FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42043

FusionGeneSummary for WNK1_PRMT8

check button Fusion gene summary
Fusion gene informationFusion gene name: WNK1_PRMT8
Fusion gene ID: 42043
HgeneTgene
Gene symbol

WNK1

PRMT8

Gene ID

65125

56341

Gene nameWNK lysine deficient protein kinase 1protein arginine methyltransferase 8
SynonymsHSAN2|HSN2|KDP|PPP1R167|PRKWNK1|PSK|p65HRMT1L3|HRMT1L4
Cytomap

12p13.33

12p13.32

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein kinase WNK1WNK lysine deficient protein kinase 1 isoformerythrocyte 65 kDa proteinprostate-derived sterile 20-like kinaseprotein kinase with no lysine 1protein phosphatase 1, regulatory subunit 167serine/threonine-protein kiprotein arginine N-methyltransferase 8HMT1 hnRNP methyltransferase-like 3arginine methyltransferase 8heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4protein arginine N-methyltransferase 4
Modification date2018052320180523
UniProtAcc

Q9H4A3

Q9NR22

Ensembl transtripts involved in fusion geneENST00000535572, ENST00000537687, 
ENST00000315939, ENST00000447667, 
ENST00000530271, ENST00000540360, 
ENST00000340908, ENST00000574564, 
ENST00000452611, ENST00000382622, 
ENST00000261252, 
Fusion gene scores* DoF score15 X 10 X 10=15004 X 3 X 3=36
# samples 194
** MAII scorelog2(19/1500*10)=-2.9808911770523
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: WNK1 [Title/Abstract] AND PRMT8 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneWNK1

GO:0006468

protein phosphorylation

10660600

HgeneWNK1

GO:0010923

negative regulation of phosphatase activity

19389623

HgeneWNK1

GO:0023016

signal transduction by trans-phosphorylation

16669787

HgeneWNK1

GO:0035556

intracellular signal transduction

10660600

TgenePRMT8

GO:0016571

histone methylation

16051612

TgenePRMT8

GO:0018216

peptidyl-arginine methylation

16051612|18320585

TgenePRMT8

GO:0019919

peptidyl-arginine methylation, to asymmetrical-dimethyl arginine

16051612

TgenePRMT8

GO:0051260

protein homooligomerization

26876602


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-BH-A18T-01AWNK1chr12

971436

+PRMT8chr12

3649772

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000535572ENST00000452611WNK1chr12

971436

+PRMT8chr12

3649772

+
In-frameENST00000535572ENST00000382622WNK1chr12

971436

+PRMT8chr12

3649772

+
5CDS-3UTRENST00000535572ENST00000261252WNK1chr12

971436

+PRMT8chr12

3649772

+
In-frameENST00000537687ENST00000452611WNK1chr12

971436

+PRMT8chr12

3649772

+
In-frameENST00000537687ENST00000382622WNK1chr12

971436

+PRMT8chr12

3649772

+
5CDS-3UTRENST00000537687ENST00000261252WNK1chr12

971436

+PRMT8chr12

3649772

+
In-frameENST00000315939ENST00000452611WNK1chr12

971436

+PRMT8chr12

3649772

+
In-frameENST00000315939ENST00000382622WNK1chr12

971436

+PRMT8chr12

3649772

+
5CDS-3UTRENST00000315939ENST00000261252WNK1chr12

971436

+PRMT8chr12

3649772

+
intron-3CDSENST00000447667ENST00000452611WNK1chr12

971436

+PRMT8chr12

3649772

+
intron-3CDSENST00000447667ENST00000382622WNK1chr12

971436

+PRMT8chr12

3649772

+
intron-3UTRENST00000447667ENST00000261252WNK1chr12

971436

+PRMT8chr12

3649772

+
In-frameENST00000530271ENST00000452611WNK1chr12

971436

+PRMT8chr12

3649772

+
In-frameENST00000530271ENST00000382622WNK1chr12

971436

+PRMT8chr12

3649772

+
5CDS-3UTRENST00000530271ENST00000261252WNK1chr12

971436

+PRMT8chr12

3649772

+
intron-3CDSENST00000540360ENST00000452611WNK1chr12

971436

+PRMT8chr12

3649772

+
intron-3CDSENST00000540360ENST00000382622WNK1chr12

971436

+PRMT8chr12

3649772

+
intron-3UTRENST00000540360ENST00000261252WNK1chr12

971436

+PRMT8chr12

3649772

+
In-frameENST00000340908ENST00000452611WNK1chr12

971436

+PRMT8chr12

3649772

+
In-frameENST00000340908ENST00000382622WNK1chr12

971436

+PRMT8chr12

3649772

+
5CDS-3UTRENST00000340908ENST00000261252WNK1chr12

971436

+PRMT8chr12

3649772

+
intron-3CDSENST00000574564ENST00000452611WNK1chr12

971436

+PRMT8chr12

3649772

+
intron-3CDSENST00000574564ENST00000382622WNK1chr12

971436

+PRMT8chr12

3649772

+
intron-3UTRENST00000574564ENST00000261252WNK1chr12

971436

+PRMT8chr12

3649772

+

Top

FusionProtFeatures for WNK1_PRMT8


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
WNK1

Q9H4A3

PRMT8

Q9NR22

S-adenosyl-L-methionine-dependent and membrane-associated arginine methyltransferase that can both catalyze theformation of omega-N monomethylarginine (MMA) and asymmetricaldimethylarginine (aDMA) in proteins such as NIFK, myelin basicprotein, histone H4, H2A and H2A/H2B dimer (PubMed:16051612,PubMed:17925405, PubMed:26876602, PubMed:26529540). Able tomono- and dimethylate EWS protein; however its precise role towardEWS remains unclear as it still interacts with fully methylatedEWS (PubMed:18320585). {ECO:0000269|PubMed:16051612,ECO:0000269|PubMed:17925405, ECO:0000269|PubMed:18320585,ECO:0000269|PubMed:26529540, ECO:0000269|PubMed:26876602}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneWNK1chr12:971436chr12:3649772ENST00000315939+828221_4797132383DomainProtein kinase
HgeneWNK1chr12:971436chr12:3649772ENST00000537687+828221_4797132643DomainProtein kinase
HgeneWNK1chr12:971436chr12:3649772ENST00000315939+828301_3047132383Nucleotide bindingATP
HgeneWNK1chr12:971436chr12:3649772ENST00000340908+525301_3043061976Nucleotide bindingATP
HgeneWNK1chr12:971436chr12:3649772ENST00000537687+828301_3047132643Nucleotide bindingATP
HgeneWNK1chr12:971436chr12:3649772ENST00000315939+828488_5557132383RegionAutoinhibitory domain
HgeneWNK1chr12:971436chr12:3649772ENST00000537687+828488_5557132643RegionAutoinhibitory domain
TgenePRMT8chr12:971436chr12:3649772ENST00000382622+01073_39425395DomainSAM-dependent MTase PRMT-type
TgenePRMT8chr12:971436chr12:3649772ENST00000452611+01073_39416386DomainSAM-dependent MTase PRMT-type
TgenePRMT8chr12:971436chr12:3649772ENST00000382622+01029_4225395MotifSH3-binding 1
TgenePRMT8chr12:971436chr12:3649772ENST00000382622+01053_5825395MotifSH3-binding 2
TgenePRMT8chr12:971436chr12:3649772ENST00000452611+01029_4216386MotifSH3-binding 1
TgenePRMT8chr12:971436chr12:3649772ENST00000452611+01053_5816386MotifSH3-binding 2
TgenePRMT8chr12:971436chr12:3649772ENST00000382622+010119_12225395RegionS-adenosyl-L-methionine binding
TgenePRMT8chr12:971436chr12:3649772ENST00000452611+010119_12216386RegionS-adenosyl-L-methionine binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneWNK1chr12:971436chr12:3649772ENST00000340908+525221_4793061976DomainProtein kinase
HgeneWNK1chr12:971436chr12:3649772ENST00000574564+11221_479-12435DomainProtein kinase
HgeneWNK1chr12:971436chr12:3649772ENST00000574564+11301_304-12435Nucleotide bindingATP
HgeneWNK1chr12:971436chr12:3649772ENST00000340908+525488_5553061976RegionAutoinhibitory domain
HgeneWNK1chr12:971436chr12:3649772ENST00000574564+11488_555-12435RegionAutoinhibitory domain


Top

FusionGeneSequence for WNK1_PRMT8


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_WNK1_ENST00000535572_chr12_971436_+_PRMT8_ENST00000452611_chr12_3649772_+_1083aa
MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNA
TALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAE
MLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIP
EVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEM
VESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQTGIKQLPSASTGIPTASTTSASVSTQVEPE
EPEADQHQQLQYQQPSISVLSDGTVDSGQGSSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVVNSPPSQ
PPQPVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGT
GILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGG
LMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRND
YVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYK

>In-frame_WNK1_ENST00000535572_chr12_971436_+_PRMT8_ENST00000382622_chr12_3649772_+_1083aa
MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNA
TALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAE
MLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIP
EVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEM
VESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQTGIKQLPSASTGIPTASTTSASVSTQVEPE
EPEADQHQQLQYQQPSISVLSDGTVDSGQGSSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVVNSPPSQ
PPQPVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGT
GILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGG
LMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRND
YVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYK

>In-frame_WNK1_ENST00000537687_chr12_971436_+_PRMT8_ENST00000452611_chr12_3649772_+_1083aa
MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNA
TALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAE
MLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIP
EVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEM
VESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQTGIKQLPSASTGIPTASTTSASVSTQVEPE
EPEADQHQQLQYQQPSISVLSDGTVDSGQGSSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVVNSPPSQ
PPQPVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGT
GILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGG
LMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRND
YVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYK

>In-frame_WNK1_ENST00000537687_chr12_971436_+_PRMT8_ENST00000382622_chr12_3649772_+_1083aa
MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNA
TALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAE
MLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIP
EVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEM
VESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQTGIKQLPSASTGIPTASTTSASVSTQVEPE
EPEADQHQQLQYQQPSISVLSDGTVDSGQGSSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVVNSPPSQ
PPQPVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGT
GILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGG
LMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRND
YVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYK

>In-frame_WNK1_ENST00000315939_chr12_971436_+_PRMT8_ENST00000452611_chr12_3649772_+_1083aa
MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNA
TALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAE
MLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIP
EVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEM
VESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQTGIKQLPSASTGIPTASTTSASVSTQVEPE
EPEADQHQQLQYQQPSISVLSDGTVDSGQGSSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVVNSPPSQ
PPQPVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGT
GILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGG
LMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRND
YVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYK

>In-frame_WNK1_ENST00000315939_chr12_971436_+_PRMT8_ENST00000382622_chr12_3649772_+_1083aa
MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNA
TALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAE
MLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIP
EVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEM
VESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQTGIKQLPSASTGIPTASTTSASVSTQVEPE
EPEADQHQQLQYQQPSISVLSDGTVDSGQGSSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVVNSPPSQ
PPQPVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGT
GILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGG
LMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRND
YVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYK

>In-frame_WNK1_ENST00000530271_chr12_971436_+_PRMT8_ENST00000452611_chr12_3649772_+_1083aa
MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNA
TALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAE
MLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIP
EVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEM
VESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQTGIKQLPSASTGIPTASTTSASVSTQVEPE
EPEADQHQQLQYQQPSISVLSDGTVDSGQGSSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVVNSPPSQ
PPQPVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGT
GILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGG
LMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRND
YVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYK

>In-frame_WNK1_ENST00000530271_chr12_971436_+_PRMT8_ENST00000382622_chr12_3649772_+_1083aa
MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNA
TALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAE
MLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIP
EVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEM
VESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQTGIKQLPSASTGIPTASTTSASVSTQVEPE
EPEADQHQQLQYQQPSISVLSDGTVDSGQGSSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVVNSPPSQ
PPQPVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGT
GILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGG
LMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRND
YVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYK

>In-frame_WNK1_ENST00000340908_chr12_971436_+_PRMT8_ENST00000452611_chr12_3649772_+_676aa
MDIKKKDFCSVFVIINSHCCCCPQKDCINEGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEK
IAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEES
SLKQQVEQSSASQTGIKQLPSASTGIPTASTTSASVSTQVEPEEPEADQHQQLQYQQPSISVLSDGTVDSGQGSSVFTESRVSSQQTVSY
GSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVVNSPPSQPPQPVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEMTSRDYYFDS
YAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKV
EEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPL
VDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVR

>In-frame_WNK1_ENST00000340908_chr12_971436_+_PRMT8_ENST00000382622_chr12_3649772_+_676aa
MDIKKKDFCSVFVIINSHCCCCPQKDCINEGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRVELAEEDDGEK
IAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEES
SLKQQVEQSSASQTGIKQLPSASTGIPTASTTSASVSTQVEPEEPEADQHQQLQYQQPSISVLSDGTVDSGQGSSVFTESRVSSQQTVSY
GSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVVNSPPSQPPQPVVPAKPVQCVHHVSTQPSCPGRGKMSKLLNPEEMTSRDYYFDS
YAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKV
EEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPL
VDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_WNK1_ENST00000535572_chr12_971436_+_PRMT8_ENST00000452611_chr12_3649772_+_3249nt
ATGTCTGGCGGCGCCGCAGAGAAGCAGAGCAGCACTCCCGGTTCCCTGTTCCTCTCGCCGCCGGCTCCTGCCCCCAAGAATGGCTCCAGC
TCCGATTCCTCCGTGGGGGAGAAACTGGGAGCCGCGGCCGCCGACGCTGTGACCGGCAGGACCGAGGAGTACAGGCGCCGCCGCCACACT
ATGGACAAGGACAGCCGTGGGGCGGCCGCGACCACTACCACCACTGAGCACCGCTTCTTCCGCCGGAGCGTCATCTGTGACTCCAATGCC
ACTGCACTGGAGCTTCCCGGCCTTCCTCTTTCCCTGCCCCAGCCCAGCATCCCCGCGGCTGTCCCGCAGAGTGCTCCACCGGAGCCCCAC
CGGGAAGAGACCGTGACCGCCACCGCCACTTCCCAGGTAGCCCAGCAGCCTCCAGCCGCTGCCGCCCCTGGGGAACAGGCCGTCGCGGGC
CCTGCCCCCTCGACTGTCCCCAGCAGTACCAGCAAAGACCGCCCAGTGTCCCAGCCTAGCCTTGTGGGGAGCAAAGAGGAGCCGCCGCCG
GCGAGAAGTGGCAGCGGCGGCGGCAGCGCCAAGGAGCCACAGGAGGAACGGAGCCAGCAGCAGGATGATATCGAAGAGCTGGAGACCAAG
GCCGTGGGAATGTCTAACGATGGCCGCTTTCTCAAGTTTGACATCGAAATCGGCAGAGGCTCCTTTAAGACGGTCTACAAAGGTCTGGAC
ACTGAAACCACCGTGGAAGTCGCCTGGTGTGAACTGCAGGATCGAAAATTAACAAAGTCTGAGAGGCAGAGATTTAAAGAAGAAGCTGAA
ATGTTAAAAGGTCTTCAGCATCCCAATATTGTTAGATTTTATGATTCCTGGGAATCCACAGTAAAAGGAAAGAAGTGCATTGTTTTGGTG
ACTGAACTTATGACGTCTGGAACACTTAAAACGTATCTGAAAAGGTTTAAAGTGATGAAGATCAAAGTTCTAAGAAGCTGGTGCCGTCAG
ATCCTTAAAGGTCTTCAGTTTCTTCATACTCGAACTCCACCTATCATTCACCGCGATCTTAAATGTGACAACATCTTTATCACCGGCCCT
ACTGGCTCAGTCAAGATTGGAGACCTCGGTCTGGCAACCCTGAAGCGGGCTTCTTTTGCCAAGAGTGTGATAGGTACCCCAGAGTTCATG
GCCCCTGAGATGTATGAGGAGAAATATGATGAATCCGTTGACGTTTATGCTTTTGGGATGTGCATGCTTGAGATGGCTACATCTGAATAT
CCTTACTCGGAGTGCCAAAATGCTGCACAGATCTACCGTCGCGTGACCAGTGGGGTGAAGCCAGCCAGTTTTGACAAAGTAGCAATTCCT
GAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGATATTCCATCAAAGACCTTTTGAACCATGCCTTCTTCCAA
GAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAAATAGCCATAAAATTATGGCTACGTATTGAAGATATTAAG
AAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGATTTAGAGAGAGATGTCCCAGAAGATGTTGCACAAGAAATG
GTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCTATCAAAGACAGAGTATCATTAATTAAGAGGAAACGAGAG
CAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGCAGTCTCAAACAGCAGGTAGAACAATCCAGTGCTTCCCAG
ACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCTACCACTTCAGCTTCAGTTTCTACACAAGTAGAACCTGAA
GAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATATCTGTGTTATCTGATGGGACGGTTGACAGTGGTCAGGGA
TCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATATGGTTCCCAACATGAACAGGCACATTCTACAGGCACAGTC
CCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTATATCCACCCTCAAGTGTGGTGAACAGCCCCCCCTCCCAG
CCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTGTCCACTCAACCCAGCTGCCCAGGACGGGGCAAGATGTCC
AAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCCTATGCCCACTTTGGGATCCACGAGGAAATGCTGAAGGAT
GAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTGTTCAAGGACAAAGTGGTACTGGATGTGGGGAGTGGTACT
GGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGGATCGAATGCTCCAGTATTTCTGACTACTCAGAGAAGATC
ATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTGGAAGAGGTGGAGCTGCCTGTGGAGAAGGTGGACATCATC
ATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACGGTGATCTTTGCCAGGGACAAGTGGCTGAAACCTGGAGGG
CTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGACAGTACAAGGACTTCAAAATCCACTGGTGGGAGAATGTC
TATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTAGTGGACATCGTGGATCCAAAGCAAGTGGTGACCAATGCC
TGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCGTTCACATCTGCATTCTGCCTGCAGATACAGCGCAACGAC
TACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCACAAGAAAATGGGGTTTTCCACAGCCCCTGATGCTCCCTAC
ACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGGAGGGGGGAGGAAATCTACGGGACCATATCCATGAAGCCA
AATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAGGGACAGCTGTGTGAAACATCTGTATCTAATGACTACAAA

