FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 42031

FusionGeneSummary for WLS_TBX3

check button Fusion gene summary
Fusion gene informationFusion gene name: WLS_TBX3
Fusion gene ID: 42031
HgeneTgene
Gene symbol

WLS

TBX3

Gene ID

79971

6926

Gene namewntless Wnt ligand secretion mediatorT-box 3
SynonymsC1orf139|EVI|GPR177|MRP|mig-14TBX3-ISO|UMS|XHL
Cytomap

1p31.3

12q24.21

Type of geneprotein-codingprotein-coding
Descriptionprotein wntless homologG protein-coupled receptor 177integral membrane protein GPR177protein evenness interrupted homologputative NF-kappa-B-activating protein 373putative NFkB activating protein 373T-box transcription factor TBX3T-box protein 3bladder cancer related protein XHL
Modification date2018052720180519
UniProtAcc

Q5T9L3

O15119

Ensembl transtripts involved in fusion geneENST00000540432, ENST00000354777, 
ENST00000262348, ENST00000370976, 
ENST00000370971, ENST00000491811, 
ENST00000349155, ENST00000257566, 
Fusion gene scores* DoF score1 X 1 X 1=11 X 1 X 1=1
# samples 11
** MAII scorelog2(1/1*10)=3.32192809488736log2(1/1*10)=3.32192809488736
Context

PubMed: WLS [Title/Abstract] AND TBX3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneTBX3

GO:0000122

negative regulation of transcription by RNA polymerase II

11689487

TgeneTBX3

GO:0007569

cell aging

11689487|11748239

TgeneTBX3

GO:0008284

positive regulation of cell proliferation

11689487|11748239|12032820

TgeneTBX3

GO:0009887

animal organ morphogenesis

9207801

TgeneTBX3

GO:0035136

forelimb morphogenesis

9207801

TgeneTBX3

GO:0043066

negative regulation of apoptotic process

12032820

TgeneTBX3

GO:0045662

negative regulation of myoblast differentiation

12032820

TgeneTBX3

GO:0045787

positive regulation of cell cycle

12032820

TgeneTBX3

GO:0045892

negative regulation of transcription, DNA-templated

10468588|11689487

TgeneTBX3

GO:0090398

cellular senescence

22002537


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-EJ-5525-01AWLSchr1

68603463

-TBX3chr12

115110107

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000540432ENST00000349155WLSchr1

68603463

-TBX3chr12

115110107

-
In-frameENST00000540432ENST00000257566WLSchr1

68603463

-TBX3chr12

115110107

-
Frame-shitENST00000354777ENST00000349155WLSchr1

68603463

-TBX3chr12

115110107

-
In-frameENST00000354777ENST00000257566WLSchr1

68603463

-TBX3chr12

115110107

-
Frame-shitENST00000262348ENST00000349155WLSchr1

68603463

-TBX3chr12

115110107

-
In-frameENST00000262348ENST00000257566WLSchr1

68603463

-TBX3chr12

115110107

-
Frame-shitENST00000370976ENST00000349155WLSchr1

68603463

-TBX3chr12

115110107

-
In-frameENST00000370976ENST00000257566WLSchr1

68603463

-TBX3chr12

115110107

-
intron-3CDSENST00000370971ENST00000349155WLSchr1

68603463

-TBX3chr12

115110107

-
intron-3CDSENST00000370971ENST00000257566WLSchr1

68603463

-TBX3chr12

115110107

-
intron-3CDSENST00000491811ENST00000349155WLSchr1

68603463

-TBX3chr12

115110107

-
intron-3CDSENST00000491811ENST00000257566WLSchr1

68603463

-TBX3chr12

115110107

-

Top

FusionProtFeatures for WLS_TBX3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
WLS

Q5T9L3

TBX3

O15119

Regulates Wnt proteins sorting and secretion in afeedback regulatory mechanism. This reciprocal interaction plays akey role in the regulation of expression, subcellular location,binding and organelle-specific association of Wnt proteins. Playsalso an important role in establishment of the anterior-posteriorbody axis formation during development (By similarity).{ECO:0000250, ECO:0000269|PubMed:16678095,ECO:0000269|PubMed:16678096}. Transcriptional repressor involved in developmentalprocesses. Probably plays a role in limb pattern formation. Actsas a negative regulator of PML function in cellular senescence.{ECO:0000269|PubMed:10468588, ECO:0000269|PubMed:22002537}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for WLS_TBX3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_WLS_ENST00000540432_chr1_68603463_-_TBX3_ENST00000257566_chr12_115110107_-_659aa
MAGAIIENMSTKKLCIVGGILLVFQIIAFLVGGLIAPGPTTAVSYMSVKCVDARKNHHKTKWFVPWGPNHCDKIRDIEEAIPREIEANDI
VFSVHIPLPHMEMSPWFQFMLFILQLDIAFKLNNQIRENAEVSMDVSLAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECD
VLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLEKVI
FALGISMTFINIPVEWFSIGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQHERNHIAGYWKQVGPIAVGSFCLFIFDMCERGVQ
LTNPFYSIWTTDIGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKVRRLHYEGLIFRFKFLMLITLACAAMTVIFF
IVSQVTEGHWKWGGVTVQVNSAFFTGIYGMWNLYVFALMFLYAPSHKNYGEDQSNGPGHVPFRKPVPLPLHVHGRSGGRLLCGSLQLGAP
PPLPQSEHHAPAAALQPLLHPGAGPGRQQSAHHRPALHGGGRGAPGRQSRRPGRQPGLGGSGLGLXTQQPLLHALLQLHVLVAQTLRGER

>In-frame_WLS_ENST00000354777_chr1_68603463_-_TBX3_ENST00000257566_chr12_115110107_-_657aa
MAGAIIENMSTKKLCIVGGILLVFQIIAFLVGGLIGPTTAVSYMSVKCVDARKNHHKTKWFVPWGPNHCDKIRDIEEAIPREIEANDIVF
SVHIPLPHMEMSPWFQFMLFILQLDIAFKLNNQIRENAEVSMDVSLAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVL
PFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLEKVIFA
LGISMTFINIPVEWFSIGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQHERNHIAGYWKQVGPIAVGSFCLFIFDMCERGVQLT
NPFYSIWTTDIGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKVRRLHYEGLIFRFKFLMLITLACAAMTVIFFIV
SQVTEGHWKWGGVTVQVNSAFFTGIYGMWNLYVFALMFLYAPSHKNYGEDQSNGPGHVPFRKPVPLPLHVHGRSGGRLLCGSLQLGAPPP
LPQSEHHAPAAALQPLLHPGAGPGRQQSAHHRPALHGGGRGAPGRQSRRPGRQPGLGGSGLGLXTQQPLLHALLQLHVLVAQTLRGERGG

>In-frame_WLS_ENST00000262348_chr1_68603463_-_TBX3_ENST00000257566_chr12_115110107_-_659aa
MAGAIIENMSTKKLCIVGGILLVFQIIAFLVGGLIAPGPTTAVSYMSVKCVDARKNHHKTKWFVPWGPNHCDKIRDIEEAIPREIEANDI
VFSVHIPLPHMEMSPWFQFMLFILQLDIAFKLNNQIRENAEVSMDVSLAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECD
VLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLEKVI
FALGISMTFINIPVEWFSIGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQHERNHIAGYWKQVGPIAVGSFCLFIFDMCERGVQ
LTNPFYSIWTTDIGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKVRRLHYEGLIFRFKFLMLITLACAAMTVIFF
IVSQVTEGHWKWGGVTVQVNSAFFTGIYGMWNLYVFALMFLYAPSHKNYGEDQSNGPGHVPFRKPVPLPLHVHGRSGGRLLCGSLQLGAP
PPLPQSEHHAPAAALQPLLHPGAGPGRQQSAHHRPALHGGGRGAPGRQSRRPGRQPGLGGSGLGLXTQQPLLHALLQLHVLVAQTLRGER

>In-frame_WLS_ENST00000370976_chr1_68603463_-_TBX3_ENST00000257566_chr12_115110107_-_568aa
MAGAIIENMSTKKLCIVGGILLVFQIIAFLVGGLIGENAEVSMDVSLAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDV
LPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLEKVIF
ALGISMTFINIPVEWFSIGFDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQHERNHIAGYWKQVGPIAVGSFCLFIFDMCERGVQL
TNPFYSIWTTDIGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKVRRLHYEGLIFRFKFLMLITLACAAMTVIFFI
VSQVTEGHWKWGGVTVQVNSAFFTGIYGMWNLYVFALMFLYAPSHKNYGEDQSNGPGHVPFRKPVPLPLHVHGRSGGRLLCGSLQLGAPP
PLPQSEHHAPAAALQPLLHPGAGPGRQQSAHHRPALHGGGRGAPGRQSRRPGRQPGLGGSGLGLXTQQPLLHALLQLHVLVAQTLRGERG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_WLS_ENST00000540432_chr1_68603463_-_TBX3_ENST00000257566_chr12_115110107_-_1978nt
ATGGCTGGGGCAATTATAGAAAACATGAGCACCAAGAAGCTGTGCATTGTTGGTGGGATTCTGCTCGTGTTCCAAATCATCGCCTTTCTG
GTGGGAGGCTTGATTGCTCCAGGGCCCACAACGGCAGTGTCCTACATGTCGGTGAAATGTGTGGATGCCCGTAAGAACCATCACAAGACA
AAATGGTTCGTGCCTTGGGGACCCAATCATTGTGACAAGATCCGAGACATTGAAGAGGCAATTCCAAGGGAAATTGAAGCCAATGACATC
GTGTTTTCTGTTCACATTCCCCTCCCCCACATGGAGATGAGTCCTTGGTTCCAATTCATGCTGTTTATCCTGCAGCTGGACATTGCCTTC
AAGCTAAACAACCAAATCAGAGAAAATGCAGAAGTCTCCATGGACGTTTCCCTGGCTTACCGTGATGACGCGTTTGCTGAGTGGACTGAA
ATGGCCCATGAAAGAGTACCACGGAAACTCAAATGCACCTTCACATCTCCCAAGACTCCAGAGCATGAGGGCCGTTACTATGAATGTGAT
GTCCTTCCTTTCATGGAAATTGGGTCTGTGGCCCATAAGTTTTACCTTTTAAACATCCGGCTGCCTGTGAATGAGAAGAAGAAAATCAAT
GTGGGAATTGGGGAGATAAAGGATATCCGGTTGGTGGGGATCCACCAAAATGGAGGCTTCACCAAGGTGTGGTTTGCCATGAAGACCTTC
CTTACGCCCAGCATCTTCATCATTATGGTGTGGTATTGGAGGAGGATCACCATGATGTCCCGACCCCCAGTGCTTCTGGAAAAAGTCATC
TTTGCCCTTGGGATTTCCATGACCTTTATCAATATCCCAGTGGAATGGTTTTCCATCGGGTTTGACTGGACCTGGATGCTGCTGTTTGGT
GACATCCGACAGGGCATCTTCTATGCGATGCTTCTGTCCTTCTGGATCATCTTCTGTGGCGAGCACATGATGGATCAGCACGAGCGGAAC
CACATCGCAGGGTATTGGAAGCAAGTCGGACCCATTGCCGTTGGCTCCTTCTGCCTCTTCATATTTGACATGTGTGAGAGAGGGGTACAA
CTCACGAATCCCTTCTACAGTATCTGGACTACAGACATTGGAACAGAGCTGGCCATGGCCTTCATCATCGTGGCTGGAATCTGCCTCTGC
CTCTACTTCCTGTTTCTATGCTTCATGGTATTTCAGGTGTTTCGGAACATCAGTGGGAAGCAGTCCAGCCTGCCAGCTATGAGCAAAGTC
CGGCGGCTACACTATGAGGGGCTAATTTTTAGGTTCAAGTTCCTCATGCTTATCACCTTGGCCTGCGCTGCCATGACTGTCATCTTCTTC
ATCGTTAGTCAGGTAACGGAAGGCCATTGGAAATGGGGCGGCGTCACAGTCCAAGTGAACAGTGCCTTTTTCACAGGCATCTATGGGATG
TGGAATCTGTATGTCTTTGCTCTGATGTTCTTGTATGCACCATCCCATAAAAACTATGGAGAAGACCAGTCCAATGGGCCTGGCCATGTC
CCCTTTCGGAAGCCTGTTCCCTTACCCCTACACGTACATGGCCGCAGCGGCGGCCGCCTCCTCTGCGGCAGCCTCCAGCTCGGTGCACCG
CCACCCCTTCCTCAATCTGAACACCATGCGCCCGCGGCTGCGCTACAGCCCCTACTCCATCCCGGTGCCGGTCCCGGACGGCAGCAGTCT
GCTCACCACCGCCCTGCCCTCCATGGCGGCGGCCGCGGGGCCCCTGGACGGCAAAGTCGCCGCCCTGGCCGCCAGCCCGGCCTCGGTGGC
AGTGGACTCGGGCTCTGAACTCAACAGCCGCTCCTCCACGCTCTCCTCCAGCTCCATGTCCTTGTCGCCCAAACTCTGCGCGGAGAAAGA

