FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41988

FusionGeneSummary for WHSC1_GSDMB

check button Fusion gene summary
Fusion gene informationFusion gene name: WHSC1_GSDMB
Fusion gene ID: 41988
HgeneTgene
Gene symbol

WHSC1

GSDMB

Gene ID

7468

55876

Gene namenuclear receptor binding SET domain protein 2gasdermin B
SynonymsKMT3F|KMT3G|MMSET|REIIBP|TRX5|WHS|WHSC1GSDML|PP4052|PRO2521
Cytomap

4p16.3

17q21.1

Type of geneprotein-codingprotein-coding
Descriptionhistone-lysine N-methyltransferase NSD2IL5 promoter REII region-binding proteinWolf-Hirschhorn syndrome candidate 1multiple myeloma SET domain containing protein type IIInuclear SET domain-containing protein 2probable histone-lysine N-methyltransferagasdermin-Bgasdermin-like protein
Modification date2018051920180523
UniProtAcc

Q8TAX9

Ensembl transtripts involved in fusion geneENST00000508803, ENST00000382892, 
ENST00000382891, ENST00000382895, 
ENST00000482415, ENST00000382888, 
ENST00000514045, ENST00000436793, 
ENST00000420906, ENST00000503128, 
ENST00000398261, 
ENST00000360317, 
ENST00000394175, ENST00000309481, 
ENST00000520542, ENST00000418519, 
ENST00000394179, 
Fusion gene scores* DoF score11 X 9 X 5=4957 X 5 X 6=210
# samples 118
** MAII scorelog2(11/495*10)=-2.16992500144231
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/210*10)=-1.39231742277876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: WHSC1 [Title/Abstract] AND GSDMB [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-38-4630-01AWHSC1chr4

1957915

+GSDMBchr17

38068750

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000508803ENST00000360317WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000508803ENST00000394175WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000508803ENST00000309481WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000508803ENST00000520542WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000508803ENST00000418519WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000508803ENST00000394179WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382892ENST00000360317WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382892ENST00000394175WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382892ENST00000309481WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382892ENST00000520542WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382892ENST00000418519WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382892ENST00000394179WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382891ENST00000360317WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382891ENST00000394175WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382891ENST00000309481WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382891ENST00000520542WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382891ENST00000418519WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382891ENST00000394179WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382895ENST00000360317WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382895ENST00000394175WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382895ENST00000309481WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382895ENST00000520542WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382895ENST00000418519WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382895ENST00000394179WHSC1chr4

1957915

+GSDMBchr17

38068750

-
3UTR-3CDSENST00000482415ENST00000360317WHSC1chr4

1957915

+GSDMBchr17

38068750

-
3UTR-3CDSENST00000482415ENST00000394175WHSC1chr4

1957915

+GSDMBchr17

38068750

-
3UTR-3CDSENST00000482415ENST00000309481WHSC1chr4

1957915

+GSDMBchr17

38068750

-
3UTR-3CDSENST00000482415ENST00000520542WHSC1chr4

1957915

+GSDMBchr17

38068750

-
3UTR-3CDSENST00000482415ENST00000418519WHSC1chr4

1957915

+GSDMBchr17

38068750

-
3UTR-3CDSENST00000482415ENST00000394179WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382888ENST00000360317WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382888ENST00000394175WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382888ENST00000309481WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382888ENST00000520542WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382888ENST00000418519WHSC1chr4

1957915

+GSDMBchr17

38068750

-
In-frameENST00000382888ENST00000394179WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000514045ENST00000360317WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000514045ENST00000394175WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000514045ENST00000309481WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000514045ENST00000520542WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000514045ENST00000418519WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000514045ENST00000394179WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000436793ENST00000360317WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000436793ENST00000394175WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000436793ENST00000309481WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000436793ENST00000520542WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000436793ENST00000418519WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000436793ENST00000394179WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000420906ENST00000360317WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000420906ENST00000394175WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000420906ENST00000309481WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000420906ENST00000520542WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000420906ENST00000418519WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000420906ENST00000394179WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000503128ENST00000360317WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000503128ENST00000394175WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000503128ENST00000309481WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000503128ENST00000520542WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000503128ENST00000418519WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000503128ENST00000394179WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000398261ENST00000360317WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000398261ENST00000394175WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000398261ENST00000309481WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000398261ENST00000520542WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000398261ENST00000418519WHSC1chr4

1957915

+GSDMBchr17

38068750

-
intron-3CDSENST00000398261ENST00000394179WHSC1chr4

1957915

+GSDMBchr17

38068750

-

Top

FusionProtFeatures for WHSC1_GSDMB


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
WHSC1

GSDMB

Q8TAX9

Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}. The N-terminal moiety promotes pyroptosis. May be actingby homooligomerizing within the membrane and forming pores(PubMed:27281216). The physiological relevance of this observationis unknown (Probable). {ECO:0000269|PubMed:27281216, ECO:0000305}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382891+1522453_5219601366DNA bindingHMG box
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382892+1623453_5219601366DNA bindingHMG box
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382895+1724453_5219601366DNA bindingHMG box
HgeneWHSC1chr4:1957915chr17:38068750ENST00000508803+1522453_5219601366DNA bindingHMG box
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382888+512222_286308714DomainPWWP 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382891+1522222_2869601366DomainPWWP 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382891+1522880_9429601366DomainPWWP 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382892+1623222_2869601366DomainPWWP 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382892+1623880_9429601366DomainPWWP 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382895+1724222_2869601366DomainPWWP 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382895+1724880_9429601366DomainPWWP 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000508803+1522222_2869601366DomainPWWP 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000508803+1522880_9429601366DomainPWWP 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382891+1522667_7139601366Zinc fingerPHD-type 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382891+1522714_7709601366Zinc fingerPHD-type 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382891+1522831_8759601366Zinc fingerPHD-type 3
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382892+1623667_7139601366Zinc fingerPHD-type 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382892+1623714_7709601366Zinc fingerPHD-type 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382892+1623831_8759601366Zinc fingerPHD-type 3
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382895+1724667_7139601366Zinc fingerPHD-type 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382895+1724714_7709601366Zinc fingerPHD-type 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382895+1724831_8759601366Zinc fingerPHD-type 3
HgeneWHSC1chr4:1957915chr17:38068750ENST00000508803+1522667_7139601366Zinc fingerPHD-type 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000508803+1522714_7709601366Zinc fingerPHD-type 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000508803+1522831_8759601366Zinc fingerPHD-type 3
TgeneGSDMBchr4:1957915chr17:38068750ENST00000309481-110243_27178404Coiled coilOntology_term=ECO:0000255
TgeneGSDMBchr4:1957915chr17:38068750ENST00000360317-010243_27178417Coiled coilOntology_term=ECO:0000255
TgeneGSDMBchr4:1957915chr17:38068750ENST00000394175-08243_27178395Coiled coilOntology_term=ECO:0000255
TgeneGSDMBchr4:1957915chr17:38068750ENST00000394179-110243_27178412Coiled coilOntology_term=ECO:0000255
TgeneGSDMBchr4:1957915chr17:38068750ENST00000418519-111243_27178417Coiled coilOntology_term=ECO:0000255
TgeneGSDMBchr4:1957915chr17:38068750ENST00000520542-110243_27178408Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382888+512453_521308714DNA bindingHMG box
HgeneWHSC1chr4:1957915chr17:38068750ENST00000398261+19453_521-10648DNA bindingHMG box
HgeneWHSC1chr4:1957915chr17:38068750ENST00000420906+111453_521-144630DNA bindingHMG box
HgeneWHSC1chr4:1957915chr17:38068750ENST00000436793+16453_521-165274DNA bindingHMG box
HgeneWHSC1chr4:1957915chr17:38068750ENST00000503128+110453_521-69648DNA bindingHMG box
HgeneWHSC1chr4:1957915chr17:38068750ENST00000514045+19453_521-37630DNA bindingHMG box
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382888+5121011_1061308714DomainAWS
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382888+5121063_1180308714DomainSET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382888+5121187_1203308714DomainPost-SET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382888+512880_942308714DomainPWWP 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382891+15221011_10619601366DomainAWS
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382891+15221063_11809601366DomainSET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382891+15221187_12039601366DomainPost-SET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382892+16231011_10619601366DomainAWS
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382892+16231063_11809601366DomainSET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382892+16231187_12039601366DomainPost-SET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382895+17241011_10619601366DomainAWS
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382895+17241063_11809601366DomainSET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382895+17241187_12039601366DomainPost-SET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000398261+191011_1061-10648DomainAWS
HgeneWHSC1chr4:1957915chr17:38068750ENST00000398261+191063_1180-10648DomainSET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000398261+191187_1203-10648DomainPost-SET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000398261+19222_286-10648DomainPWWP 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000398261+19880_942-10648DomainPWWP 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000420906+1111011_1061-144630DomainAWS
HgeneWHSC1chr4:1957915chr17:38068750ENST00000420906+1111063_1180-144630DomainSET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000420906+1111187_1203-144630DomainPost-SET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000420906+111222_286-144630DomainPWWP 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000420906+111880_942-144630DomainPWWP 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000436793+161011_1061-165274DomainAWS
HgeneWHSC1chr4:1957915chr17:38068750ENST00000436793+161063_1180-165274DomainSET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000436793+161187_1203-165274DomainPost-SET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000436793+16222_286-165274DomainPWWP 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000436793+16880_942-165274DomainPWWP 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000503128+1101011_1061-69648DomainAWS
HgeneWHSC1chr4:1957915chr17:38068750ENST00000503128+1101063_1180-69648DomainSET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000503128+1101187_1203-69648DomainPost-SET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000503128+110222_286-69648DomainPWWP 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000503128+110880_942-69648DomainPWWP 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000508803+15221011_10619601366DomainAWS
HgeneWHSC1chr4:1957915chr17:38068750ENST00000508803+15221063_11809601366DomainSET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000508803+15221187_12039601366DomainPost-SET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000514045+191011_1061-37630DomainAWS
HgeneWHSC1chr4:1957915chr17:38068750ENST00000514045+191063_1180-37630DomainSET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000514045+191187_1203-37630DomainPost-SET
HgeneWHSC1chr4:1957915chr17:38068750ENST00000514045+19222_286-37630DomainPWWP 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000514045+19880_942-37630DomainPWWP 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382888+5121239_1286308714Zinc fingerPHD-type 4%3B atypical
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382888+512667_713308714Zinc fingerPHD-type 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382888+512714_770308714Zinc fingerPHD-type 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382888+512831_875308714Zinc fingerPHD-type 3
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382891+15221239_12869601366Zinc fingerPHD-type 4%3B atypical
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382892+16231239_12869601366Zinc fingerPHD-type 4%3B atypical
HgeneWHSC1chr4:1957915chr17:38068750ENST00000382895+17241239_12869601366Zinc fingerPHD-type 4%3B atypical
HgeneWHSC1chr4:1957915chr17:38068750ENST00000398261+191239_1286-10648Zinc fingerPHD-type 4%3B atypical
HgeneWHSC1chr4:1957915chr17:38068750ENST00000398261+19667_713-10648Zinc fingerPHD-type 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000398261+19714_770-10648Zinc fingerPHD-type 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000398261+19831_875-10648Zinc fingerPHD-type 3
HgeneWHSC1chr4:1957915chr17:38068750ENST00000420906+1111239_1286-144630Zinc fingerPHD-type 4%3B atypical
HgeneWHSC1chr4:1957915chr17:38068750ENST00000420906+111667_713-144630Zinc fingerPHD-type 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000420906+111714_770-144630Zinc fingerPHD-type 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000420906+111831_875-144630Zinc fingerPHD-type 3
HgeneWHSC1chr4:1957915chr17:38068750ENST00000436793+161239_1286-165274Zinc fingerPHD-type 4%3B atypical
HgeneWHSC1chr4:1957915chr17:38068750ENST00000436793+16667_713-165274Zinc fingerPHD-type 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000436793+16714_770-165274Zinc fingerPHD-type 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000436793+16831_875-165274Zinc fingerPHD-type 3
HgeneWHSC1chr4:1957915chr17:38068750ENST00000503128+1101239_1286-69648Zinc fingerPHD-type 4%3B atypical
HgeneWHSC1chr4:1957915chr17:38068750ENST00000503128+110667_713-69648Zinc fingerPHD-type 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000503128+110714_770-69648Zinc fingerPHD-type 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000503128+110831_875-69648Zinc fingerPHD-type 3
HgeneWHSC1chr4:1957915chr17:38068750ENST00000508803+15221239_12869601366Zinc fingerPHD-type 4%3B atypical
HgeneWHSC1chr4:1957915chr17:38068750ENST00000514045+191239_1286-37630Zinc fingerPHD-type 4%3B atypical
HgeneWHSC1chr4:1957915chr17:38068750ENST00000514045+19667_713-37630Zinc fingerPHD-type 1
HgeneWHSC1chr4:1957915chr17:38068750ENST00000514045+19714_770-37630Zinc fingerPHD-type 2
HgeneWHSC1chr4:1957915chr17:38068750ENST00000514045+19831_875-37630Zinc fingerPHD-type 3
TgeneGSDMBchr4:1957915chr17:38068750ENST00000309481-1101_27578404RegionTriggers pyroptosis
TgeneGSDMBchr4:1957915chr17:38068750ENST00000360317-0101_27578417RegionTriggers pyroptosis
TgeneGSDMBchr4:1957915chr17:38068750ENST00000394175-081_27578395RegionTriggers pyroptosis
TgeneGSDMBchr4:1957915chr17:38068750ENST00000394179-1101_27578412RegionTriggers pyroptosis
TgeneGSDMBchr4:1957915chr17:38068750ENST00000418519-1111_27578417RegionTriggers pyroptosis
TgeneGSDMBchr4:1957915chr17:38068750ENST00000520542-1101_27578408RegionTriggers pyroptosis


Top

FusionGeneSequence for WHSC1_GSDMB


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000360317_chr17_38068750_-_1299aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEEKDGASSCLGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKED
IRQDLEQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDEL

>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000394175_chr17_38068750_-_1277aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMRKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGELHMED
PDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDYDPEARILCALYVV

>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000309481_chr17_38068750_-_1286aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMKKDGASSCLGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVL
ISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDYDPEA

>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000520542_chr17_38068750_-_1290aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRV
SEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDY

>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000418519_chr17_38068750_-_1299aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEEKDGASSCLGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKED
IRQDLEQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDEL

>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000394179_chr17_38068750_-_1294aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMSAGLDIHFRGKTKSFPEGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDL
EQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPP

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000360317_chr17_38068750_-_1299aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEEKDGASSCLGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKED
IRQDLEQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDEL

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000394175_chr17_38068750_-_1277aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMRKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGELHMED
PDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDYDPEARILCALYVV

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000309481_chr17_38068750_-_1286aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMKKDGASSCLGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVL
ISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDYDPEA

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000520542_chr17_38068750_-_1290aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRV
SEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDY

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000418519_chr17_38068750_-_1299aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEEKDGASSCLGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKED
IRQDLEQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDEL

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000394179_chr17_38068750_-_1294aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMSAGLDIHFRGKTKSFPEGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDL
EQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPP

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000360317_chr17_38068750_-_1299aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEEKDGASSCLGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKED
IRQDLEQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDEL

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000394175_chr17_38068750_-_1277aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMRKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGELHMED
PDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDYDPEARILCALYVV

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000309481_chr17_38068750_-_1286aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMKKDGASSCLGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVL
ISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDYDPEA

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000520542_chr17_38068750_-_1290aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRV
SEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDY

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000418519_chr17_38068750_-_1299aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEEKDGASSCLGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKED
IRQDLEQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDEL

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000394179_chr17_38068750_-_1294aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMSAGLDIHFRGKTKSFPEGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDL
EQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPP

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000360317_chr17_38068750_-_1299aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEEKDGASSCLGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKED
IRQDLEQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDEL

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000394175_chr17_38068750_-_1277aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMRKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGELHMED
PDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDYDPEARILCALYVV

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000309481_chr17_38068750_-_1286aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMKKDGASSCLGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVL
ISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDYDPEA

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000520542_chr17_38068750_-_1290aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRV
SEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDY

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000418519_chr17_38068750_-_1299aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMNIHFRGKTKSFPEEKDGASSCLGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKED
IRQDLEQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDEL

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000394179_chr17_38068750_-_1294aa
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGE
PGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDA
PERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR
SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAE
AEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNS
IICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISG
SFQGFHHQKIKISENRISQQYLATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVT
IPPNRVLSYRVKQLVFPNKETMSAGLDIHFRGKTKSFPEGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDL
EQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPP

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000360317_chr17_38068750_-_647aa
MAGSFCWRMLGLVSKVGNRARCFSSMAASEEELLDFSGSELQFNSCSLHLSLHPFFNFLLGIHSCFVCKESKTDVKRCVVTQCGKFYHEA
CVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAHFTARKGKRHHAHVNVS
WCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFF
FGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISGSFQGFHHQKIKISENRISQQYL
ATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVTIPPNRVLSYRVKQLVFPNKETM
NIHFRGKTKSFPEEKDGASSCLGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGELHMED
PDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDYDPEARILCALYVV

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000394175_chr17_38068750_-_625aa
MAGSFCWRMLGLVSKVGNRARCFSSMAASEEELLDFSGSELQFNSCSLHLSLHPFFNFLLGIHSCFVCKESKTDVKRCVVTQCGKFYHEA
CVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAHFTARKGKRHHAHVNVS
WCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFF
FGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISGSFQGFHHQKIKISENRISQQYL
ATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVTIPPNRVLSYRVKQLVFPNKETM
RKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAK

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000309481_chr17_38068750_-_634aa
MAGSFCWRMLGLVSKVGNRARCFSSMAASEEELLDFSGSELQFNSCSLHLSLHPFFNFLLGIHSCFVCKESKTDVKRCVVTQCGKFYHEA
CVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAHFTARKGKRHHAHVNVS
WCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFF
FGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISGSFQGFHHQKIKISENRISQQYL
ATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVTIPPNRVLSYRVKQLVFPNKETM
KKDGASSCLGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGELHMEDPDKPLLSSLFNAA
GVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDYDPEARILCALYVVVSILLELAEGPTS

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000520542_chr17_38068750_-_638aa
MAGSFCWRMLGLVSKVGNRARCFSSMAASEEELLDFSGSELQFNSCSLHLSLHPFFNFLLGIHSCFVCKESKTDVKRCVVTQCGKFYHEA
CVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAHFTARKGKRHHAHVNVS
WCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFF
FGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISGSFQGFHHQKIKISENRISQQYL
ATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVTIPPNRVLSYRVKQLVFPNKETM
NIHFRGKTKSFPEGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGELHMEDPDKPLLSSL
FNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDYDPEARILCALYVVVSILLELAE

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000418519_chr17_38068750_-_647aa
MAGSFCWRMLGLVSKVGNRARCFSSMAASEEELLDFSGSELQFNSCSLHLSLHPFFNFLLGIHSCFVCKESKTDVKRCVVTQCGKFYHEA
CVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAHFTARKGKRHHAHVNVS
WCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFF
FGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISGSFQGFHHQKIKISENRISQQYL
ATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVTIPPNRVLSYRVKQLVFPNKETM
NIHFRGKTKSFPEEKDGASSCLGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGELHMED
PDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDYDPEARILCALYVV

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000394179_chr17_38068750_-_642aa
MAGSFCWRMLGLVSKVGNRARCFSSMAASEEELLDFSGSELQFNSCSLHLSLHPFFNFLLGIHSCFVCKESKTDVKRCVVTQCGKFYHEA
CVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAHFTARKGKRHHAHVNVS
WCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFF
FGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNGQKAEFQILDNVDSTGELIVRLPKEITISGSFQGFHHQKIKISENRISQQYL
ATLENRKLKRELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVTIPPNRVLSYRVKQLVFPNKETM
SAGLDIHFRGKTKSFPEGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSLAKCLGKEDIRQDLEQRVSEVLISGELHMEDPDKPL
LSSLFNAAGVLVEARAKAILDFLDALLELSEEQQFVAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDYDPEARILCALYVVVSILL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000360317_chr17_38068750_-_3897nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACA
AAATCCTTTCCAGAAGAGAAGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTG
GAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGAT
ATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGC
CTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAG
CAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTG
GCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCT

>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000394175_chr17_38068750_-_3831nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAGAAAGTCTTTGGGTTCGGAGGAT
TCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTC
GCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGAC
CCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCC
CTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTC
ATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTT

>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000309481_chr17_38068750_-_3858nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAAGAAGGATGGTGCTTCATCCTGT
TTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAG
AAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTG
ATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCA
AAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCT
CTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCA

>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000520542_chr17_38068750_-_3870nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACA
AAATCCTTTCCAGAAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGAC
CTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTA
TCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTA
GAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAG
GGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTAT
GACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAA

>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000418519_chr17_38068750_-_3897nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACA
AAATCCTTTCCAGAAGAGAAGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTG
GAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGAT
ATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGC
CTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAG
CAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTG
GCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCT

>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000394179_chr17_38068750_-_3882nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAGTGCTGGTTTAGATATTCATTTC
AGGGGCAAAACAAAATCCTTTCCAGAAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGT
GTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTA
GAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCT
GGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAG
GCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCT
GACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCT

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000360317_chr17_38068750_-_3897nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACA
AAATCCTTTCCAGAAGAGAAGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTG
GAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGAT
ATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGC
CTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAG
CAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTG
GCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCT

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000394175_chr17_38068750_-_3831nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAGAAAGTCTTTGGGTTCGGAGGAT
TCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTC
GCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGAC
CCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCC
CTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTC
ATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTT

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000309481_chr17_38068750_-_3858nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAAGAAGGATGGTGCTTCATCCTGT
TTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAG
AAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTG
ATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCA
AAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCT
CTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCA

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000520542_chr17_38068750_-_3870nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACA
AAATCCTTTCCAGAAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGAC
CTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTA
TCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTA
GAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAG
GGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTAT
GACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAA

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000418519_chr17_38068750_-_3897nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACA
AAATCCTTTCCAGAAGAGAAGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTG
GAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGAT
ATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGC
CTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAG
CAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTG
GCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCT

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000394179_chr17_38068750_-_3882nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAGTGCTGGTTTAGATATTCATTTC
AGGGGCAAAACAAAATCCTTTCCAGAAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGT
GTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTA
GAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCT
GGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAG
GCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCT
GACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCT

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000360317_chr17_38068750_-_3897nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACA
AAATCCTTTCCAGAAGAGAAGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTG
GAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGAT
ATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGC
CTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAG
CAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTG
GCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCT

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000394175_chr17_38068750_-_3831nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAGAAAGTCTTTGGGTTCGGAGGAT
TCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTC
GCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGAC
CCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCC
CTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTC
ATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTT

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000309481_chr17_38068750_-_3858nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAAGAAGGATGGTGCTTCATCCTGT
TTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAG
AAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTG
ATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCA
AAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCT
CTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCA

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000520542_chr17_38068750_-_3870nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACA
AAATCCTTTCCAGAAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGAC
CTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTA
TCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTA
GAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAG
GGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTAT
GACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAA

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000418519_chr17_38068750_-_3897nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACA
AAATCCTTTCCAGAAGAGAAGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTG
GAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGAT
ATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGC
CTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAG
CAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTG
GCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCT

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000394179_chr17_38068750_-_3882nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAGTGCTGGTTTAGATATTCATTTC
AGGGGCAAAACAAAATCCTTTCCAGAAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGT
GTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTA
GAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCT
GGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAG
GCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCT
GACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCT

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000360317_chr17_38068750_-_3897nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACA
AAATCCTTTCCAGAAGAGAAGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTG
GAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGAT
ATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGC
CTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAG
CAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTG
GCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCT

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000394175_chr17_38068750_-_3831nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAGAAAGTCTTTGGGTTCGGAGGAT
TCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTC
GCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGAC
CCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCC
CTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTC
ATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTT

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000309481_chr17_38068750_-_3858nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAAGAAGGATGGTGCTTCATCCTGT
TTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAG
AAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTG
ATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCA
AAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCT
CTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCA

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000520542_chr17_38068750_-_3870nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACA
AAATCCTTTCCAGAAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGAC
CTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTA
TCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTA
GAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAG
GGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTAT
GACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAA

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000418519_chr17_38068750_-_3897nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACA
AAATCCTTTCCAGAAGAGAAGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTG
GAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGAT
ATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGC
CTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAG
CAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTG
GCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCT

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000394179_chr17_38068750_-_3882nt
ATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGT
GCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGG
GTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAA
CCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGC
TCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGAT
GTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAG
CAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACT
GGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTT
TCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCC
CCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAG
GCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAA
GAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCC
AAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTG
AGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAG
AGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGA
AGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGT
GAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAA
GCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGC
TCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGA
AATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGAC
AGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGA
GGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTC
CACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGT
AAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACT
GTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGT
AAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGC
ATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGG
GGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAAT
GACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCAT
CCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGG
ACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAAC
GGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGC
AGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTG
AAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAA
ACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACC
ATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAGTGCTGGTTTAGATATTCATTTC
AGGGGCAAAACAAAATCCTTTCCAGAAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGT
GTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTA
GAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCT
GGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAG
GCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCT
GACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCT

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000360317_chr17_38068750_-_1941nt
ATGGCTGGATCTTTTTGCTGGAGAATGCTTGGACTAGTGAGCAAGGTTGGAAACAGGGCCAGGTGCTTTAGCAGCATGGCTGCCTCTGAA
GAGGAGTTGCTTGATTTTAGTGGCTCAGAACTGCAATTTAATTCTTGTTCTTTGCACCTCTCTCTCCACCCCTTCTTTAACTTTTTGTTA
GGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCT
TGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCT
TCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGA
TGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGC
TGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATG
CCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGA
TGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTC
TTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGA
GGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTA
CCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTG
GCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAA
ACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAA
CACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATG
AATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGAGAAGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGAT
TCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTC
GCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGAC
CCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCC
CTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTC
ATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTT

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000394175_chr17_38068750_-_1875nt
ATGGCTGGATCTTTTTGCTGGAGAATGCTTGGACTAGTGAGCAAGGTTGGAAACAGGGCCAGGTGCTTTAGCAGCATGGCTGCCTCTGAA
GAGGAGTTGCTTGATTTTAGTGGCTCAGAACTGCAATTTAATTCTTGTTCTTTGCACCTCTCTCTCCACCCCTTCTTTAACTTTTTGTTA
GGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCT
TGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCT
TCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGA
TGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGC
TGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATG
CCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGA
TGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTC
TTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGA
GGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTA
CCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTG
GCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAA
ACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAA
CACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATG
AGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAG
AGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATT
TCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAA
GCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTG
TTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGA

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000309481_chr17_38068750_-_1902nt
ATGGCTGGATCTTTTTGCTGGAGAATGCTTGGACTAGTGAGCAAGGTTGGAAACAGGGCCAGGTGCTTTAGCAGCATGGCTGCCTCTGAA
GAGGAGTTGCTTGATTTTAGTGGCTCAGAACTGCAATTTAATTCTTGTTCTTTGCACCTCTCTCTCCACCCCTTCTTTAACTTTTTGTTA
GGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCT
TGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCT
TCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGA
TGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGC
TGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATG
CCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGA
TGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTC
TTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGA
GGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTA
CCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTG
GCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAA
ACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAA
CACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATG
AAGAAGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGT
GTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTA
GAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCT
GGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAG
GCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCT
GACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCT

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000520542_chr17_38068750_-_1914nt
ATGGCTGGATCTTTTTGCTGGAGAATGCTTGGACTAGTGAGCAAGGTTGGAAACAGGGCCAGGTGCTTTAGCAGCATGGCTGCCTCTGAA
GAGGAGTTGCTTGATTTTAGTGGCTCAGAACTGCAATTTAATTCTTGTTCTTTGCACCTCTCTCTCCACCCCTTCTTTAACTTTTTGTTA
GGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCT
TGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCT
TCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGA
TGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGC
TGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATG
CCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGA
TGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTC
TTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGA
GGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTA
CCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTG
GCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAA
ACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAA
CACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATG
AATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAG
GACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATT
CGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTT
TTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAG
TTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCC
AGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAG

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000418519_chr17_38068750_-_1941nt
ATGGCTGGATCTTTTTGCTGGAGAATGCTTGGACTAGTGAGCAAGGTTGGAAACAGGGCCAGGTGCTTTAGCAGCATGGCTGCCTCTGAA
GAGGAGTTGCTTGATTTTAGTGGCTCAGAACTGCAATTTAATTCTTGTTCTTTGCACCTCTCTCTCCACCCCTTCTTTAACTTTTTGTTA
GGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCT
TGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCT
TCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGA
TGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGC
TGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATG
CCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGA
TGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTC
TTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGA
GGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTA
CCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTG
GCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAA
ACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAA
CACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATG
AATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGAGAAGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGAT
TCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTC
GCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGAC
CCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCC
CTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTC
ATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTT

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000394179_chr17_38068750_-_1926nt
ATGGCTGGATCTTTTTGCTGGAGAATGCTTGGACTAGTGAGCAAGGTTGGAAACAGGGCCAGGTGCTTTAGCAGCATGGCTGCCTCTGAA
GAGGAGTTGCTTGATTTTAGTGGCTCAGAACTGCAATTTAATTCTTGTTCTTTGCACCTCTCTCTCCACCCCTTCTTTAACTTTTTGTTA
GGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCT
TGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCT
TCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGA
TGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGC
TGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATG
CCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGA
TGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTC
TTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGA
GGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTA
CCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTG
GCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAA
ACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAA
CACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATG
AGTGCTGGTTTAGATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAG
GAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGC
AAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTC
CTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCT
GAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGG
GATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000360317_chr17_38068750_-_4262nt
CGCTGCGCCCGCCGCCGCCGCCGCCCCCTCCCCGCCTGGGCCCTACCGCCGCACGGCCCCGGCCCCCTCCCAGCCTGCCGCTCCGGAGAG
CCGCCCGCCGAGGATGCGACGCACCGCAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTC
TGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAA
CCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCT
GCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGA
GTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAAC
ATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACC
AGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAA
GATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAA
CGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAA
ACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCT
CGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATT
GAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAA
AGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGG
AGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCG
GAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCC
CAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTT
GGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTG
GAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGT
AAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGAC
GGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCT
CAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCT
TGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATA
CGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCA
GCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCC
AGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGT
GGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCT
CCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGC
CTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAA
GGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGC
GGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCA
GGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAAT
GAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGA
GGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAA
TGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAA
GATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAAT
TAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTG
GAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGT
AAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGAGAAGGATGGTGCTTC
ATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGAC
AGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGA
GGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGC
GCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGAC
CCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCC
TGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACA
AAAGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGAC
CTCTTTAAAACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATTTCATACATGGACT

>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000394175_chr17_38068750_-_4196nt
CGCTGCGCCCGCCGCCGCCGCCGCCCCCTCCCCGCCTGGGCCCTACCGCCGCACGGCCCCGGCCCCCTCCCAGCCTGCCGCTCCGGAGAG
CCGCCCGCCGAGGATGCGACGCACCGCAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTC
TGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAA
CCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCT
GCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGA
GTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAAC
ATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACC
AGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAA
GATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAA
CGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAA
ACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCT
CGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATT
GAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAA
AGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGG
AGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCG
GAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCC
CAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTT
GGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTG
GAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGT
AAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGAC
GGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCT
CAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCT
TGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATA
CGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCA
GCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCC
AGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGT
GGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCT
CCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGC
CTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAA
GGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGC
GGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCA
GGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAAT
GAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGA
GGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAA
TGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAA
GATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAAT
TAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTG
GAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGT
AAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACAT
GGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCA
GGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAA
TGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGT
GGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAG
TCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCC
TACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCA
CTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAAC

>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000309481_chr17_38068750_-_4223nt
CGCTGCGCCCGCCGCCGCCGCCGCCCCCTCCCCGCCTGGGCCCTACCGCCGCACGGCCCCGGCCCCCTCCCAGCCTGCCGCTCCGGAGAG
CCGCCCGCCGAGGATGCGACGCACCGCAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTC
TGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAA
CCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCT
GCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGA
GTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAAC
ATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACC
AGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAA
GATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAA
CGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAA
ACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCT
CGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATT
GAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAA
AGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGG
AGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCG
GAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCC
CAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTT
GGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTG
GAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGT
AAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGAC
GGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCT
CAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCT
TGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATA
CGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCA
GCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCC
AGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGT
GGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCT
CCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGC
CTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAA
GGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGC
GGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCA
GGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAAT
GAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGA
GGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAA
TGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAA
GATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAAT
TAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTG
GAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGT
AAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAAGAAGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAG
AAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAA
GTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGA
CAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCT
AGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGA
GCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTC
TATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTT
ACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATTCTTTGATGTATCC

>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000520542_chr17_38068750_-_4233nt
CGCTGCGCCCGCCGCCGCCGCCGCCCCCTCCCCGCCTGGGCCCTACCGCCGCACGGCCCCGGCCCCCTCCCAGCCTGCCGCTCCGGAGAG
CCGCCCGCCGAGGATGCGACGCACCGCAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTC
TGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAA
CCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCT
GCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGA
GTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAAC
ATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACC
AGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAA
GATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAA
CGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAA
ACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCT
CGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATT
GAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAA
AGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGG
AGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCG
GAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCC
CAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTT
GGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTG
GAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGT
AAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGAC
GGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCT
CAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCT
TGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATA
CGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCA
GCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCC
AGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGT
GGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCT
CCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGC
CTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAA
GGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGC
GGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCA
GGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAAT
GAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGA
GGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAA
TGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAA
GATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAAT
TAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTG
GAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGT
AAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGGAAAGTCTTTGGGTTC
GGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAA
CTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACAT
GGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCT
GGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAA
ATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTA
TGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCTG
GGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATTC
TTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATTTCATACATGGACTTCTGATTAAAAGTGGCAGGTTGTGCAT

>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000418519_chr17_38068750_-_4260nt
CGCTGCGCCCGCCGCCGCCGCCGCCCCCTCCCCGCCTGGGCCCTACCGCCGCACGGCCCCGGCCCCCTCCCAGCCTGCCGCTCCGGAGAG
CCGCCCGCCGAGGATGCGACGCACCGCAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTC
TGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAA
CCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCT
GCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGA
GTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAAC
ATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACC
AGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAA
GATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAA
CGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAA
ACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCT
CGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATT
GAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAA
AGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGG
AGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCG
GAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCC
CAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTT
GGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTG
GAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGT
AAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGAC
GGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCT
CAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCT
TGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATA
CGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCA
GCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCC
AGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGT
GGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCT
CCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGC
CTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAA
GGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGC
GGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCA
GGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAAT
GAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGA
GGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAA
TGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAA
GATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAAT
TAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTG
GAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGT
AAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGAGAAGGATGGTGCTTC
ATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGAC
AGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGA
GGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGC
GCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGAC
CCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCC
TGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACA
AAAGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGAC
CTCTTTAAAACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATTTCATACATGGACT

>In-frame_WHSC1_ENST00000508803_chr4_1957915_+_GSDMB_ENST00000394179_chr17_38068750_-_4245nt
CGCTGCGCCCGCCGCCGCCGCCGCCCCCTCCCCGCCTGGGCCCTACCGCCGCACGGCCCCGGCCCCCTCCCAGCCTGCCGCTCCGGAGAG
CCGCCCGCCGAGGATGCGACGCACCGCAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTC
TGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAA
CCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCT
GCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGA
GTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAAC
ATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACC
AGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAA
GATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAA
CGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAA
ACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCT
CGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATT
GAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAA
AGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGG
AGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCG
GAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCC
CAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTT
GGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTG
GAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGT
AAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGAC
GGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCT
CAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCT
TGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATA
CGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCA
GCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCC
AGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGT
GGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCT
CCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGC
CTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAA
GGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGC
GGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCA
GGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAAT
GAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGA
GGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAA
TGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAA
GATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAAT
TAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTG
GAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGT
AAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAGTGCTGGTTTAGATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGGAAA
GTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAA
AGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGG
GGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCAT
TCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAA
GGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCT
CTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCCC
CACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAGC
AGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATTTCATACATGGACTTCTGATTAAAAGTGG

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000360317_chr17_38068750_-_4428nt
TGGTCTTGAACTCCTGACCTTGTGATCCGCTCGCCTCAGCCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCGTGCCTGTCCTAGAA
CCACTGGTAACTCTTAACTGCTGTCTGCTTTTCTGTGGAGACTGCGGGTTGCAGACACCAGCAGCCCCCTATTGCTGCACGTCAGGTGTC
CTCCACCTCAGTACTGTGGACATCTCGGGCCGCATAGCCCTGTTGCGCGGGCATCCTGTGCGTTGCAGGAGATGCAGCAGCATCCATGAC
CGCAACCCATCAGAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTG
TAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTG
TGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAG
CCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGA
AAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGA
AGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGA
GAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTT
CAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGG
TGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGA
AAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAG
GAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAG
GGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCT
TTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAAT
CCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGT
GTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAG
GGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAA
AACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTG
AGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAA
GAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTC
TTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAG
CAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAA
GTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACG
AAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGC
CGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCA
CCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTG
GAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGA
GCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGG
ATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACC
ACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTG
ACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGG
TGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTG
GAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCA
GCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGG
GAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACC
GGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAA
ACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTC
AGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCT
TCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGAGAAGGATGGTGCTTCATCCTGTTTAGGAA
AGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAA
AAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCG
GGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCA
TTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGA
AGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTC
TCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCC
CCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAG
CAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATTTCATACATGGACTTCTGATTAAAAGTG

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000394175_chr17_38068750_-_4362nt
TGGTCTTGAACTCCTGACCTTGTGATCCGCTCGCCTCAGCCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCGTGCCTGTCCTAGAA
CCACTGGTAACTCTTAACTGCTGTCTGCTTTTCTGTGGAGACTGCGGGTTGCAGACACCAGCAGCCCCCTATTGCTGCACGTCAGGTGTC
CTCCACCTCAGTACTGTGGACATCTCGGGCCGCATAGCCCTGTTGCGCGGGCATCCTGTGCGTTGCAGGAGATGCAGCAGCATCCATGAC
CGCAACCCATCAGAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTG
TAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTG
TGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAG
CCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGA
AAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGA
AGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGA
GAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTT
CAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGG
TGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGA
AAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAG
GAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAG
GGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCT
TTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAAT
CCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGT
GTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAG
GGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAA
AACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTG
AGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAA
GAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTC
TTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAG
CAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAA
GTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACG
AAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGC
CGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCA
CCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTG
GAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGA
GCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGG
ATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACC
ACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTG
ACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGG
TGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTG
GAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCA
GCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGG
GAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACC
GGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAA
ACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTC
AGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCT
TCCCCAACAAGGAGACGATGAGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCA
AGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAA
GAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCT
TGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGG
AGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGG
ACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTT
CCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCA
CCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATTTCA

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000309481_chr17_38068750_-_4389nt
TGGTCTTGAACTCCTGACCTTGTGATCCGCTCGCCTCAGCCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCGTGCCTGTCCTAGAA
CCACTGGTAACTCTTAACTGCTGTCTGCTTTTCTGTGGAGACTGCGGGTTGCAGACACCAGCAGCCCCCTATTGCTGCACGTCAGGTGTC
CTCCACCTCAGTACTGTGGACATCTCGGGCCGCATAGCCCTGTTGCGCGGGCATCCTGTGCGTTGCAGGAGATGCAGCAGCATCCATGAC
CGCAACCCATCAGAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTG
TAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTG
TGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAG
CCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGA
AAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGA
AGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGA
GAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTT
CAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGG
TGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGA
AAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAG
GAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAG
GGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCT
TTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAAT
CCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGT
GTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAG
GGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAA
AACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTG
AGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAA
GAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTC
TTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAG
CAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAA
GTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACG
AAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGC
CGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCA
CCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTG
GAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGA
GCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGG
ATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACC
ACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTG
ACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGG
TGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTG
GAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCA
GCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGG
GAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACC
GGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAA
ACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTC
AGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCT
TCCCCAACAAGGAGACGATGAAGAAGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGA
AGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGG
AGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAA
GCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAG
AGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATG
AGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGC
TGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTC
ACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGT

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000520542_chr17_38068750_-_4399nt
TGGTCTTGAACTCCTGACCTTGTGATCCGCTCGCCTCAGCCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCGTGCCTGTCCTAGAA
CCACTGGTAACTCTTAACTGCTGTCTGCTTTTCTGTGGAGACTGCGGGTTGCAGACACCAGCAGCCCCCTATTGCTGCACGTCAGGTGTC
CTCCACCTCAGTACTGTGGACATCTCGGGCCGCATAGCCCTGTTGCGCGGGCATCCTGTGCGTTGCAGGAGATGCAGCAGCATCCATGAC
CGCAACCCATCAGAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTG
TAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTG
TGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAG
CCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGA
AAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGA
AGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGA
GAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTT
CAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGG
TGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGA
AAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAG
GAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAG
GGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCT
TTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAAT
CCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGT
GTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAG
GGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAA
AACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTG
AGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAA
GAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTC
TTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAG
CAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAA
GTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACG
AAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGC
CGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCA
CCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTG
GAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGA
GCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGG
ATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACC
ACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTG
ACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGG
TGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTG
GAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCA
GCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGG
GAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACC
GGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAA
ACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTC
AGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCT
TCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAA
ACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGT
GCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACA
AGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAG
AGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGC
AGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTA
TCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTTAC
CAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATTCTTTGATGTATCCCA

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000418519_chr17_38068750_-_4426nt
TGGTCTTGAACTCCTGACCTTGTGATCCGCTCGCCTCAGCCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCGTGCCTGTCCTAGAA
CCACTGGTAACTCTTAACTGCTGTCTGCTTTTCTGTGGAGACTGCGGGTTGCAGACACCAGCAGCCCCCTATTGCTGCACGTCAGGTGTC
CTCCACCTCAGTACTGTGGACATCTCGGGCCGCATAGCCCTGTTGCGCGGGCATCCTGTGCGTTGCAGGAGATGCAGCAGCATCCATGAC
CGCAACCCATCAGAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTG
TAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTG
TGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAG
CCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGA
AAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGA
AGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGA
GAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTT
CAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGG
TGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGA
AAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAG
GAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAG
GGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCT
TTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAAT
CCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGT
GTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAG
GGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAA
AACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTG
AGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAA
GAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTC
TTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAG
CAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAA
GTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACG
AAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGC
CGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCA
CCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTG
GAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGA
GCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGG
ATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACC
ACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTG
ACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGG
TGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTG
GAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCA
GCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGG
GAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACC
GGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAA
ACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTC
AGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCT
TCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGAGAAGGATGGTGCTTCATCCTGTTTAGGAA
AGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAA
AAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCG
GGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCA
TTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGA
AGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTC
TCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCC
CCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAG
CAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATTTCATACATGGACTTCTGATTAAAAGTG

>In-frame_WHSC1_ENST00000382892_chr4_1957915_+_GSDMB_ENST00000394179_chr17_38068750_-_4411nt
TGGTCTTGAACTCCTGACCTTGTGATCCGCTCGCCTCAGCCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCGTGCCTGTCCTAGAA
CCACTGGTAACTCTTAACTGCTGTCTGCTTTTCTGTGGAGACTGCGGGTTGCAGACACCAGCAGCCCCCTATTGCTGCACGTCAGGTGTC
CTCCACCTCAGTACTGTGGACATCTCGGGCCGCATAGCCCTGTTGCGCGGGCATCCTGTGCGTTGCAGGAGATGCAGCAGCATCCATGAC
CGCAACCCATCAGAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAGTGTTG
TAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTG
TGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTATTCCAG
CCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGA
AAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAATGGGA
AGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGA
GAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAGTCCTT
CAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGATTTGG
TGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGGTCAGA
AAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAG
GAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAATTTCAG
GGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCT
TTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGCAGAAT
CCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGT
GTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGGAGTAG
GGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAA
AACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCTGAGTG
AGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAAAAAAA
GAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTC
TTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCAGGCAG
CAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAGCAAAA
GTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACG
AAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGAGAAGC
CGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAGGTTCA
CCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTG
GAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGA
GCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGG
ATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACC
ACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTG
ACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGG
TGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTG
GAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCA
GCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGG
GAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACC
GGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAA
ACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTC
AGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCT
TCCCCAACAAGGAGACGATGAGTGCTGGTTTAGATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGGAAAGTCTTTGGGTTCGG
AGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACT
CCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGG
AGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGG
ATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAAT
CTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATG
TTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCTGGG
TTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATTCTT
TGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATTTCATACATGGACTTCTGATTAAAAGTGGCAGGTTGTGCATGT

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000360317_chr17_38068750_-_4253nt
TGGTCTTGAACTCCTGACCTTGTGATCCGCTCGCCTCAGCCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCGTGCCTGTCCTAGAA
CCACTGGTAACTCTTAACTGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAG
TGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTG
TTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTAT
TCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGA
AATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAA
TGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAA
GGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAG
TCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGA
TTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGG
TCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTT
TGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAAT
TTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTT
CACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGC
AGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAA
ACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGG
AGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTG
TCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCT
GAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAA
AAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCA
CAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCA
GGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAG
CAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGC
AGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGA
GAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAG
GTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCA
GTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTG
TGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAG
CGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCG
ACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCA
CCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCAT
TTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGA
GATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCG
GGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTC
AACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGA
GAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAG
AGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGAT
CTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCT
TGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGAGAAGGATGGTGCTTCATCCTGTTT
AGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAA
GAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGAT
TTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAA
AGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCT
GTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACG
AATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTT
TCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAA
ACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATTTCATACATGGACTTCTGATTAA

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000394175_chr17_38068750_-_4187nt
TGGTCTTGAACTCCTGACCTTGTGATCCGCTCGCCTCAGCCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCGTGCCTGTCCTAGAA
CCACTGGTAACTCTTAACTGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAG
TGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTG
TTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTAT
TCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGA
AATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAA
TGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAA
GGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAG
TCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGA
TTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGG
TCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTT
TGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAAT
TTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTT
CACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGC
AGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAA
ACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGG
AGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTG
TCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCT
GAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAA
AAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCA
CAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCA
GGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAG
CAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGC
AGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGA
GAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAG
GTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCA
GTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTG
TGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAG
CGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCG
ACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCA
CCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCAT
TTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGA
GATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCG
GGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTC
AACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGA
GAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAG
AGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGAT
CTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCT
TGTCTTCCCCAACAAGGAGACGATGAGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGT
CCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGA
GCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGG
GGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGC
CCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGA
CATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGT
CTCTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCC
TGTCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGA

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000309481_chr17_38068750_-_4214nt
TGGTCTTGAACTCCTGACCTTGTGATCCGCTCGCCTCAGCCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCGTGCCTGTCCTAGAA
CCACTGGTAACTCTTAACTGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAG
TGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTG
TTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTAT
TCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGA
AATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAA
TGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAA
GGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAG
TCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGA
TTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGG
TCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTT
TGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAAT
TTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTT
CACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGC
AGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAA
ACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGG
AGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTG
TCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCT
GAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAA
AAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCA
CAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCA
GGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAG
CAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGC
AGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGA
GAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAG
GTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCA
GTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTG
TGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAG
CGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCG
ACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCA
CCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCAT
TTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGA
GATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCG
GGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTC
AACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGA
GAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAG
AGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGAT
CTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCT
TGTCTTCCCCAACAAGGAGACGATGAAGAAGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAA
GGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGG
CAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCT
CCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTC
TGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTG
GGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCT
GGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTG
TCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTC

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000520542_chr17_38068750_-_4224nt
TGGTCTTGAACTCCTGACCTTGTGATCCGCTCGCCTCAGCCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCGTGCCTGTCCTAGAA
CCACTGGTAACTCTTAACTGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAG
TGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTG
TTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTAT
TCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGA
AATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAA
TGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAA
GGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAG
TCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGA
TTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGG
TCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTT
TGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAAT
TTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTT
CACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGC
AGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAA
ACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGG
AGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTG
TCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCT
GAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAA
AAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCA
CAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCA
GGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAG
CAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGC
AGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGA
GAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAG
GTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCA
GTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTG
TGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAG
CGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCG
ACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCA
CCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCAT
TTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGA
GATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCG
GGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTC
AACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGA
GAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAG
AGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGAT
CTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCT
TGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGGAAAGTCTTTGGGTTCGGAGGATTC
CAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGC
TAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCC
AGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCT
GCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCAT
GGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGT
CTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCC
TTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATTCTTTGATGTA

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000418519_chr17_38068750_-_4251nt
TGGTCTTGAACTCCTGACCTTGTGATCCGCTCGCCTCAGCCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCGTGCCTGTCCTAGAA
CCACTGGTAACTCTTAACTGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAG
TGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTG
TTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTAT
TCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGA
AATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAA
TGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAA
GGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAG
TCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGA
TTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGG
TCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTT
TGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAAT
TTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTT
CACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGC
AGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAA
ACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGG
AGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTG
TCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCT
GAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAA
AAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCA
CAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCA
GGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAG
CAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGC
AGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGA
GAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAG
GTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCA
GTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTG
TGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAG
CGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCG
ACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCA
CCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCAT
TTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGA
GATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCG
GGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTC
AACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGA
GAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAG
AGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGAT
CTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCT
TGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGAGAAGGATGGTGCTTCATCCTGTTT
AGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAA
GAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGAT
TTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAA
AGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCT
GTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACG
AATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTT
TCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAA
ACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATTTCATACATGGACTTCTGATTAA

>In-frame_WHSC1_ENST00000382891_chr4_1957915_+_GSDMB_ENST00000394179_chr17_38068750_-_4236nt
TGGTCTTGAACTCCTGACCTTGTGATCCGCTCGCCTCAGCCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCGTGCCTGTCCTAGAA
CCACTGGTAACTCTTAACTGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGCAGAGTCCCCTTTCTGTTCAGAG
TGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGAGCTGCGAGGTGAACCGCGAGTG
TTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTTAT
TCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCAAACTGCGTTTTGAGTCCCAGGA
AATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATGAA
TGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAAATGGACAAAAACCAGAAAACAA
GGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCAAG
TCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAATACAACGTTGGTGA
TTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAGG
TCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATATTTGAGAAGAGCCTCGTAGCTTT
TGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAGCTATTGAAACCAAT
TTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTT
CACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCTTTGGGAGAAATGGC
AGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAA
ACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCTGACCCCAGAAGAGG
AGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTG
TCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAGTGGAGTCTGCT
GAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAGACTCTGGTAATGTAAATGGGAA
AAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCA
CAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCCTCCTCGCTCAAGAGCCA
GGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAGCATCTTCAGCTCTTGGGTTTAG
CAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGC
AGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAGTATGTGTGCCAGCTGTGTGA
GAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGGCCAGAAGGGAG
GTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCA
GTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTG
TGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAG
CGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCG
ACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCA
CCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCAT
TTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGA
GATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCG
GGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTC
AACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGA
GAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAG
AGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGAT
CTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCT
TGTCTTCCCCAACAAGGAGACGATGAGTGCTGGTTTAGATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGGAAAGTCTTTGGG
TTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCT
AAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACA
CATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTT
CCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGT
GAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCT
GTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCT
CTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCA
TTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATTTCATACATGGACTTCTGATTAAAAGTGGCAGGTTGTG

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000360317_chr17_38068750_-_4545nt
GCATGAGCCACCGTGCCTGTCCTAGAACCACTGGTAACTCTTAACTGAGACAAGATTTCGCCATGTTGCCCAGGCTGGTCTCGAACTTCT
GAGCTCAAGCGATCTACCTGCCTCGTCCTCCCAAAGTGTTGGAATTGCAGGTGTGAGCCACTGCACCCGGCCCTTGCCTCATGTTTGAAT
GATAATTTACCTGGGCATAAAATTCTGGACACTTGTGGTGGCACGAGCTGTCTGCTTTTCTGTGGAGACTGCGGGTTGCAGACACCAGCA
GCCCCCTATTGCTGCACGTCAGGTGTCCTCCACCTCAGTACTGTGGACATCTCGGGCCGCATAGCCCTGTTGCGCGGGCATCCTGTGCGT
TGCAGGAGATGCAGCAGCATCCATGACCGCAACCCATCAGAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGC
AGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGA
GCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACG
GCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCA
AACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGA
AAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAA
ATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAG
CTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACC
TGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTC
ACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATAT
TTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGA
AAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAG
TGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTG
CAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCA
TGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGG
CAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAG
CATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGC
TCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAG
ACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGA
AAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGG
CAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAG
CATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCT
CGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGG
AGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGC
TTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATG
TTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTT
TCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCC
GCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACT
TCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTG
AGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGA
AGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAA
ATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGT
TCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTC
AAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACC
ATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTT
CATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGC
AATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCC
TGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGAGA
AGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCC
TCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGC
AAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGG
TCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCC
TGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACA
TGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCT
CTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTG
TCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATT

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000394175_chr17_38068750_-_4479nt
GCATGAGCCACCGTGCCTGTCCTAGAACCACTGGTAACTCTTAACTGAGACAAGATTTCGCCATGTTGCCCAGGCTGGTCTCGAACTTCT
GAGCTCAAGCGATCTACCTGCCTCGTCCTCCCAAAGTGTTGGAATTGCAGGTGTGAGCCACTGCACCCGGCCCTTGCCTCATGTTTGAAT
GATAATTTACCTGGGCATAAAATTCTGGACACTTGTGGTGGCACGAGCTGTCTGCTTTTCTGTGGAGACTGCGGGTTGCAGACACCAGCA
GCCCCCTATTGCTGCACGTCAGGTGTCCTCCACCTCAGTACTGTGGACATCTCGGGCCGCATAGCCCTGTTGCGCGGGCATCCTGTGCGT
TGCAGGAGATGCAGCAGCATCCATGACCGCAACCCATCAGAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGC
AGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGA
GCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACG
GCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCA
AACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGA
AAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAA
ATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAG
CTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACC
TGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTC
ACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATAT
TTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGA
AAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAG
TGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTG
CAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCA
TGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGG
CAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAG
CATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGC
TCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAG
ACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGA
AAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGG
CAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAG
CATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCT
CGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGG
AGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGC
TTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATG
TTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTT
TCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCC
GCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACT
TCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTG
AGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGA
AGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAA
ATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGT
TCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTC
AAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACC
ATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTT
CATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGC
AATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCC
TGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGA
AGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGG
AGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAA
GCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAG
AGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATG
AGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGC
TGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTC
ACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGT

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000309481_chr17_38068750_-_4506nt
GCATGAGCCACCGTGCCTGTCCTAGAACCACTGGTAACTCTTAACTGAGACAAGATTTCGCCATGTTGCCCAGGCTGGTCTCGAACTTCT
GAGCTCAAGCGATCTACCTGCCTCGTCCTCCCAAAGTGTTGGAATTGCAGGTGTGAGCCACTGCACCCGGCCCTTGCCTCATGTTTGAAT
GATAATTTACCTGGGCATAAAATTCTGGACACTTGTGGTGGCACGAGCTGTCTGCTTTTCTGTGGAGACTGCGGGTTGCAGACACCAGCA
GCCCCCTATTGCTGCACGTCAGGTGTCCTCCACCTCAGTACTGTGGACATCTCGGGCCGCATAGCCCTGTTGCGCGGGCATCCTGTGCGT
TGCAGGAGATGCAGCAGCATCCATGACCGCAACCCATCAGAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGC
AGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGA
GCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACG
GCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCA
AACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGA
AAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAA
ATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAG
CTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACC
TGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTC
ACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATAT
TTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGA
AAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAG
TGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTG
CAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCA
TGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGG
CAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAG
CATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGC
TCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAG
ACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGA
AAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGG
CAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAG
CATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCT
CGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGG
AGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGC
TTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATG
TTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTT
TCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCC
GCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACT
TCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTG
AGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGA
AGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAA
ATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGT
TCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTC
AAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACC
ATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTT
CATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGC
AATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCC
TGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAAGAAGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTT
CGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAA
ACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACA
TGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCC
TGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGA
AATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGT
ATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCT
GGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATT
CTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATTTCATACATGGACTTCTGATTAAAAGTGGCAGGTTGTGCA

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000520542_chr17_38068750_-_4516nt
GCATGAGCCACCGTGCCTGTCCTAGAACCACTGGTAACTCTTAACTGAGACAAGATTTCGCCATGTTGCCCAGGCTGGTCTCGAACTTCT
GAGCTCAAGCGATCTACCTGCCTCGTCCTCCCAAAGTGTTGGAATTGCAGGTGTGAGCCACTGCACCCGGCCCTTGCCTCATGTTTGAAT
GATAATTTACCTGGGCATAAAATTCTGGACACTTGTGGTGGCACGAGCTGTCTGCTTTTCTGTGGAGACTGCGGGTTGCAGACACCAGCA
GCCCCCTATTGCTGCACGTCAGGTGTCCTCCACCTCAGTACTGTGGACATCTCGGGCCGCATAGCCCTGTTGCGCGGGCATCCTGTGCGT
TGCAGGAGATGCAGCAGCATCCATGACCGCAACCCATCAGAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGC
AGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGA
GCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACG
GCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCA
AACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGA
AAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAA
ATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAG
CTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACC
TGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTC
ACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATAT
TTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGA
AAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAG
TGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTG
CAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCA
TGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGG
CAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAG
CATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGC
TCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAG
ACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGA
AAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGG
CAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAG
CATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCT
CGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGG
AGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGC
TTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATG
TTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTT
TCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCC
GCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACT
TCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTG
AGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGA
AGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAA
ATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGT
TCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTC
AAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACC
ATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTT
CATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGC
AATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCC
TGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGGAA
AGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAA
AAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCG
GGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCA
TTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGA
AGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTC
TCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCC
CCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAG
CAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATTTCATACATGGACTTCTGATTAAAAGTG

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000418519_chr17_38068750_-_4543nt
GCATGAGCCACCGTGCCTGTCCTAGAACCACTGGTAACTCTTAACTGAGACAAGATTTCGCCATGTTGCCCAGGCTGGTCTCGAACTTCT
GAGCTCAAGCGATCTACCTGCCTCGTCCTCCCAAAGTGTTGGAATTGCAGGTGTGAGCCACTGCACCCGGCCCTTGCCTCATGTTTGAAT
GATAATTTACCTGGGCATAAAATTCTGGACACTTGTGGTGGCACGAGCTGTCTGCTTTTCTGTGGAGACTGCGGGTTGCAGACACCAGCA
GCCCCCTATTGCTGCACGTCAGGTGTCCTCCACCTCAGTACTGTGGACATCTCGGGCCGCATAGCCCTGTTGCGCGGGCATCCTGTGCGT
TGCAGGAGATGCAGCAGCATCCATGACCGCAACCCATCAGAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGC
AGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGA
GCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACG
GCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCA
AACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGA
AAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAA
ATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAG
CTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACC
TGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTC
ACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATAT
TTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGA
AAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAG
TGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTG
CAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCA
TGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGG
CAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAG
CATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGC
TCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAG
ACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGA
AAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGG
CAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAG
CATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCT
CGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGG
AGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGC
TTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATG
TTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTT
TCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCC
GCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACT
TCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTG
AGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGA
AGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAA
ATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGT
TCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTC
AAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACC
ATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTT
CATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGC
AATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCC
TGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAACAAAATCCTTTCCAGAAGAGA
AGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCC
TCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGC
AAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGG
TCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCC
TGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACA
TGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCT
CTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTG
TCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATT

>In-frame_WHSC1_ENST00000382895_chr4_1957915_+_GSDMB_ENST00000394179_chr17_38068750_-_4528nt
GCATGAGCCACCGTGCCTGTCCTAGAACCACTGGTAACTCTTAACTGAGACAAGATTTCGCCATGTTGCCCAGGCTGGTCTCGAACTTCT
GAGCTCAAGCGATCTACCTGCCTCGTCCTCCCAAAGTGTTGGAATTGCAGGTGTGAGCCACTGCACCCGGCCCTTGCCTCATGTTTGAAT
GATAATTTACCTGGGCATAAAATTCTGGACACTTGTGGTGGCACGAGCTGTCTGCTTTTCTGTGGAGACTGCGGGTTGCAGACACCAGCA
GCCCCCTATTGCTGCACGTCAGGTGTCCTCCACCTCAGTACTGTGGACATCTCGGGCCGCATAGCCCTGTTGCGCGGGCATCCTGTGCGT
TGCAGGAGATGCAGCAGCATCCATGACCGCAACCCATCAGAGTGTTCTAAGAACGGAAGCATCTGGGCTGGATGGAATTTAGCATCAAGC
AGAGTCCCCTTTCTGTTCAGAGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGGAAGACTCCGA
GCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTCTCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACG
GCCACGACGCCCTGCCCTTTATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCACACGATGCCA
AACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAACACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGA
AAATCACCAAAACATACATGAATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAGTCAGAAGAAA
ATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATAAAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAG
CTCTTGTGTCTAAGATCTCAAGTCCTTCAGATAAAAAGATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACC
TGTTGAAATACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATGGTTTCTGCAGATCCACTCCTTC
ACAGCTATACCAAACTTAAAGGTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAGCTTGGATAT
TTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTATGCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGA
AAATTAAGCTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCAGAAGAAGCTGCAAGCATGTCAG
TGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTGGGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTG
CAGAGTCTTTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCTGTGAGAGAAGAGTGCATTCCCA
TGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCAGAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGG
CAGAGGCTGACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCACGAAGCAGGAAGGGAGATGCAG
CATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGATGAGGTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGC
TCAGGTCACAGTGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCCCCTGTCCAGGCTGAAGAAG
ACTCTGGTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATGCTGAAGCTGAGGACACACCCAGGA
AAAGACTCAGGACGGACAAGCACAGTCTTCGGAAGAGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGG
CAGCCTCCTCGCTCAAGAGCCAGGCAGCAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGGCAG
CATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGAATGAGGTCTCGGACAGCCCGGGAGACGAGCCCT
CGGAGTCCCCATACGAAAGTGCAGACGAAACACAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGG
AGTATGTGTGCCAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGC
TTTCCCGGAGGCCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGGATTCACTCATGTTTCGTGTGTAAAGAGAGCAAGACAGATG
TTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGACTGTATTTGAGAGCCGAGGTT
TCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTAAAATGATGCGGTGTGTCC
GCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACT
TCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAGGGGGGAGCCTTCTGTGCTGTG
AGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGA
AGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAA
ATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCATCAGGCGCGAGTGT
TCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAAACGGTCAAAAGGCTGAGTTTC
AAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAGGCAGTTTCCAGGGCTTCCACC
ATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGCTGAAGAGGGAACTACCCTTTT
CATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGGAAACCCTGAAAAGCGACCGGC
AATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGACCATCCCCCCAAATCGGGTCC
TGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAGTGCTGGTTTAGATATTCATTTCAGGGGCAAAACAAAATCCT
TTCCAGAAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAG
AGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGG
TCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGC
GTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCC
TTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTG
AGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAA
AGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCT
CTTTAAAACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATTTCATACATGGACTTC

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000360317_chr17_38068750_-_2676nt
CAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGG
CCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGTGTCGCCCGGCACAGTCTGGGGTCTGTGAGGATGATGAGAGGACACCTGCAC
AGCCGTGGCCCTTCCTGCCTACTCACCGGGCCCAAGGAGTCTCCTATCTCACGTCAGAACACTTCCTGGGTCAGGAAGACACCTGGAGAG
TCTCCCAGGCCATGGCAGCCCCACAGCAGCACCTCACTTATGGGAGTGTCTGTCTGCCTGCCCAGAATGATAAGTGACTGCTCCACCACT
GGCCAGCTGCTCTCAAGGAGGAAAGGCCTCTTTTCATAGGAGCCCCTTCTTTCAAGCTTCTTGCCAGTTAGACTGGGCCTCCCCAGCCAG
GCTGCCTAGTAAGATTCTCCTGTATTTCAGGTGAAGCTGGAGCTCAGATCGCAGCAAGGTAATCCTTGATGGCTGGATCTTTTTGCTGGA
GAATGCTTGGACTAGTGAGCAAGGTTGGAAACAGGGCCAGGTGCTTTAGCAGCATGGCTGCCTCTGAAGAGGAGTTGCTTGATTTTAGTG
GCTCAGAACTGCAATTTAATTCTTGTTCTTTGCACCTCTCTCTCCACCCCTTCTTTAACTTTTTGTTAGGGATTCACTCATGTTTCGTGT
GTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGA
CTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAG
GTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACA
GCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAG
GGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCA
ATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCC
ATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACT
GGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAA
ACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAG
GCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGC
TGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGG
AAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGA
CCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAA
CAAAATCCTTTCCAGAAGAGAAGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGT
TGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGG
ATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCA
GCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGC
AGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGC
TGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGG
CTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACT
GCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAA

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000394175_chr17_38068750_-_2610nt
CAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGG
CCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGTGTCGCCCGGCACAGTCTGGGGTCTGTGAGGATGATGAGAGGACACCTGCAC
AGCCGTGGCCCTTCCTGCCTACTCACCGGGCCCAAGGAGTCTCCTATCTCACGTCAGAACACTTCCTGGGTCAGGAAGACACCTGGAGAG
TCTCCCAGGCCATGGCAGCCCCACAGCAGCACCTCACTTATGGGAGTGTCTGTCTGCCTGCCCAGAATGATAAGTGACTGCTCCACCACT
GGCCAGCTGCTCTCAAGGAGGAAAGGCCTCTTTTCATAGGAGCCCCTTCTTTCAAGCTTCTTGCCAGTTAGACTGGGCCTCCCCAGCCAG
GCTGCCTAGTAAGATTCTCCTGTATTTCAGGTGAAGCTGGAGCTCAGATCGCAGCAAGGTAATCCTTGATGGCTGGATCTTTTTGCTGGA
GAATGCTTGGACTAGTGAGCAAGGTTGGAAACAGGGCCAGGTGCTTTAGCAGCATGGCTGCCTCTGAAGAGGAGTTGCTTGATTTTAGTG
GCTCAGAACTGCAATTTAATTCTTGTTCTTTGCACCTCTCTCTCCACCCCTTCTTTAACTTTTTGTTAGGGATTCACTCATGTTTCGTGT
GTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGA
CTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAG
GTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACA
GCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAG
GGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCA
ATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCC
ATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACT
GGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAA
ACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAG
GCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGC
TGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGG
AAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGA
CCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAGAAAGTCTTTGGGTTCGGAGG
ATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCC
TCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGG
ACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATG
CCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTG
TCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTG
TTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCTGGGTTT
TCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATTCTTTGA
TGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATTTCATACATGGACTTCTGATTAAAAGTGGCAGGTTGTGCATGTTAA

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000309481_chr17_38068750_-_2637nt
CAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGG
CCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGTGTCGCCCGGCACAGTCTGGGGTCTGTGAGGATGATGAGAGGACACCTGCAC
AGCCGTGGCCCTTCCTGCCTACTCACCGGGCCCAAGGAGTCTCCTATCTCACGTCAGAACACTTCCTGGGTCAGGAAGACACCTGGAGAG
TCTCCCAGGCCATGGCAGCCCCACAGCAGCACCTCACTTATGGGAGTGTCTGTCTGCCTGCCCAGAATGATAAGTGACTGCTCCACCACT
GGCCAGCTGCTCTCAAGGAGGAAAGGCCTCTTTTCATAGGAGCCCCTTCTTTCAAGCTTCTTGCCAGTTAGACTGGGCCTCCCCAGCCAG
GCTGCCTAGTAAGATTCTCCTGTATTTCAGGTGAAGCTGGAGCTCAGATCGCAGCAAGGTAATCCTTGATGGCTGGATCTTTTTGCTGGA
GAATGCTTGGACTAGTGAGCAAGGTTGGAAACAGGGCCAGGTGCTTTAGCAGCATGGCTGCCTCTGAAGAGGAGTTGCTTGATTTTAGTG
GCTCAGAACTGCAATTTAATTCTTGTTCTTTGCACCTCTCTCTCCACCCCTTCTTTAACTTTTTGTTAGGGATTCACTCATGTTTCGTGT
GTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGA
CTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAG
GTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACA
GCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAG
GGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCA
ATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCC
ATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACT
GGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAA
ACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAG
GCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGC
TGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGG
AAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGA
CCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAAGAAGGATGGTGCTTCATCCT
GTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGG
AGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCC
TGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTG
CAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTC
CTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGG
CACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGC
CCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTT
TAAAACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATTTCATACATGGACTTCTGA

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000520542_chr17_38068750_-_2647nt
CAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGG
CCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGTGTCGCCCGGCACAGTCTGGGGTCTGTGAGGATGATGAGAGGACACCTGCAC
AGCCGTGGCCCTTCCTGCCTACTCACCGGGCCCAAGGAGTCTCCTATCTCACGTCAGAACACTTCCTGGGTCAGGAAGACACCTGGAGAG
TCTCCCAGGCCATGGCAGCCCCACAGCAGCACCTCACTTATGGGAGTGTCTGTCTGCCTGCCCAGAATGATAAGTGACTGCTCCACCACT
GGCCAGCTGCTCTCAAGGAGGAAAGGCCTCTTTTCATAGGAGCCCCTTCTTTCAAGCTTCTTGCCAGTTAGACTGGGCCTCCCCAGCCAG
GCTGCCTAGTAAGATTCTCCTGTATTTCAGGTGAAGCTGGAGCTCAGATCGCAGCAAGGTAATCCTTGATGGCTGGATCTTTTTGCTGGA
GAATGCTTGGACTAGTGAGCAAGGTTGGAAACAGGGCCAGGTGCTTTAGCAGCATGGCTGCCTCTGAAGAGGAGTTGCTTGATTTTAGTG
GCTCAGAACTGCAATTTAATTCTTGTTCTTTGCACCTCTCTCTCCACCCCTTCTTTAACTTTTTGTTAGGGATTCACTCATGTTTCGTGT
GTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGA
CTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAG
GTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACA
GCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAG
GGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCA
ATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCC
ATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACT
GGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAA
ACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAG
GCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGC
TGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGG
AAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGA
CCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAA
CAAAATCCTTTCCAGAAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGAGTGTCCTCAAGG
ACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATCTAGAGCAAAGAG
TATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTGCTGGGGTCTTGG
TAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTGAGGCCCTGGAGA
AGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTCCTGACATGGACT
ATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCTCTGTCTCTTCCT
AACTACAAAAGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACCATCCTGTCACCA
GTGGGACCTCTTTAAAACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCCTGGATTTCATAC

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000418519_chr17_38068750_-_2674nt
CAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGG
CCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGTGTCGCCCGGCACAGTCTGGGGTCTGTGAGGATGATGAGAGGACACCTGCAC
AGCCGTGGCCCTTCCTGCCTACTCACCGGGCCCAAGGAGTCTCCTATCTCACGTCAGAACACTTCCTGGGTCAGGAAGACACCTGGAGAG
TCTCCCAGGCCATGGCAGCCCCACAGCAGCACCTCACTTATGGGAGTGTCTGTCTGCCTGCCCAGAATGATAAGTGACTGCTCCACCACT
GGCCAGCTGCTCTCAAGGAGGAAAGGCCTCTTTTCATAGGAGCCCCTTCTTTCAAGCTTCTTGCCAGTTAGACTGGGCCTCCCCAGCCAG
GCTGCCTAGTAAGATTCTCCTGTATTTCAGGTGAAGCTGGAGCTCAGATCGCAGCAAGGTAATCCTTGATGGCTGGATCTTTTTGCTGGA
GAATGCTTGGACTAGTGAGCAAGGTTGGAAACAGGGCCAGGTGCTTTAGCAGCATGGCTGCCTCTGAAGAGGAGTTGCTTGATTTTAGTG
GCTCAGAACTGCAATTTAATTCTTGTTCTTTGCACCTCTCTCTCCACCCCTTCTTTAACTTTTTGTTAGGGATTCACTCATGTTTCGTGT
GTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGA
CTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAG
GTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACA
GCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAG
GGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCA
ATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCC
ATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACT
GGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAA
ACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAG
GCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGC
TGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGG
AAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGA
CCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAATATTCATTTCAGGGGCAAAA
CAAAATCCTTTCCAGAAGAGAAGGATGGTGCTTCATCCTGTTTAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGT
TGGAGGACATGGAGAGTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGG
ATATTCGGCAGGATCTAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCA
GCCTTTTTAATGCTGCTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGC
AGCAGTTTGTGGCTGAGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGC
TGGCCAGCAGTCCTCCTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGG
CTGAGGGGCCTACCTCTGTCTCTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACT
GCCATCGCCACTACCATCCTGTCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAA

>In-frame_WHSC1_ENST00000382888_chr4_1957915_+_GSDMB_ENST00000394179_chr17_38068750_-_2659nt
CAGCTGTGTGAGAAGCCGGGCAGCCTCCTGCTCTGTGAAGGACCCTGCTGCGGAGCTTTCCACCTCGCCTGCCTTGGGCTTTCCCGGAGG
CCAGAAGGGAGGTTCACCTGCAGCGAGTGTGCCTCAGGTGTCGCCCGGCACAGTCTGGGGTCTGTGAGGATGATGAGAGGACACCTGCAC
AGCCGTGGCCCTTCCTGCCTACTCACCGGGCCCAAGGAGTCTCCTATCTCACGTCAGAACACTTCCTGGGTCAGGAAGACACCTGGAGAG
TCTCCCAGGCCATGGCAGCCCCACAGCAGCACCTCACTTATGGGAGTGTCTGTCTGCCTGCCCAGAATGATAAGTGACTGCTCCACCACT
GGCCAGCTGCTCTCAAGGAGGAAAGGCCTCTTTTCATAGGAGCCCCTTCTTTCAAGCTTCTTGCCAGTTAGACTGGGCCTCCCCAGCCAG
GCTGCCTAGTAAGATTCTCCTGTATTTCAGGTGAAGCTGGAGCTCAGATCGCAGCAAGGTAATCCTTGATGGCTGGATCTTTTTGCTGGA
GAATGCTTGGACTAGTGAGCAAGGTTGGAAACAGGGCCAGGTGCTTTAGCAGCATGGCTGCCTCTGAAGAGGAGTTGCTTGATTTTAGTG
GCTCAGAACTGCAATTTAATTCTTGTTCTTTGCACCTCTCTCTCCACCCCTTCTTTAACTTTTTGTTAGGGATTCACTCATGTTTCGTGT
GTAAAGAGAGCAAGACAGATGTTAAGCGCTGTGTGGTAACTCAGTGTGGAAAATTTTACCATGAGGCTTGTGTGAAAAAATACCCTCTGA
CTGTATTTGAGAGCCGAGGTTTCCGCTGCCCCCTCCACAGCTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAG
GTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGGCAGCAGGATGCTCAGTGATCGCCTCCAACA
GCATCATCTGCACTGCCCACTTCACTGCTCGGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAG
GGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACATCGAGATGCCTGACGGCAGCTGGTTCTGCA
ATGACTGCAGGGCTGGGAAGAAGCTGCACTTCCAGGATATCATTTGGGTGAAACTTGGGAACTACAGATGGTGGCCGGCAGAAGTTTGCC
ATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAAGCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACT
GGACGCATCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAGAGGGATCGGAAGAGTCTTCAAAA
ACGGTCAAAAGGCTGAGTTTCAAATTCTGGATAATGTAGACTCAACGGGAGAGTTGATAGTGAGATTACCCAAAGAAATAACAATTTCAG
GCAGTTTCCAGGGCTTCCACCATCAGAAAATCAAGATATCGGAGAACCGGATATCCCAGCAGTATCTGGCTACCCTTGAAAACAGGAAGC
TGAAGAGGGAACTACCCTTTTCATTCCGATCAATTAATACGAGAGAAAACCTGTATCTGGTGACAGAAACTCTGGAGACGGTAAAGGAGG
AAACCCTGAAAAGCGACCGGCAATATAAATTTTGGAGCCAGATCTCTCAGGGCCATCTCAGCTATAAACACAAGGGCCAAAGGGAAGTGA
CCATCCCCCCAAATCGGGTCCTGAGCTATCGAGTAAAGCAGCTTGTCTTCCCCAACAAGGAGACGATGAGTGCTGGTTTAGATATTCATT
TCAGGGGCAAAACAAAATCCTTTCCAGAAGGAAAGTCTTTGGGTTCGGAGGATTCCAGAAACATGAAGGAGAAGTTGGAGGACATGGAGA
GTGTCCTCAAGGACCTGACAGAGGAGAAGAGAAAAGATGTGCTAAACTCCCTCGCTAAGTGCCTCGGCAAGGAGGATATTCGGCAGGATC
TAGAGCAAAGAGTATCTGAGGTCCTGATTTCCGGGGAGCTACACATGGAGGACCCAGACAAGCCTCTCCTAAGCAGCCTTTTTAATGCTG
CTGGGGTCTTGGTAGAAGCGCGTGCAAAAGCCATTCTGGACTTCCTGGATGCCCTGCTAGAGCTGTCTGAAGAGCAGCAGTTTGTGGCTG
AGGCCCTGGAGAAGGGGACCCTTCCTCTGTTGAAGGACCAGGTGAAATCTGTCATGGAGCAGAACTGGGATGAGCTGGCCAGCAGTCCTC
CTGACATGGACTATGACCCTGAGGCACGAATTCTCTGTGCGCTGTATGTTGTTGTCTCTATCCTGCTGGAGCTGGCTGAGGGGCCTACCT
CTGTCTCTTCCTAACTACAAAAGCCCTTTCTCCCCACAAGCCTCTGGGTTTTCCCTTTACCAGTCTGTCCTCACTGCCATCGCCACTACC
ATCCTGTCACCAGTGGGACCTCTTTAAAACAAGCAGCCAACCATTCTTTGATGTATCCCATTCGCTCCATGTTAACATCCAAAACCAGCC


Top

FusionGenePPI for WHSC1_GSDMB


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
WHSC1AR, HDAC1, SIN3B, WHSC1, HDAC2, SIN3A, KDM1A, BRD4, SIRT7, HIST2H3C, IQGAP1, TIAM1, CTNNB1, MDC1, APP, LSM1, TRIM28, HIST3H3, HIST1H3A, ESR1, RPL14, RPL8, ZC3H3, PRR11, RBM4B, GEMIN4, GEMIN5, DDX20, GOLGA3, MYBBP1A, PLEC, CCDC88C, RPL6, RBM10, PRPSAP2, THRAP3, RPLP0, PTPN13, SMN1, KIF11, WDR77, MYCBP2, MAP1B, SKIV2L2, IFI16, HIST1H4A, DTL, PCNA, CDC14B, WDR46, DGCR8, RPL30, HIST1H1E, PRDM5, ZNF2, CNBP, ZNF692, RPL28, RPL37A, RRP8, CPNE4, KNOP1, GLTSCR2, GPATCH4, ZC3HAV1, TRIM25GSDMBAPP, HIVEP1, ORM1, SERPINA1, IGFBP2, PEBP1, AGT, CLK1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for WHSC1_GSDMB


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for WHSC1_GSDMB


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneGSDMBC0004096Asthma1CTD_human