>In-frame_WNK1_ENST00000535572_chr12_971436_+_PRMT8_ENST00000382622_chr12_3649772_+_3249nt
ATGTCTGGCGGCGCCGCAGAGAAGCAGAGCAGCACTCCCGGTTCCCTGTTCCTCTCGCCGCCGGCTCCTGCCCCCAAGAATGGCTCCAGC
TCCGATTCCTCCGTGGGGGAGAAACTGGGAGCCGCGGCCGCCGACGCTGTGACCGGCAGGACCGAGGAGTACAGGCGCCGCCGCCACACT
ATGGACAAGGACAGCCGTGGGGCGGCCGCGACCACTACCACCACTGAGCACCGCTTCTTCCGCCGGAGCGTCATCTGTGACTCCAATGCC
ACTGCACTGGAGCTTCCCGGCCTTCCTCTTTCCCTGCCCCAGCCCAGCATCCCCGCGGCTGTCCCGCAGAGTGCTCCACCGGAGCCCCAC
CGGGAAGAGACCGTGACCGCCACCGCCACTTCCCAGGTAGCCCAGCAGCCTCCAGCCGCTGCCGCCCCTGGGGAACAGGCCGTCGCGGGC
CCTGCCCCCTCGACTGTCCCCAGCAGTACCAGCAAAGACCGCCCAGTGTCCCAGCCTAGCCTTGTGGGGAGCAAAGAGGAGCCGCCGCCG
GCGAGAAGTGGCAGCGGCGGCGGCAGCGCCAAGGAGCCACAGGAGGAACGGAGCCAGCAGCAGGATGATATCGAAGAGCTGGAGACCAAG
GCCGTGGGAATGTCTAACGATGGCCGCTTTCTCAAGTTTGACATCGAAATCGGCAGAGGCTCCTTTAAGACGGTCTACAAAGGTCTGGAC
ACTGAAACCACCGTGGAAGTCGCCTGGTGTGAACTGCAGGATCGAAAATTAACAAAGTCTGAGAGGCAGAGATTTAAAGAAGAAGCTGAA
ATGTTAAAAGGTCTTCAGCATCCCAATATTGTTAGATTTTATGATTCCTGGGAATCCACAGTAAAAGGAAAGAAGTGCATTGTTTTGGTG
ACTGAACTTATGACGTCTGGAACACTTAAAACGTATCTGAAAAGGTTTAAAGTGATGAAGATCAAAGTTCTAAGAAGCTGGTGCCGTCAG
ATCCTTAAAGGTCTTCAGTTTCTTCATACTCGAACTCCACCTATCATTCACCGCGATCTTAAATGTGACAACATCTTTATCACCGGCCCT
ACTGGCTCAGTCAAGATTGGAGACCTCGGTCTGGCAACCCTGAAGCGGGCTTCTTTTGCCAAGAGTGTGATAGGTACCCCAGAGTTCATG
GCCCCTGAGATGTATGAGGAGAAATATGATGAATCCGTTGACGTTTATGCTTTTGGGATGTGCATGCTTGAGATGGCTACATCTGAATAT
CCTTACTCGGAGTGCCAAAATGCTGCACAGATCTACCGTCGCGTGACCAGTGGGGTGAAGCCAGCCAGTTTTGACAAAGTAGCAATTCCT
GAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGATATTCCATCAAAGACCTTTTGAACCATGCCTTCTTCCAA
GAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAAATAGCCATAAAATTATGGCTACGTATTGAAGATATTAAG
AAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGATTTAGAGAGAGATGTCCCAGAAGATGTTGCACAAGAAATG
GTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCTATCAAAGACAGAGTATCATTAATTAAGAGGAAACGAGAG
CAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGCAGTCTCAAACAGCAGGTAGAACAATCCAGTGCTTCCCAG
ACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCTACCACTTCAGCTTCAGTTTCTACACAAGTAGAACCTGAA
GAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATATCTGTGTTATCTGATGGGACGGTTGACAGTGGTCAGGGA
TCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATATGGTTCCCAACATGAACAGGCACATTCTACAGGCACAGTC
CCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTATATCCACCCTCAAGTGTGGTGAACAGCCCCCCCTCCCAG
CCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTGTCCACTCAACCCAGCTGCCCAGGACGGGGCAAGATGTCC
AAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCCTATGCCCACTTTGGGATCCACGAGGAAATGCTGAAGGAT
GAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTGTTCAAGGACAAAGTGGTACTGGATGTGGGGAGTGGTACT
GGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGGATCGAATGCTCCAGTATTTCTGACTACTCAGAGAAGATC
ATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTGGAAGAGGTGGAGCTGCCTGTGGAGAAGGTGGACATCATC
ATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACGGTGATCTTTGCCAGGGACAAGTGGCTGAAACCTGGAGGG
CTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGACAGTACAAGGACTTCAAAATCCACTGGTGGGAGAATGTC
TATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTAGTGGACATCGTGGATCCAAAGCAAGTGGTGACCAATGCC
TGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCGTTCACATCTGCATTCTGCCTGCAGATACAGCGCAACGAC
TACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCACAAGAAAATGGGGTTTTCCACAGCCCCTGATGCTCCCTAC
ACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGGAGGGGGGAGGAAATCTACGGGACCATATCCATGAAGCCA
AATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAGGGACAGCTGTGTGAAACATCTGTATCTAATGACTACAAA

>In-frame_WNK1_ENST00000537687_chr12_971436_+_PRMT8_ENST00000452611_chr12_3649772_+_3249nt
ATGTCTGGCGGCGCCGCAGAGAAGCAGAGCAGCACTCCCGGTTCCCTGTTCCTCTCGCCGCCGGCTCCTGCCCCCAAGAATGGCTCCAGC
TCCGATTCCTCCGTGGGGGAGAAACTGGGAGCCGCGGCCGCCGACGCTGTGACCGGCAGGACCGAGGAGTACAGGCGCCGCCGCCACACT
ATGGACAAGGACAGCCGTGGGGCGGCCGCGACCACTACCACCACTGAGCACCGCTTCTTCCGCCGGAGCGTCATCTGTGACTCCAATGCC
ACTGCACTGGAGCTTCCCGGCCTTCCTCTTTCCCTGCCCCAGCCCAGCATCCCCGCGGCTGTCCCGCAGAGTGCTCCACCGGAGCCCCAC
CGGGAAGAGACCGTGACCGCCACCGCCACTTCCCAGGTAGCCCAGCAGCCTCCAGCCGCTGCCGCCCCTGGGGAACAGGCCGTCGCGGGC
CCTGCCCCCTCGACTGTCCCCAGCAGTACCAGCAAAGACCGCCCAGTGTCCCAGCCTAGCCTTGTGGGGAGCAAAGAGGAGCCGCCGCCG
GCGAGAAGTGGCAGCGGCGGCGGCAGCGCCAAGGAGCCACAGGAGGAACGGAGCCAGCAGCAGGATGATATCGAAGAGCTGGAGACCAAG
GCCGTGGGAATGTCTAACGATGGCCGCTTTCTCAAGTTTGACATCGAAATCGGCAGAGGCTCCTTTAAGACGGTCTACAAAGGTCTGGAC
ACTGAAACCACCGTGGAAGTCGCCTGGTGTGAACTGCAGGATCGAAAATTAACAAAGTCTGAGAGGCAGAGATTTAAAGAAGAAGCTGAA
ATGTTAAAAGGTCTTCAGCATCCCAATATTGTTAGATTTTATGATTCCTGGGAATCCACAGTAAAAGGAAAGAAGTGCATTGTTTTGGTG
ACTGAACTTATGACGTCTGGAACACTTAAAACGTATCTGAAAAGGTTTAAAGTGATGAAGATCAAAGTTCTAAGAAGCTGGTGCCGTCAG
ATCCTTAAAGGTCTTCAGTTTCTTCATACTCGAACTCCACCTATCATTCACCGCGATCTTAAATGTGACAACATCTTTATCACCGGCCCT
ACTGGCTCAGTCAAGATTGGAGACCTCGGTCTGGCAACCCTGAAGCGGGCTTCTTTTGCCAAGAGTGTGATAGGTACCCCAGAGTTCATG
GCCCCTGAGATGTATGAGGAGAAATATGATGAATCCGTTGACGTTTATGCTTTTGGGATGTGCATGCTTGAGATGGCTACATCTGAATAT
CCTTACTCGGAGTGCCAAAATGCTGCACAGATCTACCGTCGCGTGACCAGTGGGGTGAAGCCAGCCAGTTTTGACAAAGTAGCAATTCCT
GAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGATATTCCATCAAAGACCTTTTGAACCATGCCTTCTTCCAA
GAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAAATAGCCATAAAATTATGGCTACGTATTGAAGATATTAAG
AAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGATTTAGAGAGAGATGTCCCAGAAGATGTTGCACAAGAAATG
GTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCTATCAAAGACAGAGTATCATTAATTAAGAGGAAACGAGAG
CAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGCAGTCTCAAACAGCAGGTAGAACAATCCAGTGCTTCCCAG
ACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCTACCACTTCAGCTTCAGTTTCTACACAAGTAGAACCTGAA
GAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATATCTGTGTTATCTGATGGGACGGTTGACAGTGGTCAGGGA
TCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATATGGTTCCCAACATGAACAGGCACATTCTACAGGCACAGTC
CCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTATATCCACCCTCAAGTGTGGTGAACAGCCCCCCCTCCCAG
CCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTGTCCACTCAACCCAGCTGCCCAGGACGGGGCAAGATGTCC
AAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCCTATGCCCACTTTGGGATCCACGAGGAAATGCTGAAGGAT
GAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTGTTCAAGGACAAAGTGGTACTGGATGTGGGGAGTGGTACT
GGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGGATCGAATGCTCCAGTATTTCTGACTACTCAGAGAAGATC
ATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTGGAAGAGGTGGAGCTGCCTGTGGAGAAGGTGGACATCATC
ATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACGGTGATCTTTGCCAGGGACAAGTGGCTGAAACCTGGAGGG
CTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGACAGTACAAGGACTTCAAAATCCACTGGTGGGAGAATGTC
TATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTAGTGGACATCGTGGATCCAAAGCAAGTGGTGACCAATGCC
TGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCGTTCACATCTGCATTCTGCCTGCAGATACAGCGCAACGAC
TACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCACAAGAAAATGGGGTTTTCCACAGCCCCTGATGCTCCCTAC
ACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGGAGGGGGGAGGAAATCTACGGGACCATATCCATGAAGCCA
AATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAGGGACAGCTGTGTGAAACATCTGTATCTAATGACTACAAA

>In-frame_WNK1_ENST00000537687_chr12_971436_+_PRMT8_ENST00000382622_chr12_3649772_+_3249nt
ATGTCTGGCGGCGCCGCAGAGAAGCAGAGCAGCACTCCCGGTTCCCTGTTCCTCTCGCCGCCGGCTCCTGCCCCCAAGAATGGCTCCAGC
TCCGATTCCTCCGTGGGGGAGAAACTGGGAGCCGCGGCCGCCGACGCTGTGACCGGCAGGACCGAGGAGTACAGGCGCCGCCGCCACACT
ATGGACAAGGACAGCCGTGGGGCGGCCGCGACCACTACCACCACTGAGCACCGCTTCTTCCGCCGGAGCGTCATCTGTGACTCCAATGCC
ACTGCACTGGAGCTTCCCGGCCTTCCTCTTTCCCTGCCCCAGCCCAGCATCCCCGCGGCTGTCCCGCAGAGTGCTCCACCGGAGCCCCAC
CGGGAAGAGACCGTGACCGCCACCGCCACTTCCCAGGTAGCCCAGCAGCCTCCAGCCGCTGCCGCCCCTGGGGAACAGGCCGTCGCGGGC
CCTGCCCCCTCGACTGTCCCCAGCAGTACCAGCAAAGACCGCCCAGTGTCCCAGCCTAGCCTTGTGGGGAGCAAAGAGGAGCCGCCGCCG
GCGAGAAGTGGCAGCGGCGGCGGCAGCGCCAAGGAGCCACAGGAGGAACGGAGCCAGCAGCAGGATGATATCGAAGAGCTGGAGACCAAG
GCCGTGGGAATGTCTAACGATGGCCGCTTTCTCAAGTTTGACATCGAAATCGGCAGAGGCTCCTTTAAGACGGTCTACAAAGGTCTGGAC
ACTGAAACCACCGTGGAAGTCGCCTGGTGTGAACTGCAGGATCGAAAATTAACAAAGTCTGAGAGGCAGAGATTTAAAGAAGAAGCTGAA
ATGTTAAAAGGTCTTCAGCATCCCAATATTGTTAGATTTTATGATTCCTGGGAATCCACAGTAAAAGGAAAGAAGTGCATTGTTTTGGTG
ACTGAACTTATGACGTCTGGAACACTTAAAACGTATCTGAAAAGGTTTAAAGTGATGAAGATCAAAGTTCTAAGAAGCTGGTGCCGTCAG
ATCCTTAAAGGTCTTCAGTTTCTTCATACTCGAACTCCACCTATCATTCACCGCGATCTTAAATGTGACAACATCTTTATCACCGGCCCT
ACTGGCTCAGTCAAGATTGGAGACCTCGGTCTGGCAACCCTGAAGCGGGCTTCTTTTGCCAAGAGTGTGATAGGTACCCCAGAGTTCATG
GCCCCTGAGATGTATGAGGAGAAATATGATGAATCCGTTGACGTTTATGCTTTTGGGATGTGCATGCTTGAGATGGCTACATCTGAATAT
CCTTACTCGGAGTGCCAAAATGCTGCACAGATCTACCGTCGCGTGACCAGTGGGGTGAAGCCAGCCAGTTTTGACAAAGTAGCAATTCCT
GAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGATATTCCATCAAAGACCTTTTGAACCATGCCTTCTTCCAA
GAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAAATAGCCATAAAATTATGGCTACGTATTGAAGATATTAAG
AAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGATTTAGAGAGAGATGTCCCAGAAGATGTTGCACAAGAAATG
GTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCTATCAAAGACAGAGTATCATTAATTAAGAGGAAACGAGAG
CAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGCAGTCTCAAACAGCAGGTAGAACAATCCAGTGCTTCCCAG
ACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCTACCACTTCAGCTTCAGTTTCTACACAAGTAGAACCTGAA
GAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATATCTGTGTTATCTGATGGGACGGTTGACAGTGGTCAGGGA
TCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATATGGTTCCCAACATGAACAGGCACATTCTACAGGCACAGTC
CCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTATATCCACCCTCAAGTGTGGTGAACAGCCCCCCCTCCCAG
CCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTGTCCACTCAACCCAGCTGCCCAGGACGGGGCAAGATGTCC
AAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCCTATGCCCACTTTGGGATCCACGAGGAAATGCTGAAGGAT
GAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTGTTCAAGGACAAAGTGGTACTGGATGTGGGGAGTGGTACT
GGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGGATCGAATGCTCCAGTATTTCTGACTACTCAGAGAAGATC
ATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTGGAAGAGGTGGAGCTGCCTGTGGAGAAGGTGGACATCATC
ATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACGGTGATCTTTGCCAGGGACAAGTGGCTGAAACCTGGAGGG
CTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGACAGTACAAGGACTTCAAAATCCACTGGTGGGAGAATGTC
TATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTAGTGGACATCGTGGATCCAAAGCAAGTGGTGACCAATGCC
TGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCGTTCACATCTGCATTCTGCCTGCAGATACAGCGCAACGAC
TACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCACAAGAAAATGGGGTTTTCCACAGCCCCTGATGCTCCCTAC
ACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGGAGGGGGGAGGAAATCTACGGGACCATATCCATGAAGCCA
AATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAGGGACAGCTGTGTGAAACATCTGTATCTAATGACTACAAA

>In-frame_WNK1_ENST00000315939_chr12_971436_+_PRMT8_ENST00000452611_chr12_3649772_+_3249nt
ATGTCTGGCGGCGCCGCAGAGAAGCAGAGCAGCACTCCCGGTTCCCTGTTCCTCTCGCCGCCGGCTCCTGCCCCCAAGAATGGCTCCAGC
TCCGATTCCTCCGTGGGGGAGAAACTGGGAGCCGCGGCCGCCGACGCTGTGACCGGCAGGACCGAGGAGTACAGGCGCCGCCGCCACACT
ATGGACAAGGACAGCCGTGGGGCGGCCGCGACCACTACCACCACTGAGCACCGCTTCTTCCGCCGGAGCGTCATCTGTGACTCCAATGCC
ACTGCACTGGAGCTTCCCGGCCTTCCTCTTTCCCTGCCCCAGCCCAGCATCCCCGCGGCTGTCCCGCAGAGTGCTCCACCGGAGCCCCAC
CGGGAAGAGACCGTGACCGCCACCGCCACTTCCCAGGTAGCCCAGCAGCCTCCAGCCGCTGCCGCCCCTGGGGAACAGGCCGTCGCGGGC
CCTGCCCCCTCGACTGTCCCCAGCAGTACCAGCAAAGACCGCCCAGTGTCCCAGCCTAGCCTTGTGGGGAGCAAAGAGGAGCCGCCGCCG
GCGAGAAGTGGCAGCGGCGGCGGCAGCGCCAAGGAGCCACAGGAGGAACGGAGCCAGCAGCAGGATGATATCGAAGAGCTGGAGACCAAG
GCCGTGGGAATGTCTAACGATGGCCGCTTTCTCAAGTTTGACATCGAAATCGGCAGAGGCTCCTTTAAGACGGTCTACAAAGGTCTGGAC
ACTGAAACCACCGTGGAAGTCGCCTGGTGTGAACTGCAGGATCGAAAATTAACAAAGTCTGAGAGGCAGAGATTTAAAGAAGAAGCTGAA
ATGTTAAAAGGTCTTCAGCATCCCAATATTGTTAGATTTTATGATTCCTGGGAATCCACAGTAAAAGGAAAGAAGTGCATTGTTTTGGTG
ACTGAACTTATGACGTCTGGAACACTTAAAACGTATCTGAAAAGGTTTAAAGTGATGAAGATCAAAGTTCTAAGAAGCTGGTGCCGTCAG
ATCCTTAAAGGTCTTCAGTTTCTTCATACTCGAACTCCACCTATCATTCACCGCGATCTTAAATGTGACAACATCTTTATCACCGGCCCT
ACTGGCTCAGTCAAGATTGGAGACCTCGGTCTGGCAACCCTGAAGCGGGCTTCTTTTGCCAAGAGTGTGATAGGTACCCCAGAGTTCATG
GCCCCTGAGATGTATGAGGAGAAATATGATGAATCCGTTGACGTTTATGCTTTTGGGATGTGCATGCTTGAGATGGCTACATCTGAATAT
CCTTACTCGGAGTGCCAAAATGCTGCACAGATCTACCGTCGCGTGACCAGTGGGGTGAAGCCAGCCAGTTTTGACAAAGTAGCAATTCCT
GAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGATATTCCATCAAAGACCTTTTGAACCATGCCTTCTTCCAA
GAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAAATAGCCATAAAATTATGGCTACGTATTGAAGATATTAAG
AAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGATTTAGAGAGAGATGTCCCAGAAGATGTTGCACAAGAAATG
GTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCTATCAAAGACAGAGTATCATTAATTAAGAGGAAACGAGAG
CAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGCAGTCTCAAACAGCAGGTAGAACAATCCAGTGCTTCCCAG
ACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCTACCACTTCAGCTTCAGTTTCTACACAAGTAGAACCTGAA
GAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATATCTGTGTTATCTGATGGGACGGTTGACAGTGGTCAGGGA
TCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATATGGTTCCCAACATGAACAGGCACATTCTACAGGCACAGTC
CCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTATATCCACCCTCAAGTGTGGTGAACAGCCCCCCCTCCCAG
CCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTGTCCACTCAACCCAGCTGCCCAGGACGGGGCAAGATGTCC
AAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCCTATGCCCACTTTGGGATCCACGAGGAAATGCTGAAGGAT
GAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTGTTCAAGGACAAAGTGGTACTGGATGTGGGGAGTGGTACT
GGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGGATCGAATGCTCCAGTATTTCTGACTACTCAGAGAAGATC
ATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTGGAAGAGGTGGAGCTGCCTGTGGAGAAGGTGGACATCATC
ATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACGGTGATCTTTGCCAGGGACAAGTGGCTGAAACCTGGAGGG
CTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGACAGTACAAGGACTTCAAAATCCACTGGTGGGAGAATGTC
TATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTAGTGGACATCGTGGATCCAAAGCAAGTGGTGACCAATGCC
TGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCGTTCACATCTGCATTCTGCCTGCAGATACAGCGCAACGAC
TACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCACAAGAAAATGGGGTTTTCCACAGCCCCTGATGCTCCCTAC
ACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGGAGGGGGGAGGAAATCTACGGGACCATATCCATGAAGCCA
AATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAGGGACAGCTGTGTGAAACATCTGTATCTAATGACTACAAA

>In-frame_WNK1_ENST00000315939_chr12_971436_+_PRMT8_ENST00000382622_chr12_3649772_+_3249nt
ATGTCTGGCGGCGCCGCAGAGAAGCAGAGCAGCACTCCCGGTTCCCTGTTCCTCTCGCCGCCGGCTCCTGCCCCCAAGAATGGCTCCAGC
TCCGATTCCTCCGTGGGGGAGAAACTGGGAGCCGCGGCCGCCGACGCTGTGACCGGCAGGACCGAGGAGTACAGGCGCCGCCGCCACACT
ATGGACAAGGACAGCCGTGGGGCGGCCGCGACCACTACCACCACTGAGCACCGCTTCTTCCGCCGGAGCGTCATCTGTGACTCCAATGCC
ACTGCACTGGAGCTTCCCGGCCTTCCTCTTTCCCTGCCCCAGCCCAGCATCCCCGCGGCTGTCCCGCAGAGTGCTCCACCGGAGCCCCAC
CGGGAAGAGACCGTGACCGCCACCGCCACTTCCCAGGTAGCCCAGCAGCCTCCAGCCGCTGCCGCCCCTGGGGAACAGGCCGTCGCGGGC
CCTGCCCCCTCGACTGTCCCCAGCAGTACCAGCAAAGACCGCCCAGTGTCCCAGCCTAGCCTTGTGGGGAGCAAAGAGGAGCCGCCGCCG
GCGAGAAGTGGCAGCGGCGGCGGCAGCGCCAAGGAGCCACAGGAGGAACGGAGCCAGCAGCAGGATGATATCGAAGAGCTGGAGACCAAG
GCCGTGGGAATGTCTAACGATGGCCGCTTTCTCAAGTTTGACATCGAAATCGGCAGAGGCTCCTTTAAGACGGTCTACAAAGGTCTGGAC
ACTGAAACCACCGTGGAAGTCGCCTGGTGTGAACTGCAGGATCGAAAATTAACAAAGTCTGAGAGGCAGAGATTTAAAGAAGAAGCTGAA
ATGTTAAAAGGTCTTCAGCATCCCAATATTGTTAGATTTTATGATTCCTGGGAATCCACAGTAAAAGGAAAGAAGTGCATTGTTTTGGTG
ACTGAACTTATGACGTCTGGAACACTTAAAACGTATCTGAAAAGGTTTAAAGTGATGAAGATCAAAGTTCTAAGAAGCTGGTGCCGTCAG
ATCCTTAAAGGTCTTCAGTTTCTTCATACTCGAACTCCACCTATCATTCACCGCGATCTTAAATGTGACAACATCTTTATCACCGGCCCT
ACTGGCTCAGTCAAGATTGGAGACCTCGGTCTGGCAACCCTGAAGCGGGCTTCTTTTGCCAAGAGTGTGATAGGTACCCCAGAGTTCATG
GCCCCTGAGATGTATGAGGAGAAATATGATGAATCCGTTGACGTTTATGCTTTTGGGATGTGCATGCTTGAGATGGCTACATCTGAATAT
CCTTACTCGGAGTGCCAAAATGCTGCACAGATCTACCGTCGCGTGACCAGTGGGGTGAAGCCAGCCAGTTTTGACAAAGTAGCAATTCCT
GAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGATATTCCATCAAAGACCTTTTGAACCATGCCTTCTTCCAA
GAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAAATAGCCATAAAATTATGGCTACGTATTGAAGATATTAAG
AAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGATTTAGAGAGAGATGTCCCAGAAGATGTTGCACAAGAAATG
GTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCTATCAAAGACAGAGTATCATTAATTAAGAGGAAACGAGAG
CAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGCAGTCTCAAACAGCAGGTAGAACAATCCAGTGCTTCCCAG
ACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCTACCACTTCAGCTTCAGTTTCTACACAAGTAGAACCTGAA
GAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATATCTGTGTTATCTGATGGGACGGTTGACAGTGGTCAGGGA
TCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATATGGTTCCCAACATGAACAGGCACATTCTACAGGCACAGTC
CCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTATATCCACCCTCAAGTGTGGTGAACAGCCCCCCCTCCCAG
CCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTGTCCACTCAACCCAGCTGCCCAGGACGGGGCAAGATGTCC
AAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCCTATGCCCACTTTGGGATCCACGAGGAAATGCTGAAGGAT
GAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTGTTCAAGGACAAAGTGGTACTGGATGTGGGGAGTGGTACT
GGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGGATCGAATGCTCCAGTATTTCTGACTACTCAGAGAAGATC
ATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTGGAAGAGGTGGAGCTGCCTGTGGAGAAGGTGGACATCATC
ATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACGGTGATCTTTGCCAGGGACAAGTGGCTGAAACCTGGAGGG
CTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGACAGTACAAGGACTTCAAAATCCACTGGTGGGAGAATGTC
TATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTAGTGGACATCGTGGATCCAAAGCAAGTGGTGACCAATGCC
TGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCGTTCACATCTGCATTCTGCCTGCAGATACAGCGCAACGAC
TACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCACAAGAAAATGGGGTTTTCCACAGCCCCTGATGCTCCCTAC
ACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGGAGGGGGGAGGAAATCTACGGGACCATATCCATGAAGCCA
AATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAGGGACAGCTGTGTGAAACATCTGTATCTAATGACTACAAA

>In-frame_WNK1_ENST00000530271_chr12_971436_+_PRMT8_ENST00000452611_chr12_3649772_+_3249nt
ATGTCTGGCGGCGCCGCAGAGAAGCAGAGCAGCACTCCCGGTTCCCTGTTCCTCTCGCCGCCGGCTCCTGCCCCCAAGAATGGCTCCAGC
TCCGATTCCTCCGTGGGGGAGAAACTGGGAGCCGCGGCCGCCGACGCTGTGACCGGCAGGACCGAGGAGTACAGGCGCCGCCGCCACACT
ATGGACAAGGACAGCCGTGGGGCGGCCGCGACCACTACCACCACTGAGCACCGCTTCTTCCGCCGGAGCGTCATCTGTGACTCCAATGCC
ACTGCACTGGAGCTTCCCGGCCTTCCTCTTTCCCTGCCCCAGCCCAGCATCCCCGCGGCTGTCCCGCAGAGTGCTCCACCGGAGCCCCAC
CGGGAAGAGACCGTGACCGCCACCGCCACTTCCCAGGTAGCCCAGCAGCCTCCAGCCGCTGCCGCCCCTGGGGAACAGGCCGTCGCGGGC
CCTGCCCCCTCGACTGTCCCCAGCAGTACCAGCAAAGACCGCCCAGTGTCCCAGCCTAGCCTTGTGGGGAGCAAAGAGGAGCCGCCGCCG
GCGAGAAGTGGCAGCGGCGGCGGCAGCGCCAAGGAGCCACAGGAGGAACGGAGCCAGCAGCAGGATGATATCGAAGAGCTGGAGACCAAG
GCCGTGGGAATGTCTAACGATGGCCGCTTTCTCAAGTTTGACATCGAAATCGGCAGAGGCTCCTTTAAGACGGTCTACAAAGGTCTGGAC
ACTGAAACCACCGTGGAAGTCGCCTGGTGTGAACTGCAGGATCGAAAATTAACAAAGTCTGAGAGGCAGAGATTTAAAGAAGAAGCTGAA
ATGTTAAAAGGTCTTCAGCATCCCAATATTGTTAGATTTTATGATTCCTGGGAATCCACAGTAAAAGGAAAGAAGTGCATTGTTTTGGTG
ACTGAACTTATGACGTCTGGAACACTTAAAACGTATCTGAAAAGGTTTAAAGTGATGAAGATCAAAGTTCTAAGAAGCTGGTGCCGTCAG
ATCCTTAAAGGTCTTCAGTTTCTTCATACTCGAACTCCACCTATCATTCACCGCGATCTTAAATGTGACAACATCTTTATCACCGGCCCT
ACTGGCTCAGTCAAGATTGGAGACCTCGGTCTGGCAACCCTGAAGCGGGCTTCTTTTGCCAAGAGTGTGATAGGTACCCCAGAGTTCATG
GCCCCTGAGATGTATGAGGAGAAATATGATGAATCCGTTGACGTTTATGCTTTTGGGATGTGCATGCTTGAGATGGCTACATCTGAATAT
CCTTACTCGGAGTGCCAAAATGCTGCACAGATCTACCGTCGCGTGACCAGTGGGGTGAAGCCAGCCAGTTTTGACAAAGTAGCAATTCCT
GAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGATATTCCATCAAAGACCTTTTGAACCATGCCTTCTTCCAA
GAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAAATAGCCATAAAATTATGGCTACGTATTGAAGATATTAAG
AAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGATTTAGAGAGAGATGTCCCAGAAGATGTTGCACAAGAAATG
GTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCTATCAAAGACAGAGTATCATTAATTAAGAGGAAACGAGAG
CAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGCAGTCTCAAACAGCAGGTAGAACAATCCAGTGCTTCCCAG
ACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCTACCACTTCAGCTTCAGTTTCTACACAAGTAGAACCTGAA
GAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATATCTGTGTTATCTGATGGGACGGTTGACAGTGGTCAGGGA
TCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATATGGTTCCCAACATGAACAGGCACATTCTACAGGCACAGTC
CCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTATATCCACCCTCAAGTGTGGTGAACAGCCCCCCCTCCCAG
CCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTGTCCACTCAACCCAGCTGCCCAGGACGGGGCAAGATGTCC
AAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCCTATGCCCACTTTGGGATCCACGAGGAAATGCTGAAGGAT
GAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTGTTCAAGGACAAAGTGGTACTGGATGTGGGGAGTGGTACT
GGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGGATCGAATGCTCCAGTATTTCTGACTACTCAGAGAAGATC
ATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTGGAAGAGGTGGAGCTGCCTGTGGAGAAGGTGGACATCATC
ATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACGGTGATCTTTGCCAGGGACAAGTGGCTGAAACCTGGAGGG
CTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGACAGTACAAGGACTTCAAAATCCACTGGTGGGAGAATGTC
TATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTAGTGGACATCGTGGATCCAAAGCAAGTGGTGACCAATGCC
TGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCGTTCACATCTGCATTCTGCCTGCAGATACAGCGCAACGAC
TACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCACAAGAAAATGGGGTTTTCCACAGCCCCTGATGCTCCCTAC
ACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGGAGGGGGGAGGAAATCTACGGGACCATATCCATGAAGCCA
AATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAGGGACAGCTGTGTGAAACATCTGTATCTAATGACTACAAA

>In-frame_WNK1_ENST00000530271_chr12_971436_+_PRMT8_ENST00000382622_chr12_3649772_+_3249nt
ATGTCTGGCGGCGCCGCAGAGAAGCAGAGCAGCACTCCCGGTTCCCTGTTCCTCTCGCCGCCGGCTCCTGCCCCCAAGAATGGCTCCAGC
TCCGATTCCTCCGTGGGGGAGAAACTGGGAGCCGCGGCCGCCGACGCTGTGACCGGCAGGACCGAGGAGTACAGGCGCCGCCGCCACACT
ATGGACAAGGACAGCCGTGGGGCGGCCGCGACCACTACCACCACTGAGCACCGCTTCTTCCGCCGGAGCGTCATCTGTGACTCCAATGCC
ACTGCACTGGAGCTTCCCGGCCTTCCTCTTTCCCTGCCCCAGCCCAGCATCCCCGCGGCTGTCCCGCAGAGTGCTCCACCGGAGCCCCAC
CGGGAAGAGACCGTGACCGCCACCGCCACTTCCCAGGTAGCCCAGCAGCCTCCAGCCGCTGCCGCCCCTGGGGAACAGGCCGTCGCGGGC
CCTGCCCCCTCGACTGTCCCCAGCAGTACCAGCAAAGACCGCCCAGTGTCCCAGCCTAGCCTTGTGGGGAGCAAAGAGGAGCCGCCGCCG
GCGAGAAGTGGCAGCGGCGGCGGCAGCGCCAAGGAGCCACAGGAGGAACGGAGCCAGCAGCAGGATGATATCGAAGAGCTGGAGACCAAG
GCCGTGGGAATGTCTAACGATGGCCGCTTTCTCAAGTTTGACATCGAAATCGGCAGAGGCTCCTTTAAGACGGTCTACAAAGGTCTGGAC
ACTGAAACCACCGTGGAAGTCGCCTGGTGTGAACTGCAGGATCGAAAATTAACAAAGTCTGAGAGGCAGAGATTTAAAGAAGAAGCTGAA
ATGTTAAAAGGTCTTCAGCATCCCAATATTGTTAGATTTTATGATTCCTGGGAATCCACAGTAAAAGGAAAGAAGTGCATTGTTTTGGTG
ACTGAACTTATGACGTCTGGAACACTTAAAACGTATCTGAAAAGGTTTAAAGTGATGAAGATCAAAGTTCTAAGAAGCTGGTGCCGTCAG
ATCCTTAAAGGTCTTCAGTTTCTTCATACTCGAACTCCACCTATCATTCACCGCGATCTTAAATGTGACAACATCTTTATCACCGGCCCT
ACTGGCTCAGTCAAGATTGGAGACCTCGGTCTGGCAACCCTGAAGCGGGCTTCTTTTGCCAAGAGTGTGATAGGTACCCCAGAGTTCATG
GCCCCTGAGATGTATGAGGAGAAATATGATGAATCCGTTGACGTTTATGCTTTTGGGATGTGCATGCTTGAGATGGCTACATCTGAATAT
CCTTACTCGGAGTGCCAAAATGCTGCACAGATCTACCGTCGCGTGACCAGTGGGGTGAAGCCAGCCAGTTTTGACAAAGTAGCAATTCCT
GAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGATATTCCATCAAAGACCTTTTGAACCATGCCTTCTTCCAA
GAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAAATAGCCATAAAATTATGGCTACGTATTGAAGATATTAAG
AAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGATTTAGAGAGAGATGTCCCAGAAGATGTTGCACAAGAAATG
GTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCTATCAAAGACAGAGTATCATTAATTAAGAGGAAACGAGAG
CAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGCAGTCTCAAACAGCAGGTAGAACAATCCAGTGCTTCCCAG
ACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCTACCACTTCAGCTTCAGTTTCTACACAAGTAGAACCTGAA
GAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATATCTGTGTTATCTGATGGGACGGTTGACAGTGGTCAGGGA
TCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATATGGTTCCCAACATGAACAGGCACATTCTACAGGCACAGTC
CCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTATATCCACCCTCAAGTGTGGTGAACAGCCCCCCCTCCCAG
CCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTGTCCACTCAACCCAGCTGCCCAGGACGGGGCAAGATGTCC
AAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCCTATGCCCACTTTGGGATCCACGAGGAAATGCTGAAGGAT
GAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTGTTCAAGGACAAAGTGGTACTGGATGTGGGGAGTGGTACT
GGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGGATCGAATGCTCCAGTATTTCTGACTACTCAGAGAAGATC
ATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTGGAAGAGGTGGAGCTGCCTGTGGAGAAGGTGGACATCATC
ATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACGGTGATCTTTGCCAGGGACAAGTGGCTGAAACCTGGAGGG
CTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGACAGTACAAGGACTTCAAAATCCACTGGTGGGAGAATGTC
TATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTAGTGGACATCGTGGATCCAAAGCAAGTGGTGACCAATGCC
TGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCGTTCACATCTGCATTCTGCCTGCAGATACAGCGCAACGAC
TACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCACAAGAAAATGGGGTTTTCCACAGCCCCTGATGCTCCCTAC
ACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGGAGGGGGGAGGAAATCTACGGGACCATATCCATGAAGCCA
AATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAGGGACAGCTGTGTGAAACATCTGTATCTAATGACTACAAA

>In-frame_WNK1_ENST00000340908_chr12_971436_+_PRMT8_ENST00000452611_chr12_3649772_+_2028nt
ATGGATATTAAAAAGAAAGATTTTTGCTCAGTATTTGTCATCATAAATTCTCATTGCTGCTGCTGCCCTCAAAAGGATTGTATAAATGAG
GGGGTGAAGCCAGCCAGTTTTGACAAAGTAGCAATTCCTGAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGA
TATTCCATCAAAGACCTTTTGAACCATGCCTTCTTCCAAGAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAA
ATAGCCATAAAATTATGGCTACGTATTGAAGATATTAAGAAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGAT
TTAGAGAGAGATGTCCCAGAAGATGTTGCACAAGAAATGGTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCT
ATCAAAGACAGAGTATCATTAATTAAGAGGAAACGAGAGCAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGC
AGTCTCAAACAGCAGGTAGAACAATCCAGTGCTTCCCAGACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCT
ACCACTTCAGCTTCAGTTTCTACACAAGTAGAACCTGAAGAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATA
TCTGTGTTATCTGATGGGACGGTTGACAGTGGTCAGGGATCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATAT
GGTTCCCAACATGAACAGGCACATTCTACAGGCACAGTCCCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTA
TATCCACCCTCAAGTGTGGTGAACAGCCCCCCCTCCCAGCCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTG
TCCACTCAACCCAGCTGCCCAGGACGGGGCAAGATGTCCAAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCC
TATGCCCACTTTGGGATCCACGAGGAAATGCTGAAGGATGAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTG
TTCAAGGACAAAGTGGTACTGGATGTGGGGAGTGGTACTGGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGG
ATCGAATGCTCCAGTATTTCTGACTACTCAGAGAAGATCATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTG
GAAGAGGTGGAGCTGCCTGTGGAGAAGGTGGACATCATCATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACG
GTGATCTTTGCCAGGGACAAGTGGCTGAAACCTGGAGGGCTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGA
CAGTACAAGGACTTCAAAATCCACTGGTGGGAGAATGTCTATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTA
GTGGACATCGTGGATCCAAAGCAAGTGGTGACCAATGCCTGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCG
TTCACATCTGCATTCTGCCTGCAGATACAGCGCAACGACTACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCAC
AAGAAAATGGGGTTTTCCACAGCCCCTGATGCTCCCTACACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGG
AGGGGGGAGGAAATCTACGGGACCATATCCATGAAGCCAAATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAG

>In-frame_WNK1_ENST00000340908_chr12_971436_+_PRMT8_ENST00000382622_chr12_3649772_+_2028nt
ATGGATATTAAAAAGAAAGATTTTTGCTCAGTATTTGTCATCATAAATTCTCATTGCTGCTGCTGCCCTCAAAAGGATTGTATAAATGAG
GGGGTGAAGCCAGCCAGTTTTGACAAAGTAGCAATTCCTGAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGA
TATTCCATCAAAGACCTTTTGAACCATGCCTTCTTCCAAGAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAA
ATAGCCATAAAATTATGGCTACGTATTGAAGATATTAAGAAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGAT
TTAGAGAGAGATGTCCCAGAAGATGTTGCACAAGAAATGGTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCT
ATCAAAGACAGAGTATCATTAATTAAGAGGAAACGAGAGCAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGC
AGTCTCAAACAGCAGGTAGAACAATCCAGTGCTTCCCAGACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCT
ACCACTTCAGCTTCAGTTTCTACACAAGTAGAACCTGAAGAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATA
TCTGTGTTATCTGATGGGACGGTTGACAGTGGTCAGGGATCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATAT
GGTTCCCAACATGAACAGGCACATTCTACAGGCACAGTCCCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTA
TATCCACCCTCAAGTGTGGTGAACAGCCCCCCCTCCCAGCCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTG
TCCACTCAACCCAGCTGCCCAGGACGGGGCAAGATGTCCAAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCC
TATGCCCACTTTGGGATCCACGAGGAAATGCTGAAGGATGAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTG
TTCAAGGACAAAGTGGTACTGGATGTGGGGAGTGGTACTGGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGG
ATCGAATGCTCCAGTATTTCTGACTACTCAGAGAAGATCATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTG
GAAGAGGTGGAGCTGCCTGTGGAGAAGGTGGACATCATCATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACG
GTGATCTTTGCCAGGGACAAGTGGCTGAAACCTGGAGGGCTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGA
CAGTACAAGGACTTCAAAATCCACTGGTGGGAGAATGTCTATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTA
GTGGACATCGTGGATCCAAAGCAAGTGGTGACCAATGCCTGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCG
TTCACATCTGCATTCTGCCTGCAGATACAGCGCAACGACTACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCAC
AAGAAAATGGGGTTTTCCACAGCCCCTGATGCTCCCTACACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGG
AGGGGGGAGGAAATCTACGGGACCATATCCATGAAGCCAAATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_WNK1_ENST00000535572_chr12_971436_+_PRMT8_ENST00000452611_chr12_3649772_+_4222nt
ATTTAGCGCGGAGAGTTTCCCGGGTGGACGCGGCTCCTCTCTCGGCCACTCCGCACCCCCATCTTCGGTGACAGAAGGCGCCTGGTGGGG
GTGGCTGCTCTTTTCTCTCCCTGTTCCCCCTCACCCAGTCCTCTAGGTCTCCTCTCCTCTTGCCTCAGAGAAGCAGCGGAGCTCGGGCCC
CGCGGTGAGCGGCCCTCCCCTCCCCGCCGTTCCCTCCTCCGTCAGCCCCCGGCACCGGCCCGGGAGGAGACGGGTTTGCCAGGCCTGGGG
CGGGCGGGGAGGCCTCGGGGAAGGGGGGGCCCGCTCCTCAGGCGCCGAGGCTCCGAGGCTCCGGCCCTTCGCCTCTGGGCGATGGGCGAC
CTGTGAGGCCGGTCCCCATCGCTGGGGGCGCGTGTGGGAGGAGGCGGCCGCCCGAGTGACCGGGAGCCGGGCCGCGGCCTTCCCTCGCCC
GCCTCGGCCCCTCCCACTCCTCTGCCCCGGGGCCGCCACCGCCCGGGCGTCGGACCTGGTCCCGTGCTCGCGGTGCCGCCGCCCTCTGGG
CCTAGCCCGCCCAGCTCGGCGAGCGGCGGCAGTGGGAGCCGCGTCCGCCGCATCCGCCTCGACTCGGTGCCGGCCCCTGGCCCTCCCCTC
ATGACTGCGGCGCCTCTGCTGCCACCGCCCGCCCGGCCGCCGCTCGCCGCAGGATGGATGCGGACCGTGCGGCGCTAACCCCCGTGGCTC
AGCTCCCGAATCGCCCGCCTTCGAGCCCTCCTCGTGAGCCGCAGCAGCCTCGGTGCCAGCCCCCGCCGCAGCTGGGCCCAGCGGTCCGCC
TGTCCCTCGTTGCGGCTTGTCGGTGCTGAGTGAGGCGTCGTCCGGGTCGGCGCGAACCCGCCCGGCCGCGGTTCCCTGCAGACCTCTGCG
CGGGCGGCTCGGCCCTTCACGCCCTTTTCGTTCACGAATCCGAGCCCGCTCGCCTCTCTCCAGCGAACCGACCATGTCTGGCGGCGCCGC
AGAGAAGCAGAGCAGCACTCCCGGTTCCCTGTTCCTCTCGCCGCCGGCTCCTGCCCCCAAGAATGGCTCCAGCTCCGATTCCTCCGTGGG
GGAGAAACTGGGAGCCGCGGCCGCCGACGCTGTGACCGGCAGGACCGAGGAGTACAGGCGCCGCCGCCACACTATGGACAAGGACAGCCG
TGGGGCGGCCGCGACCACTACCACCACTGAGCACCGCTTCTTCCGCCGGAGCGTCATCTGTGACTCCAATGCCACTGCACTGGAGCTTCC
CGGCCTTCCTCTTTCCCTGCCCCAGCCCAGCATCCCCGCGGCTGTCCCGCAGAGTGCTCCACCGGAGCCCCACCGGGAAGAGACCGTGAC
CGCCACCGCCACTTCCCAGGTAGCCCAGCAGCCTCCAGCCGCTGCCGCCCCTGGGGAACAGGCCGTCGCGGGCCCTGCCCCCTCGACTGT
CCCCAGCAGTACCAGCAAAGACCGCCCAGTGTCCCAGCCTAGCCTTGTGGGGAGCAAAGAGGAGCCGCCGCCGGCGAGAAGTGGCAGCGG
CGGCGGCAGCGCCAAGGAGCCACAGGAGGAACGGAGCCAGCAGCAGGATGATATCGAAGAGCTGGAGACCAAGGCCGTGGGAATGTCTAA
CGATGGCCGCTTTCTCAAGTTTGACATCGAAATCGGCAGAGGCTCCTTTAAGACGGTCTACAAAGGTCTGGACACTGAAACCACCGTGGA
AGTCGCCTGGTGTGAACTGCAGGATCGAAAATTAACAAAGTCTGAGAGGCAGAGATTTAAAGAAGAAGCTGAAATGTTAAAAGGTCTTCA
GCATCCCAATATTGTTAGATTTTATGATTCCTGGGAATCCACAGTAAAAGGAAAGAAGTGCATTGTTTTGGTGACTGAACTTATGACGTC
TGGAACACTTAAAACGTATCTGAAAAGGTTTAAAGTGATGAAGATCAAAGTTCTAAGAAGCTGGTGCCGTCAGATCCTTAAAGGTCTTCA
GTTTCTTCATACTCGAACTCCACCTATCATTCACCGCGATCTTAAATGTGACAACATCTTTATCACCGGCCCTACTGGCTCAGTCAAGAT
TGGAGACCTCGGTCTGGCAACCCTGAAGCGGGCTTCTTTTGCCAAGAGTGTGATAGGTACCCCAGAGTTCATGGCCCCTGAGATGTATGA
GGAGAAATATGATGAATCCGTTGACGTTTATGCTTTTGGGATGTGCATGCTTGAGATGGCTACATCTGAATATCCTTACTCGGAGTGCCA
AAATGCTGCACAGATCTACCGTCGCGTGACCAGTGGGGTGAAGCCAGCCAGTTTTGACAAAGTAGCAATTCCTGAAGTGAAGGAAATTAT
TGAAGGATGCATACGACAAAACAAAGATGAAAGATATTCCATCAAAGACCTTTTGAACCATGCCTTCTTCCAAGAGGAAACAGGAGTACG
GGTAGAATTAGCAGAAGAAGATGATGGAGAAAAAATAGCCATAAAATTATGGCTACGTATTGAAGATATTAAGAAATTAAAGGGAAAATA
CAAAGATAATGAAGCTATTGAGTTTTCTTTTGATTTAGAGAGAGATGTCCCAGAAGATGTTGCACAAGAAATGGTAGAGTCTGGGTATGT
CTGTGAAGGTGATCACAAGACCATGGCTAAAGCTATCAAAGACAGAGTATCATTAATTAAGAGGAAACGAGAGCAGCGGCAGTTGGTACG
GGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGCAGTCTCAAACAGCAGGTAGAACAATCCAGTGCTTCCCAGACAGGAATCAAGCAGCT
CCCTTCTGCTAGCACCGGCATACCTACTGCTTCTACCACTTCAGCTTCAGTTTCTACACAAGTAGAACCTGAAGAACCTGAGGCAGATCA
ACATCAACAACTACAGTACCAGCAACCCAGTATATCTGTGTTATCTGATGGGACGGTTGACAGTGGTCAGGGATCCTCTGTCTTCACAGA
ATCTCGAGTGAGCAGCCAACAGACAGTTTCATATGGTTCCCAACATGAACAGGCACATTCTACAGGCACAGTCCCAGGGCATATACCTTC
TACTGTCCAAGCACAGTCTCAGCCCCATGGGGTATATCCACCCTCAAGTGTGGTGAACAGCCCCCCCTCCCAGCCCCCCCAGCCCGTCGT
CCCTGCTAAGCCCGTGCAATGCGTCCATCATGTGTCCACTCAACCCAGCTGCCCAGGACGGGGCAAGATGTCCAAGCTGCTGAACCCAGA
GGAGATGACCTCGAGAGATTATTACTTCGACTCCTATGCCCACTTTGGGATCCACGAGGAAATGCTGAAGGATGAGGTGCGGACTCTCAC
TTACCGGAACTCCATGTACCACAACAAGCACGTGTTCAAGGACAAAGTGGTACTGGATGTGGGGAGTGGTACTGGGATCCTTTCCATGTT
CGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGGATCGAATGCTCCAGTATTTCTGACTACTCAGAGAAGATCATTAAGGCCAACCACTT
GGACAACATCATCACCATATTTAAGGGTAAAGTGGAAGAGGTGGAGCTGCCTGTGGAGAAGGTGGACATCATCATCAGCGAGTGGATGGG
CTACTGTCTGTTCTATGAGTCCATGCTCAACACGGTGATCTTTGCCAGGGACAAGTGGCTGAAACCTGGAGGGCTTATGTTTCCAGACCG
GGCAGCTTTGTACGTGGTAGCGATTGAAGACAGACAGTACAAGGACTTCAAAATCCACTGGTGGGAGAATGTCTATGGCTTTGACATGAC
CTGCATCCGGGACGTGGCCATGAAGGAGCCTCTAGTGGACATCGTGGATCCAAAGCAAGTGGTGACCAATGCCTGTTTGATAAAGGAGGT
GGACATTTACACAGTGAAGACGGAAGAGCTATCGTTCACATCTGCATTCTGCCTGCAGATACAGCGCAACGACTACGTCCACGCCCTGGT
CACCTATTTTAATATTGAATTTACCAAGTGCCACAAGAAAATGGGGTTTTCCACAGCCCCTGATGCTCCCTACACCCACTGGAAGCAGAC
CGTCTTCTACTTGGAAGATTACCTCACTGTCCGGAGGGGGGAGGAAATCTACGGGACCATATCCATGAAGCCAAATGCCAAAAATGTGCG

>In-frame_WNK1_ENST00000535572_chr12_971436_+_PRMT8_ENST00000382622_chr12_3649772_+_5013nt
ATTTAGCGCGGAGAGTTTCCCGGGTGGACGCGGCTCCTCTCTCGGCCACTCCGCACCCCCATCTTCGGTGACAGAAGGCGCCTGGTGGGG
GTGGCTGCTCTTTTCTCTCCCTGTTCCCCCTCACCCAGTCCTCTAGGTCTCCTCTCCTCTTGCCTCAGAGAAGCAGCGGAGCTCGGGCCC
CGCGGTGAGCGGCCCTCCCCTCCCCGCCGTTCCCTCCTCCGTCAGCCCCCGGCACCGGCCCGGGAGGAGACGGGTTTGCCAGGCCTGGGG
CGGGCGGGGAGGCCTCGGGGAAGGGGGGGCCCGCTCCTCAGGCGCCGAGGCTCCGAGGCTCCGGCCCTTCGCCTCTGGGCGATGGGCGAC
CTGTGAGGCCGGTCCCCATCGCTGGGGGCGCGTGTGGGAGGAGGCGGCCGCCCGAGTGACCGGGAGCCGGGCCGCGGCCTTCCCTCGCCC
GCCTCGGCCCCTCCCACTCCTCTGCCCCGGGGCCGCCACCGCCCGGGCGTCGGACCTGGTCCCGTGCTCGCGGTGCCGCCGCCCTCTGGG
CCTAGCCCGCCCAGCTCGGCGAGCGGCGGCAGTGGGAGCCGCGTCCGCCGCATCCGCCTCGACTCGGTGCCGGCCCCTGGCCCTCCCCTC
ATGACTGCGGCGCCTCTGCTGCCACCGCCCGCCCGGCCGCCGCTCGCCGCAGGATGGATGCGGACCGTGCGGCGCTAACCCCCGTGGCTC
AGCTCCCGAATCGCCCGCCTTCGAGCCCTCCTCGTGAGCCGCAGCAGCCTCGGTGCCAGCCCCCGCCGCAGCTGGGCCCAGCGGTCCGCC
TGTCCCTCGTTGCGGCTTGTCGGTGCTGAGTGAGGCGTCGTCCGGGTCGGCGCGAACCCGCCCGGCCGCGGTTCCCTGCAGACCTCTGCG
CGGGCGGCTCGGCCCTTCACGCCCTTTTCGTTCACGAATCCGAGCCCGCTCGCCTCTCTCCAGCGAACCGACCATGTCTGGCGGCGCCGC
AGAGAAGCAGAGCAGCACTCCCGGTTCCCTGTTCCTCTCGCCGCCGGCTCCTGCCCCCAAGAATGGCTCCAGCTCCGATTCCTCCGTGGG
GGAGAAACTGGGAGCCGCGGCCGCCGACGCTGTGACCGGCAGGACCGAGGAGTACAGGCGCCGCCGCCACACTATGGACAAGGACAGCCG
TGGGGCGGCCGCGACCACTACCACCACTGAGCACCGCTTCTTCCGCCGGAGCGTCATCTGTGACTCCAATGCCACTGCACTGGAGCTTCC
CGGCCTTCCTCTTTCCCTGCCCCAGCCCAGCATCCCCGCGGCTGTCCCGCAGAGTGCTCCACCGGAGCCCCACCGGGAAGAGACCGTGAC
CGCCACCGCCACTTCCCAGGTAGCCCAGCAGCCTCCAGCCGCTGCCGCCCCTGGGGAACAGGCCGTCGCGGGCCCTGCCCCCTCGACTGT
CCCCAGCAGTACCAGCAAAGACCGCCCAGTGTCCCAGCCTAGCCTTGTGGGGAGCAAAGAGGAGCCGCCGCCGGCGAGAAGTGGCAGCGG
CGGCGGCAGCGCCAAGGAGCCACAGGAGGAACGGAGCCAGCAGCAGGATGATATCGAAGAGCTGGAGACCAAGGCCGTGGGAATGTCTAA
CGATGGCCGCTTTCTCAAGTTTGACATCGAAATCGGCAGAGGCTCCTTTAAGACGGTCTACAAAGGTCTGGACACTGAAACCACCGTGGA
AGTCGCCTGGTGTGAACTGCAGGATCGAAAATTAACAAAGTCTGAGAGGCAGAGATTTAAAGAAGAAGCTGAAATGTTAAAAGGTCTTCA
GCATCCCAATATTGTTAGATTTTATGATTCCTGGGAATCCACAGTAAAAGGAAAGAAGTGCATTGTTTTGGTGACTGAACTTATGACGTC
TGGAACACTTAAAACGTATCTGAAAAGGTTTAAAGTGATGAAGATCAAAGTTCTAAGAAGCTGGTGCCGTCAGATCCTTAAAGGTCTTCA
GTTTCTTCATACTCGAACTCCACCTATCATTCACCGCGATCTTAAATGTGACAACATCTTTATCACCGGCCCTACTGGCTCAGTCAAGAT
TGGAGACCTCGGTCTGGCAACCCTGAAGCGGGCTTCTTTTGCCAAGAGTGTGATAGGTACCCCAGAGTTCATGGCCCCTGAGATGTATGA
GGAGAAATATGATGAATCCGTTGACGTTTATGCTTTTGGGATGTGCATGCTTGAGATGGCTACATCTGAATATCCTTACTCGGAGTGCCA
AAATGCTGCACAGATCTACCGTCGCGTGACCAGTGGGGTGAAGCCAGCCAGTTTTGACAAAGTAGCAATTCCTGAAGTGAAGGAAATTAT
TGAAGGATGCATACGACAAAACAAAGATGAAAGATATTCCATCAAAGACCTTTTGAACCATGCCTTCTTCCAAGAGGAAACAGGAGTACG
GGTAGAATTAGCAGAAGAAGATGATGGAGAAAAAATAGCCATAAAATTATGGCTACGTATTGAAGATATTAAGAAATTAAAGGGAAAATA
CAAAGATAATGAAGCTATTGAGTTTTCTTTTGATTTAGAGAGAGATGTCCCAGAAGATGTTGCACAAGAAATGGTAGAGTCTGGGTATGT
CTGTGAAGGTGATCACAAGACCATGGCTAAAGCTATCAAAGACAGAGTATCATTAATTAAGAGGAAACGAGAGCAGCGGCAGTTGGTACG
GGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGCAGTCTCAAACAGCAGGTAGAACAATCCAGTGCTTCCCAGACAGGAATCAAGCAGCT
CCCTTCTGCTAGCACCGGCATACCTACTGCTTCTACCACTTCAGCTTCAGTTTCTACACAAGTAGAACCTGAAGAACCTGAGGCAGATCA
ACATCAACAACTACAGTACCAGCAACCCAGTATATCTGTGTTATCTGATGGGACGGTTGACAGTGGTCAGGGATCCTCTGTCTTCACAGA
ATCTCGAGTGAGCAGCCAACAGACAGTTTCATATGGTTCCCAACATGAACAGGCACATTCTACAGGCACAGTCCCAGGGCATATACCTTC
TACTGTCCAAGCACAGTCTCAGCCCCATGGGGTATATCCACCCTCAAGTGTGGTGAACAGCCCCCCCTCCCAGCCCCCCCAGCCCGTCGT
CCCTGCTAAGCCCGTGCAATGCGTCCATCATGTGTCCACTCAACCCAGCTGCCCAGGACGGGGCAAGATGTCCAAGCTGCTGAACCCAGA
GGAGATGACCTCGAGAGATTATTACTTCGACTCCTATGCCCACTTTGGGATCCACGAGGAAATGCTGAAGGATGAGGTGCGGACTCTCAC
TTACCGGAACTCCATGTACCACAACAAGCACGTGTTCAAGGACAAAGTGGTACTGGATGTGGGGAGTGGTACTGGGATCCTTTCCATGTT
CGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGGATCGAATGCTCCAGTATTTCTGACTACTCAGAGAAGATCATTAAGGCCAACCACTT
GGACAACATCATCACCATATTTAAGGGTAAAGTGGAAGAGGTGGAGCTGCCTGTGGAGAAGGTGGACATCATCATCAGCGAGTGGATGGG
CTACTGTCTGTTCTATGAGTCCATGCTCAACACGGTGATCTTTGCCAGGGACAAGTGGCTGAAACCTGGAGGGCTTATGTTTCCAGACCG
GGCAGCTTTGTACGTGGTAGCGATTGAAGACAGACAGTACAAGGACTTCAAAATCCACTGGTGGGAGAATGTCTATGGCTTTGACATGAC
CTGCATCCGGGACGTGGCCATGAAGGAGCCTCTAGTGGACATCGTGGATCCAAAGCAAGTGGTGACCAATGCCTGTTTGATAAAGGAGGT
GGACATTTACACAGTGAAGACGGAAGAGCTATCGTTCACATCTGCATTCTGCCTGCAGATACAGCGCAACGACTACGTCCACGCCCTGGT
CACCTATTTTAATATTGAATTTACCAAGTGCCACAAGAAAATGGGGTTTTCCACAGCCCCTGATGCTCCCTACACCCACTGGAAGCAGAC
CGTCTTCTACTTGGAAGATTACCTCACTGTCCGGAGGGGGGAGGAAATCTACGGGACCATATCCATGAAGCCAAATGCCAAAAATGTGCG
AGACCTCGATTTCACAGTAGACTTGGATTTTAAGGGACAGCTGTGTGAAACATCTGTATCTAATGACTACAAAATGCGTTAGCACACGTG
GGAAGCTGCAGAGAGCAACGAGAAAAGGAACTCTCACCTCGATCTGCCGTGCCGTCCCAAAGAATACCGTTTGCAGGACTACACACTTGA
AAACCAGAGTTTTCAACTCTGCCTTGAAGATTGGTGAACTCCCCAGGGCTCCCGTGGGCTCTGCCACTGGACAGAAGGCCTCCAGCTCCT
CCGCTCTGCCCTGGTAGCCCTTCACGAAGGCTTTGTGTTGCCAACAAAGAGCGACCTGGCGTGCTGTGGCTGGGCCCCGAGGGTGGAAAC
GTATTCGCGTCTCCCCGTCTCCTCCTTAACTGTGACTCTCCGGGTCTTCTGAGTTTTGCATGCTGCGGGTGTCTAGGACAGATTGCTTCC
ACTAGAACCTGGAGACATAGCATCTTTGATAGCATAAGCCAGATTATCTGTGTGTGCGGTGGTGTGCGTGTGCGTGCATGTGTGAATGTG
AGCAGCATAGTTGATATTTACCCACAAACACCTGTATATGCGTGCATATACAACCAAGTGGGTAGACCTAGGTGTTCTCTCAGAGGGGTG
TGTGTGTGTGTGCGTGCGCGTGTGCCTAGAATATATATTACTCTCAGAGGAGATTCTGTTGCTTTTGAATAGGAATTTGTTTTGTGATTA
GTTCGCCCCTTCCCCACCCCTTACCAGATGTTAAGCAGCTATGAAACATTCTCTGTACTAGTTCTGGTCTCCTTTTGACTGGACTGTGGC

>In-frame_WNK1_ENST00000537687_chr12_971436_+_PRMT8_ENST00000452611_chr12_3649772_+_3892nt
CCGGCCCTTCGCCTCTGGGCGATGGGCGACCTGTGAGGCCGGTCCCCATCGCTGGGGGCGCGTGTGGGAGGAGGCGGCCGCCCGAGTGAC
CGGGAGCCGGGCCGCGGCCTTCCCTCGCCCGCCTCGGCCCCTCCCACTCCTCTGCCCCGGGGCCGCCACCGCCCGGGCGTCGGACCTGGT
CCCGTGCTCGCGGTGCCGCCGCCCTCTGGGCCTAGCCCGCCCAGCTCGGCGAGCGGCGGCAGTGGGAGCCGCGTCCGCCGCATCCGCCTC
GACTCGGTGCCGGCCCCTGGCCCTCCCCTCATGACTGCGGCGCCTCTGCTGCCACCGCCCGCCCGGCCGCCGCTCGCCGCAGGATGGATG
CGGACCGTGCGGCGCTAACCCCCGTGGCTCAGCTCCCGAATCGCCCGCCTTCGAGCCCTCCTCGTGAGCCGCAGCAGCCTCGGTGCCAGC
CCCCGCCGCAGCTGGGCCCAGCGGTCCGCCTGTCCCTCGTTGCGGCTTGTCGGTGCTGAGTGAGGCGTCGTCCGGGTCGGCGCGAACCCG
CCCGGCCGCGGTTCCCTGCAGACCTCTGCGCGGGCGGCTCGGCCCTTCACGCCCTTTTCGTTCACGAATCCGAGCCCGCTCGCCTCTCTC
CAGCGAACCGACCATGTCTGGCGGCGCCGCAGAGAAGCAGAGCAGCACTCCCGGTTCCCTGTTCCTCTCGCCGCCGGCTCCTGCCCCCAA
GAATGGCTCCAGCTCCGATTCCTCCGTGGGGGAGAAACTGGGAGCCGCGGCCGCCGACGCTGTGACCGGCAGGACCGAGGAGTACAGGCG
CCGCCGCCACACTATGGACAAGGACAGCCGTGGGGCGGCCGCGACCACTACCACCACTGAGCACCGCTTCTTCCGCCGGAGCGTCATCTG
TGACTCCAATGCCACTGCACTGGAGCTTCCCGGCCTTCCTCTTTCCCTGCCCCAGCCCAGCATCCCCGCGGCTGTCCCGCAGAGTGCTCC
ACCGGAGCCCCACCGGGAAGAGACCGTGACCGCCACCGCCACTTCCCAGGTAGCCCAGCAGCCTCCAGCCGCTGCCGCCCCTGGGGAACA
GGCCGTCGCGGGCCCTGCCCCCTCGACTGTCCCCAGCAGTACCAGCAAAGACCGCCCAGTGTCCCAGCCTAGCCTTGTGGGGAGCAAAGA
GGAGCCGCCGCCGGCGAGAAGTGGCAGCGGCGGCGGCAGCGCCAAGGAGCCACAGGAGGAACGGAGCCAGCAGCAGGATGATATCGAAGA
GCTGGAGACCAAGGCCGTGGGAATGTCTAACGATGGCCGCTTTCTCAAGTTTGACATCGAAATCGGCAGAGGCTCCTTTAAGACGGTCTA
CAAAGGTCTGGACACTGAAACCACCGTGGAAGTCGCCTGGTGTGAACTGCAGGATCGAAAATTAACAAAGTCTGAGAGGCAGAGATTTAA
AGAAGAAGCTGAAATGTTAAAAGGTCTTCAGCATCCCAATATTGTTAGATTTTATGATTCCTGGGAATCCACAGTAAAAGGAAAGAAGTG
CATTGTTTTGGTGACTGAACTTATGACGTCTGGAACACTTAAAACGTATCTGAAAAGGTTTAAAGTGATGAAGATCAAAGTTCTAAGAAG
CTGGTGCCGTCAGATCCTTAAAGGTCTTCAGTTTCTTCATACTCGAACTCCACCTATCATTCACCGCGATCTTAAATGTGACAACATCTT
TATCACCGGCCCTACTGGCTCAGTCAAGATTGGAGACCTCGGTCTGGCAACCCTGAAGCGGGCTTCTTTTGCCAAGAGTGTGATAGGTAC
CCCAGAGTTCATGGCCCCTGAGATGTATGAGGAGAAATATGATGAATCCGTTGACGTTTATGCTTTTGGGATGTGCATGCTTGAGATGGC
TACATCTGAATATCCTTACTCGGAGTGCCAAAATGCTGCACAGATCTACCGTCGCGTGACCAGTGGGGTGAAGCCAGCCAGTTTTGACAA
AGTAGCAATTCCTGAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGATATTCCATCAAAGACCTTTTGAACCA
TGCCTTCTTCCAAGAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAAATAGCCATAAAATTATGGCTACGTAT
TGAAGATATTAAGAAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGATTTAGAGAGAGATGTCCCAGAAGATGT
TGCACAAGAAATGGTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCTATCAAAGACAGAGTATCATTAATTAA
GAGGAAACGAGAGCAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGCAGTCTCAAACAGCAGGTAGAACAATC
CAGTGCTTCCCAGACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCTACCACTTCAGCTTCAGTTTCTACACA
AGTAGAACCTGAAGAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATATCTGTGTTATCTGATGGGACGGTTGA
CAGTGGTCAGGGATCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATATGGTTCCCAACATGAACAGGCACATTC
TACAGGCACAGTCCCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTATATCCACCCTCAAGTGTGGTGAACAG
CCCCCCCTCCCAGCCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTGTCCACTCAACCCAGCTGCCCAGGACG
GGGCAAGATGTCCAAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCCTATGCCCACTTTGGGATCCACGAGGA
AATGCTGAAGGATGAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTGTTCAAGGACAAAGTGGTACTGGATGT
GGGGAGTGGTACTGGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGGATCGAATGCTCCAGTATTTCTGACTA
CTCAGAGAAGATCATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTGGAAGAGGTGGAGCTGCCTGTGGAGAA
GGTGGACATCATCATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACGGTGATCTTTGCCAGGGACAAGTGGCT
GAAACCTGGAGGGCTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGACAGTACAAGGACTTCAAAATCCACTG
GTGGGAGAATGTCTATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTAGTGGACATCGTGGATCCAAAGCAAGT
GGTGACCAATGCCTGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCGTTCACATCTGCATTCTGCCTGCAGAT
ACAGCGCAACGACTACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCACAAGAAAATGGGGTTTTCCACAGCCCC
TGATGCTCCCTACACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGGAGGGGGGAGGAAATCTACGGGACCAT
ATCCATGAAGCCAAATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAGGGACAGCTGTGTGAAACATCTGTATC

>In-frame_WNK1_ENST00000537687_chr12_971436_+_PRMT8_ENST00000382622_chr12_3649772_+_4683nt
CCGGCCCTTCGCCTCTGGGCGATGGGCGACCTGTGAGGCCGGTCCCCATCGCTGGGGGCGCGTGTGGGAGGAGGCGGCCGCCCGAGTGAC
CGGGAGCCGGGCCGCGGCCTTCCCTCGCCCGCCTCGGCCCCTCCCACTCCTCTGCCCCGGGGCCGCCACCGCCCGGGCGTCGGACCTGGT
CCCGTGCTCGCGGTGCCGCCGCCCTCTGGGCCTAGCCCGCCCAGCTCGGCGAGCGGCGGCAGTGGGAGCCGCGTCCGCCGCATCCGCCTC
GACTCGGTGCCGGCCCCTGGCCCTCCCCTCATGACTGCGGCGCCTCTGCTGCCACCGCCCGCCCGGCCGCCGCTCGCCGCAGGATGGATG
CGGACCGTGCGGCGCTAACCCCCGTGGCTCAGCTCCCGAATCGCCCGCCTTCGAGCCCTCCTCGTGAGCCGCAGCAGCCTCGGTGCCAGC
CCCCGCCGCAGCTGGGCCCAGCGGTCCGCCTGTCCCTCGTTGCGGCTTGTCGGTGCTGAGTGAGGCGTCGTCCGGGTCGGCGCGAACCCG
CCCGGCCGCGGTTCCCTGCAGACCTCTGCGCGGGCGGCTCGGCCCTTCACGCCCTTTTCGTTCACGAATCCGAGCCCGCTCGCCTCTCTC
CAGCGAACCGACCATGTCTGGCGGCGCCGCAGAGAAGCAGAGCAGCACTCCCGGTTCCCTGTTCCTCTCGCCGCCGGCTCCTGCCCCCAA
GAATGGCTCCAGCTCCGATTCCTCCGTGGGGGAGAAACTGGGAGCCGCGGCCGCCGACGCTGTGACCGGCAGGACCGAGGAGTACAGGCG
CCGCCGCCACACTATGGACAAGGACAGCCGTGGGGCGGCCGCGACCACTACCACCACTGAGCACCGCTTCTTCCGCCGGAGCGTCATCTG
TGACTCCAATGCCACTGCACTGGAGCTTCCCGGCCTTCCTCTTTCCCTGCCCCAGCCCAGCATCCCCGCGGCTGTCCCGCAGAGTGCTCC
ACCGGAGCCCCACCGGGAAGAGACCGTGACCGCCACCGCCACTTCCCAGGTAGCCCAGCAGCCTCCAGCCGCTGCCGCCCCTGGGGAACA
GGCCGTCGCGGGCCCTGCCCCCTCGACTGTCCCCAGCAGTACCAGCAAAGACCGCCCAGTGTCCCAGCCTAGCCTTGTGGGGAGCAAAGA
GGAGCCGCCGCCGGCGAGAAGTGGCAGCGGCGGCGGCAGCGCCAAGGAGCCACAGGAGGAACGGAGCCAGCAGCAGGATGATATCGAAGA
GCTGGAGACCAAGGCCGTGGGAATGTCTAACGATGGCCGCTTTCTCAAGTTTGACATCGAAATCGGCAGAGGCTCCTTTAAGACGGTCTA
CAAAGGTCTGGACACTGAAACCACCGTGGAAGTCGCCTGGTGTGAACTGCAGGATCGAAAATTAACAAAGTCTGAGAGGCAGAGATTTAA
AGAAGAAGCTGAAATGTTAAAAGGTCTTCAGCATCCCAATATTGTTAGATTTTATGATTCCTGGGAATCCACAGTAAAAGGAAAGAAGTG
CATTGTTTTGGTGACTGAACTTATGACGTCTGGAACACTTAAAACGTATCTGAAAAGGTTTAAAGTGATGAAGATCAAAGTTCTAAGAAG
CTGGTGCCGTCAGATCCTTAAAGGTCTTCAGTTTCTTCATACTCGAACTCCACCTATCATTCACCGCGATCTTAAATGTGACAACATCTT
TATCACCGGCCCTACTGGCTCAGTCAAGATTGGAGACCTCGGTCTGGCAACCCTGAAGCGGGCTTCTTTTGCCAAGAGTGTGATAGGTAC
CCCAGAGTTCATGGCCCCTGAGATGTATGAGGAGAAATATGATGAATCCGTTGACGTTTATGCTTTTGGGATGTGCATGCTTGAGATGGC
TACATCTGAATATCCTTACTCGGAGTGCCAAAATGCTGCACAGATCTACCGTCGCGTGACCAGTGGGGTGAAGCCAGCCAGTTTTGACAA
AGTAGCAATTCCTGAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGATATTCCATCAAAGACCTTTTGAACCA
TGCCTTCTTCCAAGAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAAATAGCCATAAAATTATGGCTACGTAT
TGAAGATATTAAGAAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGATTTAGAGAGAGATGTCCCAGAAGATGT
TGCACAAGAAATGGTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCTATCAAAGACAGAGTATCATTAATTAA
GAGGAAACGAGAGCAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGCAGTCTCAAACAGCAGGTAGAACAATC
CAGTGCTTCCCAGACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCTACCACTTCAGCTTCAGTTTCTACACA
AGTAGAACCTGAAGAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATATCTGTGTTATCTGATGGGACGGTTGA
CAGTGGTCAGGGATCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATATGGTTCCCAACATGAACAGGCACATTC
TACAGGCACAGTCCCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTATATCCACCCTCAAGTGTGGTGAACAG
CCCCCCCTCCCAGCCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTGTCCACTCAACCCAGCTGCCCAGGACG
GGGCAAGATGTCCAAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCCTATGCCCACTTTGGGATCCACGAGGA
AATGCTGAAGGATGAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTGTTCAAGGACAAAGTGGTACTGGATGT
GGGGAGTGGTACTGGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGGATCGAATGCTCCAGTATTTCTGACTA
CTCAGAGAAGATCATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTGGAAGAGGTGGAGCTGCCTGTGGAGAA
GGTGGACATCATCATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACGGTGATCTTTGCCAGGGACAAGTGGCT
GAAACCTGGAGGGCTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGACAGTACAAGGACTTCAAAATCCACTG
GTGGGAGAATGTCTATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTAGTGGACATCGTGGATCCAAAGCAAGT
GGTGACCAATGCCTGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCGTTCACATCTGCATTCTGCCTGCAGAT
ACAGCGCAACGACTACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCACAAGAAAATGGGGTTTTCCACAGCCCC
TGATGCTCCCTACACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGGAGGGGGGAGGAAATCTACGGGACCAT
ATCCATGAAGCCAAATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAGGGACAGCTGTGTGAAACATCTGTATC
TAATGACTACAAAATGCGTTAGCACACGTGGGAAGCTGCAGAGAGCAACGAGAAAAGGAACTCTCACCTCGATCTGCCGTGCCGTCCCAA
AGAATACCGTTTGCAGGACTACACACTTGAAAACCAGAGTTTTCAACTCTGCCTTGAAGATTGGTGAACTCCCCAGGGCTCCCGTGGGCT
CTGCCACTGGACAGAAGGCCTCCAGCTCCTCCGCTCTGCCCTGGTAGCCCTTCACGAAGGCTTTGTGTTGCCAACAAAGAGCGACCTGGC
GTGCTGTGGCTGGGCCCCGAGGGTGGAAACGTATTCGCGTCTCCCCGTCTCCTCCTTAACTGTGACTCTCCGGGTCTTCTGAGTTTTGCA
TGCTGCGGGTGTCTAGGACAGATTGCTTCCACTAGAACCTGGAGACATAGCATCTTTGATAGCATAAGCCAGATTATCTGTGTGTGCGGT
GGTGTGCGTGTGCGTGCATGTGTGAATGTGAGCAGCATAGTTGATATTTACCCACAAACACCTGTATATGCGTGCATATACAACCAAGTG
GGTAGACCTAGGTGTTCTCTCAGAGGGGTGTGTGTGTGTGTGCGTGCGCGTGTGCCTAGAATATATATTACTCTCAGAGGAGATTCTGTT
GCTTTTGAATAGGAATTTGTTTTGTGATTAGTTCGCCCCTTCCCCACCCCTTACCAGATGTTAAGCAGCTATGAAACATTCTCTGTACTA
GTTCTGGTCTCCTTTTGACTGGACTGTGGCTCTGAACCTTGAGCATAGTACCACGGACTCCGTGGGCGCTCAATAAACACACATGAGAAC

>In-frame_WNK1_ENST00000315939_chr12_971436_+_PRMT8_ENST00000452611_chr12_3649772_+_3892nt
CCGGCCCTTCGCCTCTGGGCGATGGGCGACCTGTGAGGCCGGTCCCCATCGCTGGGGGCGCGTGTGGGAGGAGGCGGCCGCCCGAGTGAC
CGGGAGCCGGGCCGCGGCCTTCCCTCGCCCGCCTCGGCCCCTCCCACTCCTCTGCCCCGGGGCCGCCACCGCCCGGGCGTCGGACCTGGT
CCCGTGCTCGCGGTGCCGCCGCCCTCTGGGCCTAGCCCGCCCAGCTCGGCGAGCGGCGGCAGTGGGAGCCGCGTCCGCCGCATCCGCCTC
GACTCGGTGCCGGCCCCTGGCCCTCCCCTCATGACTGCGGCGCCTCTGCTGCCACCGCCCGCCCGGCCGCCGCTCGCCGCAGGATGGATG
CGGACCGTGCGGCGCTAACCCCCGTGGCTCAGCTCCCGAATCGCCCGCCTTCGAGCCCTCCTCGTGAGCCGCAGCAGCCTCGGTGCCAGC
CCCCGCCGCAGCTGGGCCCAGCGGTCCGCCTGTCCCTCGTTGCGGCTTGTCGGTGCTGAGTGAGGCGTCGTCCGGGTCGGCGCGAACCCG
CCCGGCCGCGGTTCCCTGCAGACCTCTGCGCGGGCGGCTCGGCCCTTCACGCCCTTTTCGTTCACGAATCCGAGCCCGCTCGCCTCTCTC
CAGCGAACCGACCATGTCTGGCGGCGCCGCAGAGAAGCAGAGCAGCACTCCCGGTTCCCTGTTCCTCTCGCCGCCGGCTCCTGCCCCCAA
GAATGGCTCCAGCTCCGATTCCTCCGTGGGGGAGAAACTGGGAGCCGCGGCCGCCGACGCTGTGACCGGCAGGACCGAGGAGTACAGGCG
CCGCCGCCACACTATGGACAAGGACAGCCGTGGGGCGGCCGCGACCACTACCACCACTGAGCACCGCTTCTTCCGCCGGAGCGTCATCTG
TGACTCCAATGCCACTGCACTGGAGCTTCCCGGCCTTCCTCTTTCCCTGCCCCAGCCCAGCATCCCCGCGGCTGTCCCGCAGAGTGCTCC
ACCGGAGCCCCACCGGGAAGAGACCGTGACCGCCACCGCCACTTCCCAGGTAGCCCAGCAGCCTCCAGCCGCTGCCGCCCCTGGGGAACA
GGCCGTCGCGGGCCCTGCCCCCTCGACTGTCCCCAGCAGTACCAGCAAAGACCGCCCAGTGTCCCAGCCTAGCCTTGTGGGGAGCAAAGA
GGAGCCGCCGCCGGCGAGAAGTGGCAGCGGCGGCGGCAGCGCCAAGGAGCCACAGGAGGAACGGAGCCAGCAGCAGGATGATATCGAAGA
GCTGGAGACCAAGGCCGTGGGAATGTCTAACGATGGCCGCTTTCTCAAGTTTGACATCGAAATCGGCAGAGGCTCCTTTAAGACGGTCTA
CAAAGGTCTGGACACTGAAACCACCGTGGAAGTCGCCTGGTGTGAACTGCAGGATCGAAAATTAACAAAGTCTGAGAGGCAGAGATTTAA
AGAAGAAGCTGAAATGTTAAAAGGTCTTCAGCATCCCAATATTGTTAGATTTTATGATTCCTGGGAATCCACAGTAAAAGGAAAGAAGTG
CATTGTTTTGGTGACTGAACTTATGACGTCTGGAACACTTAAAACGTATCTGAAAAGGTTTAAAGTGATGAAGATCAAAGTTCTAAGAAG
CTGGTGCCGTCAGATCCTTAAAGGTCTTCAGTTTCTTCATACTCGAACTCCACCTATCATTCACCGCGATCTTAAATGTGACAACATCTT
TATCACCGGCCCTACTGGCTCAGTCAAGATTGGAGACCTCGGTCTGGCAACCCTGAAGCGGGCTTCTTTTGCCAAGAGTGTGATAGGTAC
CCCAGAGTTCATGGCCCCTGAGATGTATGAGGAGAAATATGATGAATCCGTTGACGTTTATGCTTTTGGGATGTGCATGCTTGAGATGGC
TACATCTGAATATCCTTACTCGGAGTGCCAAAATGCTGCACAGATCTACCGTCGCGTGACCAGTGGGGTGAAGCCAGCCAGTTTTGACAA
AGTAGCAATTCCTGAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGATATTCCATCAAAGACCTTTTGAACCA
TGCCTTCTTCCAAGAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAAATAGCCATAAAATTATGGCTACGTAT
TGAAGATATTAAGAAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGATTTAGAGAGAGATGTCCCAGAAGATGT
TGCACAAGAAATGGTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCTATCAAAGACAGAGTATCATTAATTAA
GAGGAAACGAGAGCAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGCAGTCTCAAACAGCAGGTAGAACAATC
CAGTGCTTCCCAGACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCTACCACTTCAGCTTCAGTTTCTACACA
AGTAGAACCTGAAGAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATATCTGTGTTATCTGATGGGACGGTTGA
CAGTGGTCAGGGATCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATATGGTTCCCAACATGAACAGGCACATTC
TACAGGCACAGTCCCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTATATCCACCCTCAAGTGTGGTGAACAG
CCCCCCCTCCCAGCCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTGTCCACTCAACCCAGCTGCCCAGGACG
GGGCAAGATGTCCAAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCCTATGCCCACTTTGGGATCCACGAGGA
AATGCTGAAGGATGAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTGTTCAAGGACAAAGTGGTACTGGATGT
GGGGAGTGGTACTGGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGGATCGAATGCTCCAGTATTTCTGACTA
CTCAGAGAAGATCATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTGGAAGAGGTGGAGCTGCCTGTGGAGAA
GGTGGACATCATCATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACGGTGATCTTTGCCAGGGACAAGTGGCT
GAAACCTGGAGGGCTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGACAGTACAAGGACTTCAAAATCCACTG
GTGGGAGAATGTCTATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTAGTGGACATCGTGGATCCAAAGCAAGT
GGTGACCAATGCCTGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCGTTCACATCTGCATTCTGCCTGCAGAT
ACAGCGCAACGACTACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCACAAGAAAATGGGGTTTTCCACAGCCCC
TGATGCTCCCTACACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGGAGGGGGGAGGAAATCTACGGGACCAT
ATCCATGAAGCCAAATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAGGGACAGCTGTGTGAAACATCTGTATC

>In-frame_WNK1_ENST00000315939_chr12_971436_+_PRMT8_ENST00000382622_chr12_3649772_+_4683nt
CCGGCCCTTCGCCTCTGGGCGATGGGCGACCTGTGAGGCCGGTCCCCATCGCTGGGGGCGCGTGTGGGAGGAGGCGGCCGCCCGAGTGAC
CGGGAGCCGGGCCGCGGCCTTCCCTCGCCCGCCTCGGCCCCTCCCACTCCTCTGCCCCGGGGCCGCCACCGCCCGGGCGTCGGACCTGGT
CCCGTGCTCGCGGTGCCGCCGCCCTCTGGGCCTAGCCCGCCCAGCTCGGCGAGCGGCGGCAGTGGGAGCCGCGTCCGCCGCATCCGCCTC
GACTCGGTGCCGGCCCCTGGCCCTCCCCTCATGACTGCGGCGCCTCTGCTGCCACCGCCCGCCCGGCCGCCGCTCGCCGCAGGATGGATG
CGGACCGTGCGGCGCTAACCCCCGTGGCTCAGCTCCCGAATCGCCCGCCTTCGAGCCCTCCTCGTGAGCCGCAGCAGCCTCGGTGCCAGC
CCCCGCCGCAGCTGGGCCCAGCGGTCCGCCTGTCCCTCGTTGCGGCTTGTCGGTGCTGAGTGAGGCGTCGTCCGGGTCGGCGCGAACCCG
CCCGGCCGCGGTTCCCTGCAGACCTCTGCGCGGGCGGCTCGGCCCTTCACGCCCTTTTCGTTCACGAATCCGAGCCCGCTCGCCTCTCTC
CAGCGAACCGACCATGTCTGGCGGCGCCGCAGAGAAGCAGAGCAGCACTCCCGGTTCCCTGTTCCTCTCGCCGCCGGCTCCTGCCCCCAA
GAATGGCTCCAGCTCCGATTCCTCCGTGGGGGAGAAACTGGGAGCCGCGGCCGCCGACGCTGTGACCGGCAGGACCGAGGAGTACAGGCG
CCGCCGCCACACTATGGACAAGGACAGCCGTGGGGCGGCCGCGACCACTACCACCACTGAGCACCGCTTCTTCCGCCGGAGCGTCATCTG
TGACTCCAATGCCACTGCACTGGAGCTTCCCGGCCTTCCTCTTTCCCTGCCCCAGCCCAGCATCCCCGCGGCTGTCCCGCAGAGTGCTCC
ACCGGAGCCCCACCGGGAAGAGACCGTGACCGCCACCGCCACTTCCCAGGTAGCCCAGCAGCCTCCAGCCGCTGCCGCCCCTGGGGAACA
GGCCGTCGCGGGCCCTGCCCCCTCGACTGTCCCCAGCAGTACCAGCAAAGACCGCCCAGTGTCCCAGCCTAGCCTTGTGGGGAGCAAAGA
GGAGCCGCCGCCGGCGAGAAGTGGCAGCGGCGGCGGCAGCGCCAAGGAGCCACAGGAGGAACGGAGCCAGCAGCAGGATGATATCGAAGA
GCTGGAGACCAAGGCCGTGGGAATGTCTAACGATGGCCGCTTTCTCAAGTTTGACATCGAAATCGGCAGAGGCTCCTTTAAGACGGTCTA
CAAAGGTCTGGACACTGAAACCACCGTGGAAGTCGCCTGGTGTGAACTGCAGGATCGAAAATTAACAAAGTCTGAGAGGCAGAGATTTAA
AGAAGAAGCTGAAATGTTAAAAGGTCTTCAGCATCCCAATATTGTTAGATTTTATGATTCCTGGGAATCCACAGTAAAAGGAAAGAAGTG
CATTGTTTTGGTGACTGAACTTATGACGTCTGGAACACTTAAAACGTATCTGAAAAGGTTTAAAGTGATGAAGATCAAAGTTCTAAGAAG
CTGGTGCCGTCAGATCCTTAAAGGTCTTCAGTTTCTTCATACTCGAACTCCACCTATCATTCACCGCGATCTTAAATGTGACAACATCTT
TATCACCGGCCCTACTGGCTCAGTCAAGATTGGAGACCTCGGTCTGGCAACCCTGAAGCGGGCTTCTTTTGCCAAGAGTGTGATAGGTAC
CCCAGAGTTCATGGCCCCTGAGATGTATGAGGAGAAATATGATGAATCCGTTGACGTTTATGCTTTTGGGATGTGCATGCTTGAGATGGC
TACATCTGAATATCCTTACTCGGAGTGCCAAAATGCTGCACAGATCTACCGTCGCGTGACCAGTGGGGTGAAGCCAGCCAGTTTTGACAA
AGTAGCAATTCCTGAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGATATTCCATCAAAGACCTTTTGAACCA
TGCCTTCTTCCAAGAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAAATAGCCATAAAATTATGGCTACGTAT
TGAAGATATTAAGAAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGATTTAGAGAGAGATGTCCCAGAAGATGT
TGCACAAGAAATGGTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCTATCAAAGACAGAGTATCATTAATTAA
GAGGAAACGAGAGCAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGCAGTCTCAAACAGCAGGTAGAACAATC
CAGTGCTTCCCAGACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCTACCACTTCAGCTTCAGTTTCTACACA
AGTAGAACCTGAAGAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATATCTGTGTTATCTGATGGGACGGTTGA
CAGTGGTCAGGGATCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATATGGTTCCCAACATGAACAGGCACATTC
TACAGGCACAGTCCCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTATATCCACCCTCAAGTGTGGTGAACAG
CCCCCCCTCCCAGCCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTGTCCACTCAACCCAGCTGCCCAGGACG
GGGCAAGATGTCCAAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCCTATGCCCACTTTGGGATCCACGAGGA
AATGCTGAAGGATGAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTGTTCAAGGACAAAGTGGTACTGGATGT
GGGGAGTGGTACTGGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGGATCGAATGCTCCAGTATTTCTGACTA
CTCAGAGAAGATCATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTGGAAGAGGTGGAGCTGCCTGTGGAGAA
GGTGGACATCATCATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACGGTGATCTTTGCCAGGGACAAGTGGCT
GAAACCTGGAGGGCTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGACAGTACAAGGACTTCAAAATCCACTG
GTGGGAGAATGTCTATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTAGTGGACATCGTGGATCCAAAGCAAGT
GGTGACCAATGCCTGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCGTTCACATCTGCATTCTGCCTGCAGAT
ACAGCGCAACGACTACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCACAAGAAAATGGGGTTTTCCACAGCCCC
TGATGCTCCCTACACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGGAGGGGGGAGGAAATCTACGGGACCAT
ATCCATGAAGCCAAATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAGGGACAGCTGTGTGAAACATCTGTATC
TAATGACTACAAAATGCGTTAGCACACGTGGGAAGCTGCAGAGAGCAACGAGAAAAGGAACTCTCACCTCGATCTGCCGTGCCGTCCCAA
AGAATACCGTTTGCAGGACTACACACTTGAAAACCAGAGTTTTCAACTCTGCCTTGAAGATTGGTGAACTCCCCAGGGCTCCCGTGGGCT
CTGCCACTGGACAGAAGGCCTCCAGCTCCTCCGCTCTGCCCTGGTAGCCCTTCACGAAGGCTTTGTGTTGCCAACAAAGAGCGACCTGGC
GTGCTGTGGCTGGGCCCCGAGGGTGGAAACGTATTCGCGTCTCCCCGTCTCCTCCTTAACTGTGACTCTCCGGGTCTTCTGAGTTTTGCA
TGCTGCGGGTGTCTAGGACAGATTGCTTCCACTAGAACCTGGAGACATAGCATCTTTGATAGCATAAGCCAGATTATCTGTGTGTGCGGT
GGTGTGCGTGTGCGTGCATGTGTGAATGTGAGCAGCATAGTTGATATTTACCCACAAACACCTGTATATGCGTGCATATACAACCAAGTG
GGTAGACCTAGGTGTTCTCTCAGAGGGGTGTGTGTGTGTGTGCGTGCGCGTGTGCCTAGAATATATATTACTCTCAGAGGAGATTCTGTT
GCTTTTGAATAGGAATTTGTTTTGTGATTAGTTCGCCCCTTCCCCACCCCTTACCAGATGTTAAGCAGCTATGAAACATTCTCTGTACTA
GTTCTGGTCTCCTTTTGACTGGACTGTGGCTCTGAACCTTGAGCATAGTACCACGGACTCCGTGGGCGCTCAATAAACACACATGAGAAC

>In-frame_WNK1_ENST00000530271_chr12_971436_+_PRMT8_ENST00000452611_chr12_3649772_+_3249nt
ATGTCTGGCGGCGCCGCAGAGAAGCAGAGCAGCACTCCCGGTTCCCTGTTCCTCTCGCCGCCGGCTCCTGCCCCCAAGAATGGCTCCAGC
TCCGATTCCTCCGTGGGGGAGAAACTGGGAGCCGCGGCCGCCGACGCTGTGACCGGCAGGACCGAGGAGTACAGGCGCCGCCGCCACACT
ATGGACAAGGACAGCCGTGGGGCGGCCGCGACCACTACCACCACTGAGCACCGCTTCTTCCGCCGGAGCGTCATCTGTGACTCCAATGCC
ACTGCACTGGAGCTTCCCGGCCTTCCTCTTTCCCTGCCCCAGCCCAGCATCCCCGCGGCTGTCCCGCAGAGTGCTCCACCGGAGCCCCAC
CGGGAAGAGACCGTGACCGCCACCGCCACTTCCCAGGTAGCCCAGCAGCCTCCAGCCGCTGCCGCCCCTGGGGAACAGGCCGTCGCGGGC
CCTGCCCCCTCGACTGTCCCCAGCAGTACCAGCAAAGACCGCCCAGTGTCCCAGCCTAGCCTTGTGGGGAGCAAAGAGGAGCCGCCGCCG
GCGAGAAGTGGCAGCGGCGGCGGCAGCGCCAAGGAGCCACAGGAGGAACGGAGCCAGCAGCAGGATGATATCGAAGAGCTGGAGACCAAG
GCCGTGGGAATGTCTAACGATGGCCGCTTTCTCAAGTTTGACATCGAAATCGGCAGAGGCTCCTTTAAGACGGTCTACAAAGGTCTGGAC
ACTGAAACCACCGTGGAAGTCGCCTGGTGTGAACTGCAGGATCGAAAATTAACAAAGTCTGAGAGGCAGAGATTTAAAGAAGAAGCTGAA
ATGTTAAAAGGTCTTCAGCATCCCAATATTGTTAGATTTTATGATTCCTGGGAATCCACAGTAAAAGGAAAGAAGTGCATTGTTTTGGTG
ACTGAACTTATGACGTCTGGAACACTTAAAACGTATCTGAAAAGGTTTAAAGTGATGAAGATCAAAGTTCTAAGAAGCTGGTGCCGTCAG
ATCCTTAAAGGTCTTCAGTTTCTTCATACTCGAACTCCACCTATCATTCACCGCGATCTTAAATGTGACAACATCTTTATCACCGGCCCT
ACTGGCTCAGTCAAGATTGGAGACCTCGGTCTGGCAACCCTGAAGCGGGCTTCTTTTGCCAAGAGTGTGATAGGTACCCCAGAGTTCATG
GCCCCTGAGATGTATGAGGAGAAATATGATGAATCCGTTGACGTTTATGCTTTTGGGATGTGCATGCTTGAGATGGCTACATCTGAATAT
CCTTACTCGGAGTGCCAAAATGCTGCACAGATCTACCGTCGCGTGACCAGTGGGGTGAAGCCAGCCAGTTTTGACAAAGTAGCAATTCCT
GAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGATATTCCATCAAAGACCTTTTGAACCATGCCTTCTTCCAA
GAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAAATAGCCATAAAATTATGGCTACGTATTGAAGATATTAAG
AAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGATTTAGAGAGAGATGTCCCAGAAGATGTTGCACAAGAAATG
GTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCTATCAAAGACAGAGTATCATTAATTAAGAGGAAACGAGAG
CAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGCAGTCTCAAACAGCAGGTAGAACAATCCAGTGCTTCCCAG
ACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCTACCACTTCAGCTTCAGTTTCTACACAAGTAGAACCTGAA
GAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATATCTGTGTTATCTGATGGGACGGTTGACAGTGGTCAGGGA
TCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATATGGTTCCCAACATGAACAGGCACATTCTACAGGCACAGTC
CCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTATATCCACCCTCAAGTGTGGTGAACAGCCCCCCCTCCCAG
CCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTGTCCACTCAACCCAGCTGCCCAGGACGGGGCAAGATGTCC
AAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCCTATGCCCACTTTGGGATCCACGAGGAAATGCTGAAGGAT
GAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTGTTCAAGGACAAAGTGGTACTGGATGTGGGGAGTGGTACT
GGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGGATCGAATGCTCCAGTATTTCTGACTACTCAGAGAAGATC
ATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTGGAAGAGGTGGAGCTGCCTGTGGAGAAGGTGGACATCATC
ATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACGGTGATCTTTGCCAGGGACAAGTGGCTGAAACCTGGAGGG
CTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGACAGTACAAGGACTTCAAAATCCACTGGTGGGAGAATGTC
TATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTAGTGGACATCGTGGATCCAAAGCAAGTGGTGACCAATGCC
TGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCGTTCACATCTGCATTCTGCCTGCAGATACAGCGCAACGAC
TACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCACAAGAAAATGGGGTTTTCCACAGCCCCTGATGCTCCCTAC
ACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGGAGGGGGGAGGAAATCTACGGGACCATATCCATGAAGCCA
AATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAGGGACAGCTGTGTGAAACATCTGTATCTAATGACTACAAA