>In-frame_WLS_ENST00000354777_chr1_68603463_-_TBX3_ENST00000257566_chr12_115110107_-_1972nt
ATGGCTGGGGCAATTATAGAAAACATGAGCACCAAGAAGCTGTGCATTGTTGGTGGGATTCTGCTCGTGTTCCAAATCATCGCCTTTCTG
GTGGGAGGCTTGATTGGGCCCACAACGGCAGTGTCCTACATGTCGGTGAAATGTGTGGATGCCCGTAAGAACCATCACAAGACAAAATGG
TTCGTGCCTTGGGGACCCAATCATTGTGACAAGATCCGAGACATTGAAGAGGCAATTCCAAGGGAAATTGAAGCCAATGACATCGTGTTT
TCTGTTCACATTCCCCTCCCCCACATGGAGATGAGTCCTTGGTTCCAATTCATGCTGTTTATCCTGCAGCTGGACATTGCCTTCAAGCTA
AACAACCAAATCAGAGAAAATGCAGAAGTCTCCATGGACGTTTCCCTGGCTTACCGTGATGACGCGTTTGCTGAGTGGACTGAAATGGCC
CATGAAAGAGTACCACGGAAACTCAAATGCACCTTCACATCTCCCAAGACTCCAGAGCATGAGGGCCGTTACTATGAATGTGATGTCCTT
CCTTTCATGGAAATTGGGTCTGTGGCCCATAAGTTTTACCTTTTAAACATCCGGCTGCCTGTGAATGAGAAGAAGAAAATCAATGTGGGA
ATTGGGGAGATAAAGGATATCCGGTTGGTGGGGATCCACCAAAATGGAGGCTTCACCAAGGTGTGGTTTGCCATGAAGACCTTCCTTACG
CCCAGCATCTTCATCATTATGGTGTGGTATTGGAGGAGGATCACCATGATGTCCCGACCCCCAGTGCTTCTGGAAAAAGTCATCTTTGCC
CTTGGGATTTCCATGACCTTTATCAATATCCCAGTGGAATGGTTTTCCATCGGGTTTGACTGGACCTGGATGCTGCTGTTTGGTGACATC
CGACAGGGCATCTTCTATGCGATGCTTCTGTCCTTCTGGATCATCTTCTGTGGCGAGCACATGATGGATCAGCACGAGCGGAACCACATC
GCAGGGTATTGGAAGCAAGTCGGACCCATTGCCGTTGGCTCCTTCTGCCTCTTCATATTTGACATGTGTGAGAGAGGGGTACAACTCACG
AATCCCTTCTACAGTATCTGGACTACAGACATTGGAACAGAGCTGGCCATGGCCTTCATCATCGTGGCTGGAATCTGCCTCTGCCTCTAC
TTCCTGTTTCTATGCTTCATGGTATTTCAGGTGTTTCGGAACATCAGTGGGAAGCAGTCCAGCCTGCCAGCTATGAGCAAAGTCCGGCGG
CTACACTATGAGGGGCTAATTTTTAGGTTCAAGTTCCTCATGCTTATCACCTTGGCCTGCGCTGCCATGACTGTCATCTTCTTCATCGTT
AGTCAGGTAACGGAAGGCCATTGGAAATGGGGCGGCGTCACAGTCCAAGTGAACAGTGCCTTTTTCACAGGCATCTATGGGATGTGGAAT
CTGTATGTCTTTGCTCTGATGTTCTTGTATGCACCATCCCATAAAAACTATGGAGAAGACCAGTCCAATGGGCCTGGCCATGTCCCCTTT
CGGAAGCCTGTTCCCTTACCCCTACACGTACATGGCCGCAGCGGCGGCCGCCTCCTCTGCGGCAGCCTCCAGCTCGGTGCACCGCCACCC
CTTCCTCAATCTGAACACCATGCGCCCGCGGCTGCGCTACAGCCCCTACTCCATCCCGGTGCCGGTCCCGGACGGCAGCAGTCTGCTCAC
CACCGCCCTGCCCTCCATGGCGGCGGCCGCGGGGCCCCTGGACGGCAAAGTCGCCGCCCTGGCCGCCAGCCCGGCCTCGGTGGCAGTGGA
CTCGGGCTCTGAACTCAACAGCCGCTCCTCCACGCTCTCCTCCAGCTCCATGTCCTTGTCGCCCAAACTCTGCGCGGAGAAAGAGGCGGC

>In-frame_WLS_ENST00000262348_chr1_68603463_-_TBX3_ENST00000257566_chr12_115110107_-_1978nt
ATGGCTGGGGCAATTATAGAAAACATGAGCACCAAGAAGCTGTGCATTGTTGGTGGGATTCTGCTCGTGTTCCAAATCATCGCCTTTCTG
GTGGGAGGCTTGATTGCTCCAGGGCCCACAACGGCAGTGTCCTACATGTCGGTGAAATGTGTGGATGCCCGTAAGAACCATCACAAGACA
AAATGGTTCGTGCCTTGGGGACCCAATCATTGTGACAAGATCCGAGACATTGAAGAGGCAATTCCAAGGGAAATTGAAGCCAATGACATC
GTGTTTTCTGTTCACATTCCCCTCCCCCACATGGAGATGAGTCCTTGGTTCCAATTCATGCTGTTTATCCTGCAGCTGGACATTGCCTTC
AAGCTAAACAACCAAATCAGAGAAAATGCAGAAGTCTCCATGGACGTTTCCCTGGCTTACCGTGATGACGCGTTTGCTGAGTGGACTGAA
ATGGCCCATGAAAGAGTACCACGGAAACTCAAATGCACCTTCACATCTCCCAAGACTCCAGAGCATGAGGGCCGTTACTATGAATGTGAT
GTCCTTCCTTTCATGGAAATTGGGTCTGTGGCCCATAAGTTTTACCTTTTAAACATCCGGCTGCCTGTGAATGAGAAGAAGAAAATCAAT
GTGGGAATTGGGGAGATAAAGGATATCCGGTTGGTGGGGATCCACCAAAATGGAGGCTTCACCAAGGTGTGGTTTGCCATGAAGACCTTC
CTTACGCCCAGCATCTTCATCATTATGGTGTGGTATTGGAGGAGGATCACCATGATGTCCCGACCCCCAGTGCTTCTGGAAAAAGTCATC
TTTGCCCTTGGGATTTCCATGACCTTTATCAATATCCCAGTGGAATGGTTTTCCATCGGGTTTGACTGGACCTGGATGCTGCTGTTTGGT
GACATCCGACAGGGCATCTTCTATGCGATGCTTCTGTCCTTCTGGATCATCTTCTGTGGCGAGCACATGATGGATCAGCACGAGCGGAAC
CACATCGCAGGGTATTGGAAGCAAGTCGGACCCATTGCCGTTGGCTCCTTCTGCCTCTTCATATTTGACATGTGTGAGAGAGGGGTACAA
CTCACGAATCCCTTCTACAGTATCTGGACTACAGACATTGGAACAGAGCTGGCCATGGCCTTCATCATCGTGGCTGGAATCTGCCTCTGC
CTCTACTTCCTGTTTCTATGCTTCATGGTATTTCAGGTGTTTCGGAACATCAGTGGGAAGCAGTCCAGCCTGCCAGCTATGAGCAAAGTC
CGGCGGCTACACTATGAGGGGCTAATTTTTAGGTTCAAGTTCCTCATGCTTATCACCTTGGCCTGCGCTGCCATGACTGTCATCTTCTTC
ATCGTTAGTCAGGTAACGGAAGGCCATTGGAAATGGGGCGGCGTCACAGTCCAAGTGAACAGTGCCTTTTTCACAGGCATCTATGGGATG
TGGAATCTGTATGTCTTTGCTCTGATGTTCTTGTATGCACCATCCCATAAAAACTATGGAGAAGACCAGTCCAATGGGCCTGGCCATGTC
CCCTTTCGGAAGCCTGTTCCCTTACCCCTACACGTACATGGCCGCAGCGGCGGCCGCCTCCTCTGCGGCAGCCTCCAGCTCGGTGCACCG
CCACCCCTTCCTCAATCTGAACACCATGCGCCCGCGGCTGCGCTACAGCCCCTACTCCATCCCGGTGCCGGTCCCGGACGGCAGCAGTCT
GCTCACCACCGCCCTGCCCTCCATGGCGGCGGCCGCGGGGCCCCTGGACGGCAAAGTCGCCGCCCTGGCCGCCAGCCCGGCCTCGGTGGC
AGTGGACTCGGGCTCTGAACTCAACAGCCGCTCCTCCACGCTCTCCTCCAGCTCCATGTCCTTGTCGCCCAAACTCTGCGCGGAGAAAGA

