SGK1, ATXN1, KLHL3, KLHL2, DGCR14, TSC22D4, PSMC3, SPATA1, TRIM25FAM120ASIRT7, CUL3, CAND1, GRK5, CFTR, TARDBP, HECW2, PASK, STAU1, SPRTN, CEP250, NXF1, EZH2, RNF2, BMI1, FBXW11, EFNB2, GGPS1, HNRNPA1, PRMT8, ILF2, RBMX, SPACA4, IFI30, NTRK1, SSX2IP, HNRNPD, HNRNPH2, HNRNPU, MATR3, SEC16A, SYNCRIP, MRPL50, ATL2, FOXK2, FOXQ1, ZNF746, ELAVL2, SSSCA1, BCHE, APOBEC3D, LGALS3BP, GSPT2, CSN1S1, RBM42, CDX1, RBM3, TRIM25, G3BP1, BRCA1, YAP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneFAM120Achr9:96021896chr9:96259753ENST00000277165+218339_4052681119YES1%2C SRC and FYN
TgeneFAM120Achr9:96021896chr9:96259753ENST00000333936+219339_4052681147YES1%2C SRC and FYN
TgeneFAM120Achr9:96021896chr9:96259753ENST00000340893+217339_4052681073YES1%2C SRC and FYN
TgeneFAM120Achr9:96021896chr9:96259753ENST00000375389+29339_405268629YES1%2C SRC and FYN


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for WNK2_FAM120A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for WNK2_FAM120A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource