FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4180

FusionGeneSummary for BIRC2_YAP1

check button Fusion gene summary
Fusion gene informationFusion gene name: BIRC2_YAP1
Fusion gene ID: 4180
HgeneTgene
Gene symbol

BIRC2

YAP1

Gene ID

329

10413

Gene namebaculoviral IAP repeat containing 2Yes associated protein 1
SynonymsAPI1|HIAP2|Hiap-2|MIHB|RNF48|c-IAP1|cIAP1COB1|YAP|YAP2|YAP65|YKI
Cytomap

11q22.2

11q22.1

Type of geneprotein-codingprotein-coding
Descriptionbaculoviral IAP repeat-containing protein 2IAP homolog BIAP-2NFR2-TRAF signalling complex proteinRING finger protein 48RING-type E3 ubiquitin transferase BIRC2TNFR2-TRAF-signaling complex protein 2apoptosis inhibitor 1cellular inhibitor of apoptostranscriptional coactivator YAP165 kDa Yes-associated proteinprotein yorkie homologyes-associated protein 1yes-associated protein 2yes-associated protein YAP65 homologyorkie homolog
Modification date2018052320180527
UniProtAcc

Q13490

P46937

Ensembl transtripts involved in fusion geneENST00000530675, ENST00000227758, 
ENST00000532672, ENST00000527910, 
ENST00000526343, ENST00000282441, 
ENST00000537274, ENST00000345877, 
ENST00000531439, ENST00000524575, 
ENST00000528834, 
Fusion gene scores* DoF score3 X 3 X 3=2713 X 7 X 11=1001
# samples 313
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(13/1001*10)=-2.94485844580754
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: BIRC2 [Title/Abstract] AND YAP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneBIRC2

GO:0000209

protein polyubiquitination

11907583

HgeneBIRC2

GO:0043066

negative regulation of apoptotic process

21525013

HgeneBIRC2

GO:0043161

proteasome-mediated ubiquitin-dependent protein catabolic process

11907583

HgeneBIRC2

GO:0051726

regulation of cell cycle

15665297

HgeneBIRC2

GO:1902523

positive regulation of protein K63-linked ubiquitination

21931591

HgeneBIRC2

GO:1902524

positive regulation of protein K48-linked ubiquitination

21931591

HgeneBIRC2

GO:1902527

positive regulation of protein monoubiquitination

21931591

TgeneYAP1

GO:0006974

cellular response to DNA damage stimulus

18280240

TgeneYAP1

GO:0008283

cell proliferation

17974916

TgeneYAP1

GO:0032570

response to progesterone

16772533

TgeneYAP1

GO:0033148

positive regulation of intracellular estrogen receptor signaling pathway

16772533

TgeneYAP1

GO:0045893

positive regulation of transcription, DNA-templated

20368466

TgeneYAP1

GO:0045944

positive regulation of transcription by RNA polymerase II

25796446

TgeneYAP1

GO:0050767

regulation of neurogenesis

25433207

TgeneYAP1

GO:0050847

progesterone receptor signaling pathway

16772533

TgeneYAP1

GO:0060242

contact inhibition

17974916

TgeneYAP1

GO:0065003

protein-containing complex assembly

20368466

TgeneYAP1

GO:0071480

cellular response to gamma radiation

18280240

TgeneYAP1

GO:0072091

regulation of stem cell proliferation

25433207


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-CG-4443-01ABIRC2chr11

102221674

+YAP1chr11

102033187

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000530675ENST00000526343BIRC2chr11