>In-frame_WLS_ENST00000370976_chr1_68603463_-_TBX3_ENST00000257566_chr12_115110107_-_1705nt
ATGGCTGGGGCAATTATAGAAAACATGAGCACCAAGAAGCTGTGCATTGTTGGTGGGATTCTGCTCGTGTTCCAAATCATCGCCTTTCTG
GTGGGAGGCTTGATTGGAGAAAATGCAGAAGTCTCCATGGACGTTTCCCTGGCTTACCGTGATGACGCGTTTGCTGAGTGGACTGAAATG
GCCCATGAAAGAGTACCACGGAAACTCAAATGCACCTTCACATCTCCCAAGACTCCAGAGCATGAGGGCCGTTACTATGAATGTGATGTC
CTTCCTTTCATGGAAATTGGGTCTGTGGCCCATAAGTTTTACCTTTTAAACATCCGGCTGCCTGTGAATGAGAAGAAGAAAATCAATGTG
GGAATTGGGGAGATAAAGGATATCCGGTTGGTGGGGATCCACCAAAATGGAGGCTTCACCAAGGTGTGGTTTGCCATGAAGACCTTCCTT
ACGCCCAGCATCTTCATCATTATGGTGTGGTATTGGAGGAGGATCACCATGATGTCCCGACCCCCAGTGCTTCTGGAAAAAGTCATCTTT
GCCCTTGGGATTTCCATGACCTTTATCAATATCCCAGTGGAATGGTTTTCCATCGGGTTTGACTGGACCTGGATGCTGCTGTTTGGTGAC
ATCCGACAGGGCATCTTCTATGCGATGCTTCTGTCCTTCTGGATCATCTTCTGTGGCGAGCACATGATGGATCAGCACGAGCGGAACCAC
ATCGCAGGGTATTGGAAGCAAGTCGGACCCATTGCCGTTGGCTCCTTCTGCCTCTTCATATTTGACATGTGTGAGAGAGGGGTACAACTC
ACGAATCCCTTCTACAGTATCTGGACTACAGACATTGGAACAGAGCTGGCCATGGCCTTCATCATCGTGGCTGGAATCTGCCTCTGCCTC
TACTTCCTGTTTCTATGCTTCATGGTATTTCAGGTGTTTCGGAACATCAGTGGGAAGCAGTCCAGCCTGCCAGCTATGAGCAAAGTCCGG
CGGCTACACTATGAGGGGCTAATTTTTAGGTTCAAGTTCCTCATGCTTATCACCTTGGCCTGCGCTGCCATGACTGTCATCTTCTTCATC
GTTAGTCAGGTAACGGAAGGCCATTGGAAATGGGGCGGCGTCACAGTCCAAGTGAACAGTGCCTTTTTCACAGGCATCTATGGGATGTGG
AATCTGTATGTCTTTGCTCTGATGTTCTTGTATGCACCATCCCATAAAAACTATGGAGAAGACCAGTCCAATGGGCCTGGCCATGTCCCC
TTTCGGAAGCCTGTTCCCTTACCCCTACACGTACATGGCCGCAGCGGCGGCCGCCTCCTCTGCGGCAGCCTCCAGCTCGGTGCACCGCCA
CCCCTTCCTCAATCTGAACACCATGCGCCCGCGGCTGCGCTACAGCCCCTACTCCATCCCGGTGCCGGTCCCGGACGGCAGCAGTCTGCT
CACCACCGCCCTGCCCTCCATGGCGGCGGCCGCGGGGCCCCTGGACGGCAAAGTCGCCGCCCTGGCCGCCAGCCCGGCCTCGGTGGCAGT
GGACTCGGGCTCTGAACTCAACAGCCGCTCCTCCACGCTCTCCTCCAGCTCCATGTCCTTGTCGCCCAAACTCTGCGCGGAGAAAGAGGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_WLS_ENST00000540432_chr1_68603463_-_TBX3_ENST00000257566_chr12_115110107_-_3848nt
GGCGGCGTCATGTGATCCGCTTCCCTGCTCCTTTAAGCGTCCACAGGCGGCGGAGCGGCCACAATCACAGCTCCGGGCATTGGGGGAACC
CGAGCCGGCTGCGCCGGGGGAATCCGTGCGGGCGCCTTCCGTCCCGGTCCCATCCTCGCCGCGCTCCAGCACCTCTGAAGTTTTGCAGCG
CCCAGAAAGGAGGCGAGGAAGGAGGGAGTGTGTGAGAGGAGGGAGCAAAAAGCTCACCCTAAAACATTTATTTCAAGGAGAAAAGAAAAA
GGGGGGGCGCAAAAATGGCTGGGGCAATTATAGAAAACATGAGCACCAAGAAGCTGTGCATTGTTGGTGGGATTCTGCTCGTGTTCCAAA
TCATCGCCTTTCTGGTGGGAGGCTTGATTGCTCCAGGGCCCACAACGGCAGTGTCCTACATGTCGGTGAAATGTGTGGATGCCCGTAAGA
ACCATCACAAGACAAAATGGTTCGTGCCTTGGGGACCCAATCATTGTGACAAGATCCGAGACATTGAAGAGGCAATTCCAAGGGAAATTG
AAGCCAATGACATCGTGTTTTCTGTTCACATTCCCCTCCCCCACATGGAGATGAGTCCTTGGTTCCAATTCATGCTGTTTATCCTGCAGC
TGGACATTGCCTTCAAGCTAAACAACCAAATCAGAGAAAATGCAGAAGTCTCCATGGACGTTTCCCTGGCTTACCGTGATGACGCGTTTG
CTGAGTGGACTGAAATGGCCCATGAAAGAGTACCACGGAAACTCAAATGCACCTTCACATCTCCCAAGACTCCAGAGCATGAGGGCCGTT
ACTATGAATGTGATGTCCTTCCTTTCATGGAAATTGGGTCTGTGGCCCATAAGTTTTACCTTTTAAACATCCGGCTGCCTGTGAATGAGA
AGAAGAAAATCAATGTGGGAATTGGGGAGATAAAGGATATCCGGTTGGTGGGGATCCACCAAAATGGAGGCTTCACCAAGGTGTGGTTTG
CCATGAAGACCTTCCTTACGCCCAGCATCTTCATCATTATGGTGTGGTATTGGAGGAGGATCACCATGATGTCCCGACCCCCAGTGCTTC
TGGAAAAAGTCATCTTTGCCCTTGGGATTTCCATGACCTTTATCAATATCCCAGTGGAATGGTTTTCCATCGGGTTTGACTGGACCTGGA
TGCTGCTGTTTGGTGACATCCGACAGGGCATCTTCTATGCGATGCTTCTGTCCTTCTGGATCATCTTCTGTGGCGAGCACATGATGGATC
AGCACGAGCGGAACCACATCGCAGGGTATTGGAAGCAAGTCGGACCCATTGCCGTTGGCTCCTTCTGCCTCTTCATATTTGACATGTGTG
AGAGAGGGGTACAACTCACGAATCCCTTCTACAGTATCTGGACTACAGACATTGGAACAGAGCTGGCCATGGCCTTCATCATCGTGGCTG
GAATCTGCCTCTGCCTCTACTTCCTGTTTCTATGCTTCATGGTATTTCAGGTGTTTCGGAACATCAGTGGGAAGCAGTCCAGCCTGCCAG
CTATGAGCAAAGTCCGGCGGCTACACTATGAGGGGCTAATTTTTAGGTTCAAGTTCCTCATGCTTATCACCTTGGCCTGCGCTGCCATGA
CTGTCATCTTCTTCATCGTTAGTCAGGTAACGGAAGGCCATTGGAAATGGGGCGGCGTCACAGTCCAAGTGAACAGTGCCTTTTTCACAG
GCATCTATGGGATGTGGAATCTGTATGTCTTTGCTCTGATGTTCTTGTATGCACCATCCCATAAAAACTATGGAGAAGACCAGTCCAATG
GGCCTGGCCATGTCCCCTTTCGGAAGCCTGTTCCCTTACCCCTACACGTACATGGCCGCAGCGGCGGCCGCCTCCTCTGCGGCAGCCTCC
AGCTCGGTGCACCGCCACCCCTTCCTCAATCTGAACACCATGCGCCCGCGGCTGCGCTACAGCCCCTACTCCATCCCGGTGCCGGTCCCG
GACGGCAGCAGTCTGCTCACCACCGCCCTGCCCTCCATGGCGGCGGCCGCGGGGCCCCTGGACGGCAAAGTCGCCGCCCTGGCCGCCAGC
CCGGCCTCGGTGGCAGTGGACTCGGGCTCTGAACTCAACAGCCGCTCCTCCACGCTCTCCTCCAGCTCCATGTCCTTGTCGCCCAAACTC
TGCGCGGAGAAAGAGGCGGCCACCAGCGAACTGCAGAGCATCCAGCGGTTGGTTAGCGGCTTGGAAGCCAAGCCGGACAGGTCCCGCAGC
GCGTCCCCGTAGACCCGTCCCAGACACGTCTTTTCATTCCAGTCCAGTTCAGGCTGCCGTGCACTTTGTCGGATATAAAATAAACCACGG
GCCCGCCATGGCGTTAGCCCTTCCTTTTGCAGTTGCGTCTGGGAAGGGGCCCCGGACTCCCTCGAGAGAATGTGCTAGAGACAGCCCCTG
TCTTCTTGGCGTGGTTTATATGTCCGGGATCTGGATCAGATTCTGGGGGCTCAGAAACGTCGGTTGCATTGAGCTACTGGGGGTAGGAGT
TCCAACATTTATGTCCAGAGCAACTTCCAGCAAGGCTGGTCTGGGTCTCTGCCCACCAGGCGGGGAGGTGTTCAAAGACATCTCCCTCAG
TGCGGATTTATATATATATTTTTCCTTCACTGTGTCAAGTGGAAACAAAAACAAAATCTTTCAAAAAAAAAATCGGGACAAGTGAACACA
TTAACATGATTCTGTTTGTGCAGATTAAAAACTTTATAGGGACTTGCATTATCGGTTCTCAATAAATTACTGAGCAGCTTTGTTTGGGGA
GGGAAGTCCCTACCATCCTTGTTTAGTCTATATTAAGAAAATCTGTGTCTTTTTAATATTCTTGTGATGTTTTCAGAGCCGCTGTAGGTC
TCTTCTTGCATGTCCACAGTAATGTATTTGTGGTTTTTATTTTGAACGCTTGCTTTTAGAGAGAAAACAATATAGCCCCCTACCCTTTTC
CCAATCCTTTGCCCTCAAATCAGTGACCCAAGGGAGGGGGGGATTTAAAGGGAAGGAGTGGGCAAAACACATAAAATGAATTTATTATAT
CTAAGCTCTGTAGCAGGATTCATGTCGTTCTTTGACAGTTCTTTCTCTTTCCTGTATATGCAATAACAAGGTTTTAAAAAAATAATAAAG
AAGTGAGACTATTAGACAAAGTATTTATGTAATTATTTGATAACTCTTGTAAATAGGTGGAATATGAATGCTTGGAAAATTAAACTTTAA
TTTATTGACATTGTACATAGCTCTGTGTAAATAGAATTGCAACTGTCAGGTTTTGTGTTCTTGTTTTCCTTTAGTTGGGTTTATTTCCAG
GTCACAGAATTGCTGTTAACACTAGAAAACACACTTCCTGCACCAACACCAATACCCTTTCAAAAGAGTTGTCTGCAACATTTTTGTTTT
CTTTTTTAATGTCCAAAAGTGGGGGAAAGTGCTATTTCCTATTTTCACCAAAATTGGGGAAGGAGTGCCACTTTCCAGCTCCACTTCAAA
TTCCTTAAAATATAACTGAGATTGCTGTGGGGAGGGAGGAGGGCAGAGGCTGCGGTTTGACTTTTTAATTTTTCTTTTGTTATTTGTATT
TGCTAGTCTCTGATTTCCTCAAAACGAAGTGGAATTTACTACTGTTGTCAGTATCGGTGTTTTGAATTGGTGCCTGCCTATAGAGATATA
TTCACAGTTCAAAAGTCAGGTGCTGAGAGATGGTTTAAAGACAAATTCATGAAGGTATATTTTGTGTTATAGTTGTTGATGAGTTCTTTG

>In-frame_WLS_ENST00000354777_chr1_68603463_-_TBX3_ENST00000257566_chr12_115110107_-_3804nt
GTCCACAGGCGGCGGAGCGGCCACAATCACAGCTCCGGGCATTGGGGGAACCCGAGCCGGCTGCGCCGGGGGAATCCGTGCGGGCGCCTT
CCGTCCCGGTCCCATCCTCGCCGCGCTCCAGCACCTCTGAAGTTTTGCAGCGCCCAGAAAGGAGGCGAGGAAGGAGGGAGTGTGTGAGAG
GAGGGAGCAAAAAGCTCACCCTAAAACATTTATTTCAAGGAGAAAAGAAAAAGGGGGGGCGCAAAAATGGCTGGGGCAATTATAGAAAAC
ATGAGCACCAAGAAGCTGTGCATTGTTGGTGGGATTCTGCTCGTGTTCCAAATCATCGCCTTTCTGGTGGGAGGCTTGATTGGGCCCACA
ACGGCAGTGTCCTACATGTCGGTGAAATGTGTGGATGCCCGTAAGAACCATCACAAGACAAAATGGTTCGTGCCTTGGGGACCCAATCAT
TGTGACAAGATCCGAGACATTGAAGAGGCAATTCCAAGGGAAATTGAAGCCAATGACATCGTGTTTTCTGTTCACATTCCCCTCCCCCAC
ATGGAGATGAGTCCTTGGTTCCAATTCATGCTGTTTATCCTGCAGCTGGACATTGCCTTCAAGCTAAACAACCAAATCAGAGAAAATGCA
GAAGTCTCCATGGACGTTTCCCTGGCTTACCGTGATGACGCGTTTGCTGAGTGGACTGAAATGGCCCATGAAAGAGTACCACGGAAACTC
AAATGCACCTTCACATCTCCCAAGACTCCAGAGCATGAGGGCCGTTACTATGAATGTGATGTCCTTCCTTTCATGGAAATTGGGTCTGTG
GCCCATAAGTTTTACCTTTTAAACATCCGGCTGCCTGTGAATGAGAAGAAGAAAATCAATGTGGGAATTGGGGAGATAAAGGATATCCGG
TTGGTGGGGATCCACCAAAATGGAGGCTTCACCAAGGTGTGGTTTGCCATGAAGACCTTCCTTACGCCCAGCATCTTCATCATTATGGTG
TGGTATTGGAGGAGGATCACCATGATGTCCCGACCCCCAGTGCTTCTGGAAAAAGTCATCTTTGCCCTTGGGATTTCCATGACCTTTATC
AATATCCCAGTGGAATGGTTTTCCATCGGGTTTGACTGGACCTGGATGCTGCTGTTTGGTGACATCCGACAGGGCATCTTCTATGCGATG
CTTCTGTCCTTCTGGATCATCTTCTGTGGCGAGCACATGATGGATCAGCACGAGCGGAACCACATCGCAGGGTATTGGAAGCAAGTCGGA
CCCATTGCCGTTGGCTCCTTCTGCCTCTTCATATTTGACATGTGTGAGAGAGGGGTACAACTCACGAATCCCTTCTACAGTATCTGGACT
ACAGACATTGGAACAGAGCTGGCCATGGCCTTCATCATCGTGGCTGGAATCTGCCTCTGCCTCTACTTCCTGTTTCTATGCTTCATGGTA
TTTCAGGTGTTTCGGAACATCAGTGGGAAGCAGTCCAGCCTGCCAGCTATGAGCAAAGTCCGGCGGCTACACTATGAGGGGCTAATTTTT
AGGTTCAAGTTCCTCATGCTTATCACCTTGGCCTGCGCTGCCATGACTGTCATCTTCTTCATCGTTAGTCAGGTAACGGAAGGCCATTGG
AAATGGGGCGGCGTCACAGTCCAAGTGAACAGTGCCTTTTTCACAGGCATCTATGGGATGTGGAATCTGTATGTCTTTGCTCTGATGTTC
TTGTATGCACCATCCCATAAAAACTATGGAGAAGACCAGTCCAATGGGCCTGGCCATGTCCCCTTTCGGAAGCCTGTTCCCTTACCCCTA
CACGTACATGGCCGCAGCGGCGGCCGCCTCCTCTGCGGCAGCCTCCAGCTCGGTGCACCGCCACCCCTTCCTCAATCTGAACACCATGCG
CCCGCGGCTGCGCTACAGCCCCTACTCCATCCCGGTGCCGGTCCCGGACGGCAGCAGTCTGCTCACCACCGCCCTGCCCTCCATGGCGGC
GGCCGCGGGGCCCCTGGACGGCAAAGTCGCCGCCCTGGCCGCCAGCCCGGCCTCGGTGGCAGTGGACTCGGGCTCTGAACTCAACAGCCG
CTCCTCCACGCTCTCCTCCAGCTCCATGTCCTTGTCGCCCAAACTCTGCGCGGAGAAAGAGGCGGCCACCAGCGAACTGCAGAGCATCCA
GCGGTTGGTTAGCGGCTTGGAAGCCAAGCCGGACAGGTCCCGCAGCGCGTCCCCGTAGACCCGTCCCAGACACGTCTTTTCATTCCAGTC
CAGTTCAGGCTGCCGTGCACTTTGTCGGATATAAAATAAACCACGGGCCCGCCATGGCGTTAGCCCTTCCTTTTGCAGTTGCGTCTGGGA
AGGGGCCCCGGACTCCCTCGAGAGAATGTGCTAGAGACAGCCCCTGTCTTCTTGGCGTGGTTTATATGTCCGGGATCTGGATCAGATTCT
GGGGGCTCAGAAACGTCGGTTGCATTGAGCTACTGGGGGTAGGAGTTCCAACATTTATGTCCAGAGCAACTTCCAGCAAGGCTGGTCTGG
GTCTCTGCCCACCAGGCGGGGAGGTGTTCAAAGACATCTCCCTCAGTGCGGATTTATATATATATTTTTCCTTCACTGTGTCAAGTGGAA
ACAAAAACAAAATCTTTCAAAAAAAAAATCGGGACAAGTGAACACATTAACATGATTCTGTTTGTGCAGATTAAAAACTTTATAGGGACT
TGCATTATCGGTTCTCAATAAATTACTGAGCAGCTTTGTTTGGGGAGGGAAGTCCCTACCATCCTTGTTTAGTCTATATTAAGAAAATCT
GTGTCTTTTTAATATTCTTGTGATGTTTTCAGAGCCGCTGTAGGTCTCTTCTTGCATGTCCACAGTAATGTATTTGTGGTTTTTATTTTG
AACGCTTGCTTTTAGAGAGAAAACAATATAGCCCCCTACCCTTTTCCCAATCCTTTGCCCTCAAATCAGTGACCCAAGGGAGGGGGGGAT
TTAAAGGGAAGGAGTGGGCAAAACACATAAAATGAATTTATTATATCTAAGCTCTGTAGCAGGATTCATGTCGTTCTTTGACAGTTCTTT
CTCTTTCCTGTATATGCAATAACAAGGTTTTAAAAAAATAATAAAGAAGTGAGACTATTAGACAAAGTATTTATGTAATTATTTGATAAC
TCTTGTAAATAGGTGGAATATGAATGCTTGGAAAATTAAACTTTAATTTATTGACATTGTACATAGCTCTGTGTAAATAGAATTGCAACT
GTCAGGTTTTGTGTTCTTGTTTTCCTTTAGTTGGGTTTATTTCCAGGTCACAGAATTGCTGTTAACACTAGAAAACACACTTCCTGCACC
AACACCAATACCCTTTCAAAAGAGTTGTCTGCAACATTTTTGTTTTCTTTTTTAATGTCCAAAAGTGGGGGAAAGTGCTATTTCCTATTT
TCACCAAAATTGGGGAAGGAGTGCCACTTTCCAGCTCCACTTCAAATTCCTTAAAATATAACTGAGATTGCTGTGGGGAGGGAGGAGGGC
AGAGGCTGCGGTTTGACTTTTTAATTTTTCTTTTGTTATTTGTATTTGCTAGTCTCTGATTTCCTCAAAACGAAGTGGAATTTACTACTG
TTGTCAGTATCGGTGTTTTGAATTGGTGCCTGCCTATAGAGATATATTCACAGTTCAAAAGTCAGGTGCTGAGAGATGGTTTAAAGACAA
ATTCATGAAGGTATATTTTGTGTTATAGTTGTTGATGAGTTCTTTGGTTTTCTGTATTTTTCCCCCTCTCTTTAAAACATCACTGAAATT

>In-frame_WLS_ENST00000262348_chr1_68603463_-_TBX3_ENST00000257566_chr12_115110107_-_3818nt
CTTTAAGCGTCCACAGGCGGCGGAGCGGCCACAATCACAGCTCCGGGCATTGGGGGAACCCGAGCCGGCTGCGCCGGGGGAATCCGTGCG
GGCGCCTTCCGTCCCGGTCCCATCCTCGCCGCGCTCCAGCACCTCTGAAGTTTTGCAGCGCCCAGAAAGGAGGCGAGGAAGGAGGGAGTG
TGTGAGAGGAGGGAGCAAAAAGCTCACCCTAAAACATTTATTTCAAGGAGAAAAGAAAAAGGGGGGGCGCAAAAATGGCTGGGGCAATTA
TAGAAAACATGAGCACCAAGAAGCTGTGCATTGTTGGTGGGATTCTGCTCGTGTTCCAAATCATCGCCTTTCTGGTGGGAGGCTTGATTG
CTCCAGGGCCCACAACGGCAGTGTCCTACATGTCGGTGAAATGTGTGGATGCCCGTAAGAACCATCACAAGACAAAATGGTTCGTGCCTT
GGGGACCCAATCATTGTGACAAGATCCGAGACATTGAAGAGGCAATTCCAAGGGAAATTGAAGCCAATGACATCGTGTTTTCTGTTCACA
TTCCCCTCCCCCACATGGAGATGAGTCCTTGGTTCCAATTCATGCTGTTTATCCTGCAGCTGGACATTGCCTTCAAGCTAAACAACCAAA
TCAGAGAAAATGCAGAAGTCTCCATGGACGTTTCCCTGGCTTACCGTGATGACGCGTTTGCTGAGTGGACTGAAATGGCCCATGAAAGAG
TACCACGGAAACTCAAATGCACCTTCACATCTCCCAAGACTCCAGAGCATGAGGGCCGTTACTATGAATGTGATGTCCTTCCTTTCATGG
AAATTGGGTCTGTGGCCCATAAGTTTTACCTTTTAAACATCCGGCTGCCTGTGAATGAGAAGAAGAAAATCAATGTGGGAATTGGGGAGA
TAAAGGATATCCGGTTGGTGGGGATCCACCAAAATGGAGGCTTCACCAAGGTGTGGTTTGCCATGAAGACCTTCCTTACGCCCAGCATCT
TCATCATTATGGTGTGGTATTGGAGGAGGATCACCATGATGTCCCGACCCCCAGTGCTTCTGGAAAAAGTCATCTTTGCCCTTGGGATTT
CCATGACCTTTATCAATATCCCAGTGGAATGGTTTTCCATCGGGTTTGACTGGACCTGGATGCTGCTGTTTGGTGACATCCGACAGGGCA
TCTTCTATGCGATGCTTCTGTCCTTCTGGATCATCTTCTGTGGCGAGCACATGATGGATCAGCACGAGCGGAACCACATCGCAGGGTATT
GGAAGCAAGTCGGACCCATTGCCGTTGGCTCCTTCTGCCTCTTCATATTTGACATGTGTGAGAGAGGGGTACAACTCACGAATCCCTTCT
ACAGTATCTGGACTACAGACATTGGAACAGAGCTGGCCATGGCCTTCATCATCGTGGCTGGAATCTGCCTCTGCCTCTACTTCCTGTTTC
TATGCTTCATGGTATTTCAGGTGTTTCGGAACATCAGTGGGAAGCAGTCCAGCCTGCCAGCTATGAGCAAAGTCCGGCGGCTACACTATG
AGGGGCTAATTTTTAGGTTCAAGTTCCTCATGCTTATCACCTTGGCCTGCGCTGCCATGACTGTCATCTTCTTCATCGTTAGTCAGGTAA
CGGAAGGCCATTGGAAATGGGGCGGCGTCACAGTCCAAGTGAACAGTGCCTTTTTCACAGGCATCTATGGGATGTGGAATCTGTATGTCT
TTGCTCTGATGTTCTTGTATGCACCATCCCATAAAAACTATGGAGAAGACCAGTCCAATGGGCCTGGCCATGTCCCCTTTCGGAAGCCTG
TTCCCTTACCCCTACACGTACATGGCCGCAGCGGCGGCCGCCTCCTCTGCGGCAGCCTCCAGCTCGGTGCACCGCCACCCCTTCCTCAAT
CTGAACACCATGCGCCCGCGGCTGCGCTACAGCCCCTACTCCATCCCGGTGCCGGTCCCGGACGGCAGCAGTCTGCTCACCACCGCCCTG
CCCTCCATGGCGGCGGCCGCGGGGCCCCTGGACGGCAAAGTCGCCGCCCTGGCCGCCAGCCCGGCCTCGGTGGCAGTGGACTCGGGCTCT
GAACTCAACAGCCGCTCCTCCACGCTCTCCTCCAGCTCCATGTCCTTGTCGCCCAAACTCTGCGCGGAGAAAGAGGCGGCCACCAGCGAA
CTGCAGAGCATCCAGCGGTTGGTTAGCGGCTTGGAAGCCAAGCCGGACAGGTCCCGCAGCGCGTCCCCGTAGACCCGTCCCAGACACGTC
TTTTCATTCCAGTCCAGTTCAGGCTGCCGTGCACTTTGTCGGATATAAAATAAACCACGGGCCCGCCATGGCGTTAGCCCTTCCTTTTGC
AGTTGCGTCTGGGAAGGGGCCCCGGACTCCCTCGAGAGAATGTGCTAGAGACAGCCCCTGTCTTCTTGGCGTGGTTTATATGTCCGGGAT
CTGGATCAGATTCTGGGGGCTCAGAAACGTCGGTTGCATTGAGCTACTGGGGGTAGGAGTTCCAACATTTATGTCCAGAGCAACTTCCAG
CAAGGCTGGTCTGGGTCTCTGCCCACCAGGCGGGGAGGTGTTCAAAGACATCTCCCTCAGTGCGGATTTATATATATATTTTTCCTTCAC
TGTGTCAAGTGGAAACAAAAACAAAATCTTTCAAAAAAAAAATCGGGACAAGTGAACACATTAACATGATTCTGTTTGTGCAGATTAAAA
ACTTTATAGGGACTTGCATTATCGGTTCTCAATAAATTACTGAGCAGCTTTGTTTGGGGAGGGAAGTCCCTACCATCCTTGTTTAGTCTA
TATTAAGAAAATCTGTGTCTTTTTAATATTCTTGTGATGTTTTCAGAGCCGCTGTAGGTCTCTTCTTGCATGTCCACAGTAATGTATTTG
TGGTTTTTATTTTGAACGCTTGCTTTTAGAGAGAAAACAATATAGCCCCCTACCCTTTTCCCAATCCTTTGCCCTCAAATCAGTGACCCA
AGGGAGGGGGGGATTTAAAGGGAAGGAGTGGGCAAAACACATAAAATGAATTTATTATATCTAAGCTCTGTAGCAGGATTCATGTCGTTC
TTTGACAGTTCTTTCTCTTTCCTGTATATGCAATAACAAGGTTTTAAAAAAATAATAAAGAAGTGAGACTATTAGACAAAGTATTTATGT
AATTATTTGATAACTCTTGTAAATAGGTGGAATATGAATGCTTGGAAAATTAAACTTTAATTTATTGACATTGTACATAGCTCTGTGTAA
ATAGAATTGCAACTGTCAGGTTTTGTGTTCTTGTTTTCCTTTAGTTGGGTTTATTTCCAGGTCACAGAATTGCTGTTAACACTAGAAAAC
ACACTTCCTGCACCAACACCAATACCCTTTCAAAAGAGTTGTCTGCAACATTTTTGTTTTCTTTTTTAATGTCCAAAAGTGGGGGAAAGT
GCTATTTCCTATTTTCACCAAAATTGGGGAAGGAGTGCCACTTTCCAGCTCCACTTCAAATTCCTTAAAATATAACTGAGATTGCTGTGG
GGAGGGAGGAGGGCAGAGGCTGCGGTTTGACTTTTTAATTTTTCTTTTGTTATTTGTATTTGCTAGTCTCTGATTTCCTCAAAACGAAGT
GGAATTTACTACTGTTGTCAGTATCGGTGTTTTGAATTGGTGCCTGCCTATAGAGATATATTCACAGTTCAAAAGTCAGGTGCTGAGAGA
TGGTTTAAAGACAAATTCATGAAGGTATATTTTGTGTTATAGTTGTTGATGAGTTCTTTGGTTTTCTGTATTTTTCCCCCTCTCTTTAAA

>In-frame_WLS_ENST00000370976_chr1_68603463_-_TBX3_ENST00000257566_chr12_115110107_-_3536nt
TCCACAGGCGGCGGAGCGGCCACAATCACAGCTCCGGGCATTGGGGGAACCCGAGCCGGCTGCGCCGGGGGAATCCGTGCGGGCGCCTTC
CGTCCCGGTCCCATCCTCGCCGCGCTCCAGCACCTCTGAAGTTTTGCAGCGCCCAGAAAGGAGGCGAGGAAGGAGGGAGTGTGTGAGAGG
AGGGAGCAAAAAGCTCACCCTAAAACATTTATTTCAAGGAGAAAAGAAAAAGGGGGGGCGCAAAAATGGCTGGGGCAATTATAGAAAACA
TGAGCACCAAGAAGCTGTGCATTGTTGGTGGGATTCTGCTCGTGTTCCAAATCATCGCCTTTCTGGTGGGAGGCTTGATTGGAGAAAATG
CAGAAGTCTCCATGGACGTTTCCCTGGCTTACCGTGATGACGCGTTTGCTGAGTGGACTGAAATGGCCCATGAAAGAGTACCACGGAAAC
TCAAATGCACCTTCACATCTCCCAAGACTCCAGAGCATGAGGGCCGTTACTATGAATGTGATGTCCTTCCTTTCATGGAAATTGGGTCTG
TGGCCCATAAGTTTTACCTTTTAAACATCCGGCTGCCTGTGAATGAGAAGAAGAAAATCAATGTGGGAATTGGGGAGATAAAGGATATCC
GGTTGGTGGGGATCCACCAAAATGGAGGCTTCACCAAGGTGTGGTTTGCCATGAAGACCTTCCTTACGCCCAGCATCTTCATCATTATGG
TGTGGTATTGGAGGAGGATCACCATGATGTCCCGACCCCCAGTGCTTCTGGAAAAAGTCATCTTTGCCCTTGGGATTTCCATGACCTTTA
TCAATATCCCAGTGGAATGGTTTTCCATCGGGTTTGACTGGACCTGGATGCTGCTGTTTGGTGACATCCGACAGGGCATCTTCTATGCGA
TGCTTCTGTCCTTCTGGATCATCTTCTGTGGCGAGCACATGATGGATCAGCACGAGCGGAACCACATCGCAGGGTATTGGAAGCAAGTCG
GACCCATTGCCGTTGGCTCCTTCTGCCTCTTCATATTTGACATGTGTGAGAGAGGGGTACAACTCACGAATCCCTTCTACAGTATCTGGA
CTACAGACATTGGAACAGAGCTGGCCATGGCCTTCATCATCGTGGCTGGAATCTGCCTCTGCCTCTACTTCCTGTTTCTATGCTTCATGG
TATTTCAGGTGTTTCGGAACATCAGTGGGAAGCAGTCCAGCCTGCCAGCTATGAGCAAAGTCCGGCGGCTACACTATGAGGGGCTAATTT
TTAGGTTCAAGTTCCTCATGCTTATCACCTTGGCCTGCGCTGCCATGACTGTCATCTTCTTCATCGTTAGTCAGGTAACGGAAGGCCATT
GGAAATGGGGCGGCGTCACAGTCCAAGTGAACAGTGCCTTTTTCACAGGCATCTATGGGATGTGGAATCTGTATGTCTTTGCTCTGATGT
TCTTGTATGCACCATCCCATAAAAACTATGGAGAAGACCAGTCCAATGGGCCTGGCCATGTCCCCTTTCGGAAGCCTGTTCCCTTACCCC
TACACGTACATGGCCGCAGCGGCGGCCGCCTCCTCTGCGGCAGCCTCCAGCTCGGTGCACCGCCACCCCTTCCTCAATCTGAACACCATG
CGCCCGCGGCTGCGCTACAGCCCCTACTCCATCCCGGTGCCGGTCCCGGACGGCAGCAGTCTGCTCACCACCGCCCTGCCCTCCATGGCG
GCGGCCGCGGGGCCCCTGGACGGCAAAGTCGCCGCCCTGGCCGCCAGCCCGGCCTCGGTGGCAGTGGACTCGGGCTCTGAACTCAACAGC
CGCTCCTCCACGCTCTCCTCCAGCTCCATGTCCTTGTCGCCCAAACTCTGCGCGGAGAAAGAGGCGGCCACCAGCGAACTGCAGAGCATC
CAGCGGTTGGTTAGCGGCTTGGAAGCCAAGCCGGACAGGTCCCGCAGCGCGTCCCCGTAGACCCGTCCCAGACACGTCTTTTCATTCCAG
TCCAGTTCAGGCTGCCGTGCACTTTGTCGGATATAAAATAAACCACGGGCCCGCCATGGCGTTAGCCCTTCCTTTTGCAGTTGCGTCTGG
GAAGGGGCCCCGGACTCCCTCGAGAGAATGTGCTAGAGACAGCCCCTGTCTTCTTGGCGTGGTTTATATGTCCGGGATCTGGATCAGATT
CTGGGGGCTCAGAAACGTCGGTTGCATTGAGCTACTGGGGGTAGGAGTTCCAACATTTATGTCCAGAGCAACTTCCAGCAAGGCTGGTCT
GGGTCTCTGCCCACCAGGCGGGGAGGTGTTCAAAGACATCTCCCTCAGTGCGGATTTATATATATATTTTTCCTTCACTGTGTCAAGTGG
AAACAAAAACAAAATCTTTCAAAAAAAAAATCGGGACAAGTGAACACATTAACATGATTCTGTTTGTGCAGATTAAAAACTTTATAGGGA
CTTGCATTATCGGTTCTCAATAAATTACTGAGCAGCTTTGTTTGGGGAGGGAAGTCCCTACCATCCTTGTTTAGTCTATATTAAGAAAAT
CTGTGTCTTTTTAATATTCTTGTGATGTTTTCAGAGCCGCTGTAGGTCTCTTCTTGCATGTCCACAGTAATGTATTTGTGGTTTTTATTT
TGAACGCTTGCTTTTAGAGAGAAAACAATATAGCCCCCTACCCTTTTCCCAATCCTTTGCCCTCAAATCAGTGACCCAAGGGAGGGGGGG
ATTTAAAGGGAAGGAGTGGGCAAAACACATAAAATGAATTTATTATATCTAAGCTCTGTAGCAGGATTCATGTCGTTCTTTGACAGTTCT
TTCTCTTTCCTGTATATGCAATAACAAGGTTTTAAAAAAATAATAAAGAAGTGAGACTATTAGACAAAGTATTTATGTAATTATTTGATA
ACTCTTGTAAATAGGTGGAATATGAATGCTTGGAAAATTAAACTTTAATTTATTGACATTGTACATAGCTCTGTGTAAATAGAATTGCAA
CTGTCAGGTTTTGTGTTCTTGTTTTCCTTTAGTTGGGTTTATTTCCAGGTCACAGAATTGCTGTTAACACTAGAAAACACACTTCCTGCA
CCAACACCAATACCCTTTCAAAAGAGTTGTCTGCAACATTTTTGTTTTCTTTTTTAATGTCCAAAAGTGGGGGAAAGTGCTATTTCCTAT
TTTCACCAAAATTGGGGAAGGAGTGCCACTTTCCAGCTCCACTTCAAATTCCTTAAAATATAACTGAGATTGCTGTGGGGAGGGAGGAGG
GCAGAGGCTGCGGTTTGACTTTTTAATTTTTCTTTTGTTATTTGTATTTGCTAGTCTCTGATTTCCTCAAAACGAAGTGGAATTTACTAC
TGTTGTCAGTATCGGTGTTTTGAATTGGTGCCTGCCTATAGAGATATATTCACAGTTCAAAAGTCAGGTGCTGAGAGATGGTTTAAAGAC
AAATTCATGAAGGTATATTTTGTGTTATAGTTGTTGATGAGTTCTTTGGTTTTCTGTATTTTTCCCCCTCTCTTTAAAACATCACTGAAA