>In-frame_WNK1_ENST00000530271_chr12_971436_+_PRMT8_ENST00000382622_chr12_3649772_+_4040nt
ATGTCTGGCGGCGCCGCAGAGAAGCAGAGCAGCACTCCCGGTTCCCTGTTCCTCTCGCCGCCGGCTCCTGCCCCCAAGAATGGCTCCAGC
TCCGATTCCTCCGTGGGGGAGAAACTGGGAGCCGCGGCCGCCGACGCTGTGACCGGCAGGACCGAGGAGTACAGGCGCCGCCGCCACACT
ATGGACAAGGACAGCCGTGGGGCGGCCGCGACCACTACCACCACTGAGCACCGCTTCTTCCGCCGGAGCGTCATCTGTGACTCCAATGCC
ACTGCACTGGAGCTTCCCGGCCTTCCTCTTTCCCTGCCCCAGCCCAGCATCCCCGCGGCTGTCCCGCAGAGTGCTCCACCGGAGCCCCAC
CGGGAAGAGACCGTGACCGCCACCGCCACTTCCCAGGTAGCCCAGCAGCCTCCAGCCGCTGCCGCCCCTGGGGAACAGGCCGTCGCGGGC
CCTGCCCCCTCGACTGTCCCCAGCAGTACCAGCAAAGACCGCCCAGTGTCCCAGCCTAGCCTTGTGGGGAGCAAAGAGGAGCCGCCGCCG
GCGAGAAGTGGCAGCGGCGGCGGCAGCGCCAAGGAGCCACAGGAGGAACGGAGCCAGCAGCAGGATGATATCGAAGAGCTGGAGACCAAG
GCCGTGGGAATGTCTAACGATGGCCGCTTTCTCAAGTTTGACATCGAAATCGGCAGAGGCTCCTTTAAGACGGTCTACAAAGGTCTGGAC
ACTGAAACCACCGTGGAAGTCGCCTGGTGTGAACTGCAGGATCGAAAATTAACAAAGTCTGAGAGGCAGAGATTTAAAGAAGAAGCTGAA
ATGTTAAAAGGTCTTCAGCATCCCAATATTGTTAGATTTTATGATTCCTGGGAATCCACAGTAAAAGGAAAGAAGTGCATTGTTTTGGTG
ACTGAACTTATGACGTCTGGAACACTTAAAACGTATCTGAAAAGGTTTAAAGTGATGAAGATCAAAGTTCTAAGAAGCTGGTGCCGTCAG
ATCCTTAAAGGTCTTCAGTTTCTTCATACTCGAACTCCACCTATCATTCACCGCGATCTTAAATGTGACAACATCTTTATCACCGGCCCT
ACTGGCTCAGTCAAGATTGGAGACCTCGGTCTGGCAACCCTGAAGCGGGCTTCTTTTGCCAAGAGTGTGATAGGTACCCCAGAGTTCATG
GCCCCTGAGATGTATGAGGAGAAATATGATGAATCCGTTGACGTTTATGCTTTTGGGATGTGCATGCTTGAGATGGCTACATCTGAATAT
CCTTACTCGGAGTGCCAAAATGCTGCACAGATCTACCGTCGCGTGACCAGTGGGGTGAAGCCAGCCAGTTTTGACAAAGTAGCAATTCCT
GAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGATATTCCATCAAAGACCTTTTGAACCATGCCTTCTTCCAA
GAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAAATAGCCATAAAATTATGGCTACGTATTGAAGATATTAAG
AAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGATTTAGAGAGAGATGTCCCAGAAGATGTTGCACAAGAAATG
GTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCTATCAAAGACAGAGTATCATTAATTAAGAGGAAACGAGAG
CAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGCAGTCTCAAACAGCAGGTAGAACAATCCAGTGCTTCCCAG
ACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCTACCACTTCAGCTTCAGTTTCTACACAAGTAGAACCTGAA
GAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATATCTGTGTTATCTGATGGGACGGTTGACAGTGGTCAGGGA
TCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATATGGTTCCCAACATGAACAGGCACATTCTACAGGCACAGTC
CCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTATATCCACCCTCAAGTGTGGTGAACAGCCCCCCCTCCCAG
CCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTGTCCACTCAACCCAGCTGCCCAGGACGGGGCAAGATGTCC
AAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCCTATGCCCACTTTGGGATCCACGAGGAAATGCTGAAGGAT
GAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTGTTCAAGGACAAAGTGGTACTGGATGTGGGGAGTGGTACT
GGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGGATCGAATGCTCCAGTATTTCTGACTACTCAGAGAAGATC
ATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTGGAAGAGGTGGAGCTGCCTGTGGAGAAGGTGGACATCATC
ATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACGGTGATCTTTGCCAGGGACAAGTGGCTGAAACCTGGAGGG
CTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGACAGTACAAGGACTTCAAAATCCACTGGTGGGAGAATGTC
TATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTAGTGGACATCGTGGATCCAAAGCAAGTGGTGACCAATGCC
TGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCGTTCACATCTGCATTCTGCCTGCAGATACAGCGCAACGAC
TACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCACAAGAAAATGGGGTTTTCCACAGCCCCTGATGCTCCCTAC
ACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGGAGGGGGGAGGAAATCTACGGGACCATATCCATGAAGCCA
AATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAGGGACAGCTGTGTGAAACATCTGTATCTAATGACTACAAA
ATGCGTTAGCACACGTGGGAAGCTGCAGAGAGCAACGAGAAAAGGAACTCTCACCTCGATCTGCCGTGCCGTCCCAAAGAATACCGTTTG
CAGGACTACACACTTGAAAACCAGAGTTTTCAACTCTGCCTTGAAGATTGGTGAACTCCCCAGGGCTCCCGTGGGCTCTGCCACTGGACA
GAAGGCCTCCAGCTCCTCCGCTCTGCCCTGGTAGCCCTTCACGAAGGCTTTGTGTTGCCAACAAAGAGCGACCTGGCGTGCTGTGGCTGG
GCCCCGAGGGTGGAAACGTATTCGCGTCTCCCCGTCTCCTCCTTAACTGTGACTCTCCGGGTCTTCTGAGTTTTGCATGCTGCGGGTGTC
TAGGACAGATTGCTTCCACTAGAACCTGGAGACATAGCATCTTTGATAGCATAAGCCAGATTATCTGTGTGTGCGGTGGTGTGCGTGTGC
GTGCATGTGTGAATGTGAGCAGCATAGTTGATATTTACCCACAAACACCTGTATATGCGTGCATATACAACCAAGTGGGTAGACCTAGGT
GTTCTCTCAGAGGGGTGTGTGTGTGTGTGCGTGCGCGTGTGCCTAGAATATATATTACTCTCAGAGGAGATTCTGTTGCTTTTGAATAGG
AATTTGTTTTGTGATTAGTTCGCCCCTTCCCCACCCCTTACCAGATGTTAAGCAGCTATGAAACATTCTCTGTACTAGTTCTGGTCTCCT

>In-frame_WNK1_ENST00000340908_chr12_971436_+_PRMT8_ENST00000452611_chr12_3649772_+_2028nt
ATGGATATTAAAAAGAAAGATTTTTGCTCAGTATTTGTCATCATAAATTCTCATTGCTGCTGCTGCCCTCAAAAGGATTGTATAAATGAG
GGGGTGAAGCCAGCCAGTTTTGACAAAGTAGCAATTCCTGAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGA
TATTCCATCAAAGACCTTTTGAACCATGCCTTCTTCCAAGAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAA
ATAGCCATAAAATTATGGCTACGTATTGAAGATATTAAGAAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGAT
TTAGAGAGAGATGTCCCAGAAGATGTTGCACAAGAAATGGTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCT
ATCAAAGACAGAGTATCATTAATTAAGAGGAAACGAGAGCAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGC
AGTCTCAAACAGCAGGTAGAACAATCCAGTGCTTCCCAGACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCT
ACCACTTCAGCTTCAGTTTCTACACAAGTAGAACCTGAAGAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATA
TCTGTGTTATCTGATGGGACGGTTGACAGTGGTCAGGGATCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATAT
GGTTCCCAACATGAACAGGCACATTCTACAGGCACAGTCCCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTA
TATCCACCCTCAAGTGTGGTGAACAGCCCCCCCTCCCAGCCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTG
TCCACTCAACCCAGCTGCCCAGGACGGGGCAAGATGTCCAAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCC
TATGCCCACTTTGGGATCCACGAGGAAATGCTGAAGGATGAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTG
TTCAAGGACAAAGTGGTACTGGATGTGGGGAGTGGTACTGGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGG
ATCGAATGCTCCAGTATTTCTGACTACTCAGAGAAGATCATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTG
GAAGAGGTGGAGCTGCCTGTGGAGAAGGTGGACATCATCATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACG
GTGATCTTTGCCAGGGACAAGTGGCTGAAACCTGGAGGGCTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGA
CAGTACAAGGACTTCAAAATCCACTGGTGGGAGAATGTCTATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTA
GTGGACATCGTGGATCCAAAGCAAGTGGTGACCAATGCCTGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCG
TTCACATCTGCATTCTGCCTGCAGATACAGCGCAACGACTACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCAC
AAGAAAATGGGGTTTTCCACAGCCCCTGATGCTCCCTACACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGG
AGGGGGGAGGAAATCTACGGGACCATATCCATGAAGCCAAATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAG

>In-frame_WNK1_ENST00000340908_chr12_971436_+_PRMT8_ENST00000382622_chr12_3649772_+_2819nt
ATGGATATTAAAAAGAAAGATTTTTGCTCAGTATTTGTCATCATAAATTCTCATTGCTGCTGCTGCCCTCAAAAGGATTGTATAAATGAG
GGGGTGAAGCCAGCCAGTTTTGACAAAGTAGCAATTCCTGAAGTGAAGGAAATTATTGAAGGATGCATACGACAAAACAAAGATGAAAGA
TATTCCATCAAAGACCTTTTGAACCATGCCTTCTTCCAAGAGGAAACAGGAGTACGGGTAGAATTAGCAGAAGAAGATGATGGAGAAAAA
ATAGCCATAAAATTATGGCTACGTATTGAAGATATTAAGAAATTAAAGGGAAAATACAAAGATAATGAAGCTATTGAGTTTTCTTTTGAT
TTAGAGAGAGATGTCCCAGAAGATGTTGCACAAGAAATGGTAGAGTCTGGGTATGTCTGTGAAGGTGATCACAAGACCATGGCTAAAGCT
ATCAAAGACAGAGTATCATTAATTAAGAGGAAACGAGAGCAGCGGCAGTTGGTACGGGAGGAGCAAGAAAAAAAAAAGCAGGAAGAGAGC
AGTCTCAAACAGCAGGTAGAACAATCCAGTGCTTCCCAGACAGGAATCAAGCAGCTCCCTTCTGCTAGCACCGGCATACCTACTGCTTCT
ACCACTTCAGCTTCAGTTTCTACACAAGTAGAACCTGAAGAACCTGAGGCAGATCAACATCAACAACTACAGTACCAGCAACCCAGTATA
TCTGTGTTATCTGATGGGACGGTTGACAGTGGTCAGGGATCCTCTGTCTTCACAGAATCTCGAGTGAGCAGCCAACAGACAGTTTCATAT
GGTTCCCAACATGAACAGGCACATTCTACAGGCACAGTCCCAGGGCATATACCTTCTACTGTCCAAGCACAGTCTCAGCCCCATGGGGTA
TATCCACCCTCAAGTGTGGTGAACAGCCCCCCCTCCCAGCCCCCCCAGCCCGTCGTCCCTGCTAAGCCCGTGCAATGCGTCCATCATGTG
TCCACTCAACCCAGCTGCCCAGGACGGGGCAAGATGTCCAAGCTGCTGAACCCAGAGGAGATGACCTCGAGAGATTATTACTTCGACTCC
TATGCCCACTTTGGGATCCACGAGGAAATGCTGAAGGATGAGGTGCGGACTCTCACTTACCGGAACTCCATGTACCACAACAAGCACGTG
TTCAAGGACAAAGTGGTACTGGATGTGGGGAGTGGTACTGGGATCCTTTCCATGTTCGCTGCCAAGGCAGGGGCCAAGAAGGTGTTTGGG
ATCGAATGCTCCAGTATTTCTGACTACTCAGAGAAGATCATTAAGGCCAACCACTTGGACAACATCATCACCATATTTAAGGGTAAAGTG
GAAGAGGTGGAGCTGCCTGTGGAGAAGGTGGACATCATCATCAGCGAGTGGATGGGCTACTGTCTGTTCTATGAGTCCATGCTCAACACG
GTGATCTTTGCCAGGGACAAGTGGCTGAAACCTGGAGGGCTTATGTTTCCAGACCGGGCAGCTTTGTACGTGGTAGCGATTGAAGACAGA
CAGTACAAGGACTTCAAAATCCACTGGTGGGAGAATGTCTATGGCTTTGACATGACCTGCATCCGGGACGTGGCCATGAAGGAGCCTCTA
GTGGACATCGTGGATCCAAAGCAAGTGGTGACCAATGCCTGTTTGATAAAGGAGGTGGACATTTACACAGTGAAGACGGAAGAGCTATCG
TTCACATCTGCATTCTGCCTGCAGATACAGCGCAACGACTACGTCCACGCCCTGGTCACCTATTTTAATATTGAATTTACCAAGTGCCAC
AAGAAAATGGGGTTTTCCACAGCCCCTGATGCTCCCTACACCCACTGGAAGCAGACCGTCTTCTACTTGGAAGATTACCTCACTGTCCGG
AGGGGGGAGGAAATCTACGGGACCATATCCATGAAGCCAAATGCCAAAAATGTGCGAGACCTCGATTTCACAGTAGACTTGGATTTTAAG
GGACAGCTGTGTGAAACATCTGTATCTAATGACTACAAAATGCGTTAGCACACGTGGGAAGCTGCAGAGAGCAACGAGAAAAGGAACTCT
CACCTCGATCTGCCGTGCCGTCCCAAAGAATACCGTTTGCAGGACTACACACTTGAAAACCAGAGTTTTCAACTCTGCCTTGAAGATTGG
TGAACTCCCCAGGGCTCCCGTGGGCTCTGCCACTGGACAGAAGGCCTCCAGCTCCTCCGCTCTGCCCTGGTAGCCCTTCACGAAGGCTTT
GTGTTGCCAACAAAGAGCGACCTGGCGTGCTGTGGCTGGGCCCCGAGGGTGGAAACGTATTCGCGTCTCCCCGTCTCCTCCTTAACTGTG
ACTCTCCGGGTCTTCTGAGTTTTGCATGCTGCGGGTGTCTAGGACAGATTGCTTCCACTAGAACCTGGAGACATAGCATCTTTGATAGCA
TAAGCCAGATTATCTGTGTGTGCGGTGGTGTGCGTGTGCGTGCATGTGTGAATGTGAGCAGCATAGTTGATATTTACCCACAAACACCTG
TATATGCGTGCATATACAACCAAGTGGGTAGACCTAGGTGTTCTCTCAGAGGGGTGTGTGTGTGTGTGCGTGCGCGTGTGCCTAGAATAT
ATATTACTCTCAGAGGAGATTCTGTTGCTTTTGAATAGGAATTTGTTTTGTGATTAGTTCGCCCCTTCCCCACCCCTTACCAGATGTTAA
GCAGCTATGAAACATTCTCTGTACTAGTTCTGGTCTCCTTTTGACTGGACTGTGGCTCTGAACCTTGAGCATAGTACCACGGACTCCGTG


Top

FusionGenePPI for WNK1_PRMT8


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
WNK1E2F3, CLTC, FLNC, ATP8, PRKAR1A, PRKAR1B, SLC9A1, ZYX, CSDE1, TSC22D1, BAG3, RANBP9, COPS5, TNRC6A, ZNF106, YWHAE, YWHAZ, MAP2K1, YWHAG, WNK1, WNK2, GLIS2, MYC, SGK1, NEDD4L, ATXN1, KLHL3, VCP, YWHAQ, MMS19, KLHL2, PFKP, ARAF, PVR, UPF2, YWHAB, EIF2B2, EIF3K, HNRNPD, ADRB2, FAM96B, FHL3, UBE2I, METTL6, TSC22D4, AAMP, MED4, XPO1, CDC42, CLTB, GAK, PICALM, GTSE1, SPATA1, AARSD1, HAO2, HSPA8, BAG4, SERPINB13, RAPGEF5, STAMBPL1, MLF1, PLEC, AAK1, TRIM25PRMT8PRMT8, HNRNPA1, COIL, SYNCRIP, TAF15, PRMT1, HIST1H4A, GPATCH2L, CEP162, OFCC1, PPARA, SERBP1, VHL, DCAF8, ZNF451, EWSR1, NEFM, VIM, INA, HNRNPU, FAM120A, DHX9, HNRNPR, BCLAF1, THRAP3, LSM14A, PRRC2C, HNRNPUL2, CHTOP, FBXW11, SCAF11, ALYREF, ANGEL2, HNRNPK, GIMAP2, SPDEF, TIGD7, ZSCAN1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for WNK1_PRMT8


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for WNK1_PRMT8


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneWNK1C0020538Hypertensive disease1CTD_human
HgeneWNK1C0022658Kidney Diseases1CTD_human
HgeneWNK1C0033805Pseudohypoaldosteronism1CTD_human