102221674

+YAP1chr11

102033187

+
In-frameENST00000530675ENST00000282441BIRC2chr11

102221674

+YAP1chr11

102033187

+
In-frameENST00000530675ENST00000537274BIRC2chr11

102221674

+YAP1chr11

102033187

+
In-frameENST00000530675ENST00000345877BIRC2chr11

102221674

+YAP1chr11

102033187

+
In-frameENST00000530675ENST00000531439BIRC2chr11

102221674

+YAP1chr11

102033187

+
In-frameENST00000530675ENST00000524575BIRC2chr11

102221674

+YAP1chr11

102033187

+
5CDS-intronENST00000530675ENST00000528834BIRC2chr11

102221674

+YAP1chr11

102033187

+
In-frameENST00000227758ENST00000526343BIRC2chr11

102221674

+YAP1chr11

102033187

+
In-frameENST00000227758ENST00000282441BIRC2chr11

102221674

+YAP1chr11

102033187

+
In-frameENST00000227758ENST00000537274BIRC2chr11

102221674

+YAP1chr11

102033187

+
In-frameENST00000227758ENST00000345877BIRC2chr11

102221674

+YAP1chr11

102033187

+
In-frameENST00000227758ENST00000531439BIRC2chr11

102221674

+YAP1chr11

102033187

+
In-frameENST00000227758ENST00000524575BIRC2chr11

102221674

+YAP1chr11

102033187

+
5CDS-intronENST00000227758ENST00000528834BIRC2chr11

102221674

+YAP1chr11

102033187

+
In-frameENST00000532672ENST00000526343BIRC2chr11

102221674

+YAP1chr11

102033187

+
In-frameENST00000532672ENST00000282441BIRC2chr11

102221674

+YAP1chr11

102033187

+
In-frameENST00000532672ENST00000537274BIRC2chr11

102221674

+YAP1chr11

102033187

+
In-frameENST00000532672ENST00000345877BIRC2chr11

102221674

+YAP1chr11

102033187

+
In-frameENST00000532672ENST00000531439BIRC2chr11

102221674

+YAP1chr11

102033187

+
In-frameENST00000532672ENST00000524575BIRC2chr11

102221674

+YAP1chr11

102033187

+
5CDS-intronENST00000532672ENST00000528834BIRC2chr11

102221674

+YAP1chr11

102033187

+
3UTR-3CDSENST00000527910ENST00000526343BIRC2chr11

102221674

+YAP1chr11

102033187

+
3UTR-3CDSENST00000527910ENST00000282441BIRC2chr11

102221674

+YAP1chr11

102033187

+
3UTR-3CDSENST00000527910ENST00000537274BIRC2chr11

102221674

+YAP1chr11

102033187

+
3UTR-3CDSENST00000527910ENST00000345877BIRC2chr11

102221674

+YAP1chr11

102033187

+
3UTR-3CDSENST00000527910ENST00000531439BIRC2chr11

102221674

+YAP1chr11

102033187

+
3UTR-3CDSENST00000527910ENST00000524575BIRC2chr11

102221674

+YAP1chr11

102033187

+
3UTR-intronENST00000527910ENST00000528834BIRC2chr11

102221674

+YAP1chr11

102033187

+

Top

FusionProtFeatures for BIRC2_YAP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BIRC2

Q13490

YAP1

P46937

Multi-functional protein which regulates not onlycaspases and apoptosis, but also modulates inflammatory signalingand immunity, mitogenic kinase signaling, and cell proliferation,as well as cell invasion and metastasis. Acts as an E3 ubiquitin-protein ligase regulating NF-kappa-B signaling and regulates bothcanonical and non-canonical NF-kappa-B signaling by acting inopposite directions: acts as a positive regulator of the canonicalpathway and suppresses constitutive activation of non-canonicalNF-kappa-B signaling. The target proteins for its E3 ubiquitin-protein ligase activity include: RIPK1, RIPK2, RIPK3, RIPK4,CASP3, CASP7, CASP8, TRAF2, DIABLO/SMAC, MAP3K14/NIK, MAP3K5/ASK1,IKBKG/NEMO, IKBKE and MXD1/MAD1. Can also function as an E3ubiquitin-protein ligase of the NEDD8 conjugation pathway,targeting effector caspases for neddylation and inactivation. Actsas an important regulator of innate immune signaling viaregulation of Toll-like receptors (TLRs), Nodlike receptors (NLRs)and RIG-I like receptors (RLRs), collectively referred to aspattern recognition receptors (PRRs). Protects cells fromspontaneous formation of the ripoptosome, a large multi-proteincomplex that has the capability to kill cancer cells in a caspase-dependent and caspase-independent manner. Suppresses ripoptosomeformation by ubiquitinating RIPK1 and CASP8. Can stimulate thetranscriptional activity of E2F1. Plays a role in the modulationof the cell cycle. {ECO:0000269|PubMed:15665297,ECO:0000269|PubMed:18082613, ECO:0000269|PubMed:21145488,ECO:0000269|PubMed:21653699, ECO:0000269|PubMed:21931591,ECO:0000269|PubMed:23453969}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBIRC2chr11:102221674chr11:102033187ENST00000227758+39184_250331619RepeatNote=BIR 2
HgeneBIRC2chr11:102221674chr11:102033187ENST00000227758+3946_113331619RepeatNote=BIR 1
HgeneBIRC2chr11:102221674chr11:102033187ENST00000530675+39184_250282570RepeatNote=BIR 2
HgeneBIRC2chr11:102221674chr11:102033187ENST00000530675+3946_113282570RepeatNote=BIR 1
TgeneYAP1chr11:102221674chr11:102033187ENST00000282441+19298_359190505Coiled coilOntology_term=ECO:0000255
TgeneYAP1chr11:102221674chr11:102033187ENST00000345877+17298_359190455Coiled coilOntology_term=ECO:0000255
TgeneYAP1chr11:102221674chr11:102033187ENST00000524575+19298_35912327Coiled coilOntology_term=ECO:0000255
TgeneYAP1chr11:102221674chr11:102033187ENST00000524575+1986_10012327Coiled coilOntology_term=ECO:0000269
TgeneYAP1chr11:102221674chr11:102033187ENST00000526343+17298_359190451Coiled coilOntology_term=ECO:0000255
TgeneYAP1chr11:102221674chr11:102033187ENST00000531439+18298_359190489Coiled coilOntology_term=ECO:0000255
TgeneYAP1chr11:102221674chr11:102033187ENST00000537274+18298_359190493Coiled coilOntology_term=ECO:0000255
TgeneYAP1chr11:102221674chr11:102033187ENST00000282441+19230_263190505DomainWW 2
TgeneYAP1chr11:102221674chr11:102033187ENST00000345877+17230_263190455DomainWW 2
TgeneYAP1chr11:102221674chr11:102033187ENST00000524575+19171_20412327DomainWW 1
TgeneYAP1chr11:102221674chr11:102033187ENST00000524575+19230_26312327DomainWW 2
TgeneYAP1chr11:102221674chr11:102033187ENST00000526343+17230_263190451DomainWW 2
TgeneYAP1chr11:102221674chr11:102033187ENST00000531439+18230_263190489DomainWW 2
TgeneYAP1chr11:102221674chr11:102033187ENST00000537274+18230_263190493DomainWW 2
TgeneYAP1chr11:102221674chr11:102033187ENST00000282441+19291_504190505RegionNote=Transactivation domain
TgeneYAP1chr11:102221674chr11:102033187ENST00000345877+17291_504190455RegionNote=Transactivation domain
TgeneYAP1chr11:102221674chr11:102033187ENST00000524575+19291_50412327RegionNote=Transactivation domain
TgeneYAP1chr11:102221674chr11:102033187ENST00000526343+17291_504190451RegionNote=Transactivation domain
TgeneYAP1chr11:102221674chr11:102033187ENST00000531439+18291_504190489RegionNote=Transactivation domain
TgeneYAP1chr11:102221674chr11:102033187ENST00000537274+18291_504190493RegionNote=Transactivation domain

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBIRC2chr11:102221674chr11:102033187ENST00000227758+39453_543331619DomainCARD
HgeneBIRC2chr11:102221674chr11:102033187ENST00000530675+39453_543282570DomainCARD
HgeneBIRC2chr11:102221674chr11:102033187ENST00000227758+39269_336331619RepeatNote=BIR 3
HgeneBIRC2chr11:102221674chr11:102033187ENST00000530675+39269_336282570RepeatNote=BIR 3
HgeneBIRC2chr11:102221674chr11:102033187ENST00000227758+39571_606331619Zinc fingerRING-type
HgeneBIRC2chr11:102221674chr11:102033187ENST00000530675+39571_606282570Zinc fingerRING-type
TgeneYAP1chr11:102221674chr11:102033187ENST00000282441+1986_100190505Coiled coilOntology_term=ECO:0000269
TgeneYAP1chr11:102221674chr11:102033187ENST00000345877+1786_100190455Coiled coilOntology_term=ECO:0000269
TgeneYAP1chr11:102221674chr11:102033187ENST00000526343+1786_100190451Coiled coilOntology_term=ECO:0000269
TgeneYAP1chr11:102221674chr11:102033187ENST00000531439+1886_100190489Coiled coilOntology_term=ECO:0000269
TgeneYAP1chr11:102221674chr11:102033187ENST00000537274+1886_100190493Coiled coilOntology_term=ECO:0000269
TgeneYAP1chr11:102221674chr11:102033187ENST00000282441+193_49190505Compositional biasNote=Pro-rich
TgeneYAP1chr11:102221674chr11:102033187ENST00000345877+173_49190455Compositional biasNote=Pro-rich
TgeneYAP1chr11:102221674chr11:102033187ENST00000524575+193_4912327Compositional biasNote=Pro-rich
TgeneYAP1chr11:102221674chr11:102033187ENST00000526343+173_49190451Compositional biasNote=Pro-rich
TgeneYAP1chr11:102221674chr11:102033187ENST00000531439+183_49190489Compositional biasNote=Pro-rich
TgeneYAP1chr11:102221674chr11:102033187ENST00000537274+183_49190493Compositional biasNote=Pro-rich
TgeneYAP1chr11:102221674chr11:102033187ENST00000282441+19171_204190505DomainWW 1
TgeneYAP1chr11:102221674chr11:102033187ENST00000345877+17171_204190455DomainWW 1
TgeneYAP1chr11:102221674chr11:102033187ENST00000526343+17171_204190451DomainWW 1
TgeneYAP1chr11:102221674chr11:102033187ENST00000531439+18171_204190489DomainWW 1
TgeneYAP1chr11:102221674chr11:102033187ENST00000537274+18171_204190493DomainWW 1


Top

FusionGeneSequence for BIRC2_YAP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000526343_chr11_102033187_+_543aa
MSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLTPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSL
SPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTAMSTEEARFLTYHMWPLTFLSPSELARAGFTTIGPGDRVACFACGGKLSN
WEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFTTVGRNDDVKCFCCDGGLRCWESG
DDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQM
RLQQLQMEKERLRLKQQELLRQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTTHSRDESTDSGLSMSSYSVPRT
PDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLT

>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000282441_chr11_102033187_+_597aa
MSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLTPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSL
SPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTAMSTEEARFLTYHMWPLTFLSPSELARAGFTTIGPGDRVACFACGGKLSN
WEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFTTVGRNDDVKCFCCDGGLRCWESG
DDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYTINHKNKTTSWLDPRLDPRFA
MNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQD
GGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAI

>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000537274_chr11_102033187_+_585aa
MSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLTPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSL
SPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTAMSTEEARFLTYHMWPLTFLSPSELARAGFTTIGPGDRVACFACGGKLSN
WEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFTTVGRNDDVKCFCCDGGLRCWESG
DDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYTINHKNKTTSWLDPRLDPRFA
MNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQVRPQELALRSQLPTLEQDGGTQNPVSSPGM
SQELRTMTTNSSDPFLNSGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEG

>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000345877_chr11_102033187_+_547aa
MSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLTPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSL
SPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTAMSTEEARFLTYHMWPLTFLSPSELARAGFTTIGPGDRVACFACGGKLSN
WEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFTTVGRNDDVKCFCCDGGLRCWESG
DDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQM
RLQQLQMEKERLRLKQQELLRQVRPQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTTHSRDESTDSGLSMSSYS
VPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKE

>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000531439_chr11_102033187_+_581aa
MSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLTPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSL
SPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTAMSTEEARFLTYHMWPLTFLSPSELARAGFTTIGPGDRVACFACGGKLSN
WEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFTTVGRNDDVKCFCCDGGLRCWESG
DDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYTINHKNKTTSWLDPRLDPRFA
MNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQELALRSQLPTLEQDGGTQNPVSSPGMSQEL
RTMTTNSSDPFLNSGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMN

>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000524575_chr11_102033187_+_597aa
MSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLTPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSL
SPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTAMSTEEARFLTYHMWPLTFLSPSELARAGFTTIGPGDRVACFACGGKLSN
WEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFTTVGRNDDVKCFCCDGGLRCWESG
DDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYTINHKNKTTSWLDPRLDPRFA
MNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQD
GGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAI

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000526343_chr11_102033187_+_592aa
MHKTASQRLFPGPSTQNIKSIMEDSTILSDWTNSNKQKMKTDFSCELYRMSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLML
DNWKLGDSPIQKHKQLTPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTA
MSTEEARFLTYHMWPLTFLSPSELARAGFTTIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHA
ARMRTFMYWPSSVPVQPEQLASAGFTTVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPP
VQQNMMNSASAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQELALRSQLPTLEQDGGTQN
PVSSPGMSQELRTMTTNSSDPFLNSGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNV

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000282441_chr11_102033187_+_646aa
MHKTASQRLFPGPSTQNIKSIMEDSTILSDWTNSNKQKMKTDFSCELYRMSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLML
DNWKLGDSPIQKHKQLTPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTA
MSTEEARFLTYHMWPLTFLSPSELARAGFTTIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHA
ARMRTFMYWPSSVPVQPEQLASAGFTTVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPP
VQQNMMNSASGPLPDGWEQAMTQDGEIYTINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQ
QLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTTHSRDESTD
SGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESV

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000537274_chr11_102033187_+_634aa
MHKTASQRLFPGPSTQNIKSIMEDSTILSDWTNSNKQKMKTDFSCELYRMSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLML
DNWKLGDSPIQKHKQLTPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTA
MSTEEARFLTYHMWPLTFLSPSELARAGFTTIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHA
ARMRTFMYWPSSVPVQPEQLASAGFTTVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPP
VQQNMMNSASGPLPDGWEQAMTQDGEIYTINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQ
QLQMEKERLRLKQQELLRQVRPQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTTHSRDESTDSGLSMSSYSVPR
TPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFL

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000345877_chr11_102033187_+_596aa
MHKTASQRLFPGPSTQNIKSIMEDSTILSDWTNSNKQKMKTDFSCELYRMSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLML
DNWKLGDSPIQKHKQLTPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTA
MSTEEARFLTYHMWPLTFLSPSELARAGFTTIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHA
ARMRTFMYWPSSVPVQPEQLASAGFTTVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPP
VQQNMMNSASAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQVRPQELALRSQLPTLEQDG
GTQNPVSSPGMSQELRTMTTNSSDPFLNSGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIP

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000531439_chr11_102033187_+_630aa
MHKTASQRLFPGPSTQNIKSIMEDSTILSDWTNSNKQKMKTDFSCELYRMSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLML
DNWKLGDSPIQKHKQLTPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTA
MSTEEARFLTYHMWPLTFLSPSELARAGFTTIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHA
ARMRTFMYWPSSVPVQPEQLASAGFTTVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPP
VQQNMMNSASGPLPDGWEQAMTQDGEIYTINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQ
QLQMEKERLRLKQQELLRQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTTHSRDESTDSGLSMSSYSVPRTPDD
FLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL_