Top

FusionGenePPI for WLS_TBX3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
WLSMOV10, NXF1, OPRM1, OPRD1, OPRK1, WNT4, HTR3C, TCTN2, TCTN3, NCSTN, WNT7A, CHRND, WNT5A, HTR3A, GABRA3, WNT16, TMED6, TRIM25TBX3TBX3, TOLLIP, HDAC1, HDAC2, HDAC3, HDAC5, ELAVL1, SOX2, AES, CA8, PML, PLEKHF2, CDK8, MAPK3, KIF21B, KIF21A, DNAJC11, DCP1A, CDCA5, HNRNPLL


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for WLS_TBX3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for WLS_TBX3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneWLSC0023893Liver Cirrhosis, Experimental1CTD_human
HgeneWLSC0858355addicted to cocaine1PSYGENET
TgeneTBX3C1866994Ulnar-mammary syndrome2CTD_human;ORPHANET;UNIPROT
TgeneTBX3C0038356Stomach Neoplasms1CTD_human
TgeneTBX3C0040128Thyroid Diseases1CTD_human
TgeneTBX3C0040427Tooth Abnormalities1CTD_human
TgeneTBX3C0206762Limb Deformities, Congenital1CTD_human
TgeneTBX3C1458155Mammary Neoplasms1CTD_human