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000524575_chr11_102033187_+_646aa
MHKTASQRLFPGPSTQNIKSIMEDSTILSDWTNSNKQKMKTDFSCELYRMSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLML
DNWKLGDSPIQKHKQLTPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTA
MSTEEARFLTYHMWPLTFLSPSELARAGFTTIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHA
ARMRTFMYWPSSVPVQPEQLASAGFTTVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPP
VQQNMMNSASGPLPDGWEQAMTQDGEIYTINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQ
QLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTTHSRDESTD
SGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESV

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000526343_chr11_102033187_+_571aa
MEDSTILSDWTNSNKQKMKTDFSCELYRMSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLTPSCS
FIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTAMSTEEARFLTYHMWPLTFLSP
SELARAGFTTIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLA
SAGFTTVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASAMNQRISQSAP
VKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDP
FLNSGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSL

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000282441_chr11_102033187_+_625aa
MEDSTILSDWTNSNKQKMKTDFSCELYRMSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLTPSCS
FIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTAMSTEEARFLTYHMWPLTFLSP
SELARAGFTTIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLA
SAGFTTVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAM
TQDGEIYTINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAM
RNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSV

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000537274_chr11_102033187_+_613aa
MEDSTILSDWTNSNKQKMKTDFSCELYRMSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLTPSCS
FIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTAMSTEEARFLTYHMWPLTFLSP
SELARAGFTTIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLA
SAGFTTVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAM
TQDGEIYTINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQVR
PQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQS

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000345877_chr11_102033187_+_575aa
MEDSTILSDWTNSNKQKMKTDFSCELYRMSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLTPSCS
FIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTAMSTEEARFLTYHMWPLTFLSP
SELARAGFTTIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLA
SAGFTTVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASAMNQRISQSAP
VKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQVRPQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTN
SSDPFLNSGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEEL

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000531439_chr11_102033187_+_609aa
MEDSTILSDWTNSNKQKMKTDFSCELYRMSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLTPSCS
FIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTAMSTEEARFLTYHMWPLTFLSP
SELARAGFTTIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLA
SAGFTTVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAM
TQDGEIYTINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQEL
ALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPS

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000524575_chr11_102033187_+_625aa
MEDSTILSDWTNSNKQKMKTDFSCELYRMSTTSTFPAGVPVSERSLARAGFTTTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLTPSCS
FIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSTAMSTEEARFLTYHMWPLTFLSP
SELARAGFTTIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLA
SAGFTTVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPSHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAM
TQDGEIYTINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAM
RNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000526343_chr11_102033187_+_1629nt
ATGTCTACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGAC
AAGGTCAAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGC
TGTAGCTTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTA
TCTCCCACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATC
TCTTCATCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTG
TCACCATCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAAC
TGGGAACCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTT
AGCATTTCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAG
CTTGCAAGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGA
GATGATCCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCC
CAGATGAACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGCCATGAACCAGAGAATCAGTCAGAGT
GCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATG
CGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGAGTTAGCCCTGCGTAGCCAGTTA
CCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCA
GATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACC
CCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCA
GACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCA
AGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACA

>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000282441_chr11_102033187_+_1791nt
ATGTCTACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGAC
AAGGTCAAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGC
TGTAGCTTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTA
TCTCCCACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATC
TCTTCATCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTG
TCACCATCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAAC
TGGGAACCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTT
AGCATTTCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAG
CTTGCAAGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGA
GATGATCCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCC
CAGATGAACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAA
GCCATGACTCAGGATGGAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCC
ATGAACCAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGC
AACTCCAACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAG
GCAATGCGGAATATCAATCCCAGCACAGCAAATTCTCCAAAATGTCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGAT
GGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGT
GGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAAC
AGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATT
CCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTG

>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000537274_chr11_102033187_+_1755nt
ATGTCTACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGAC
AAGGTCAAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGC
TGTAGCTTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTA
TCTCCCACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATC
TCTTCATCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTG
TCACCATCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAAC
TGGGAACCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTT
AGCATTTCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAG
CTTGCAAGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGA
GATGATCCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCC
CAGATGAACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAA
GCCATGACTCAGGATGGAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCC
ATGAACCAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGC
AACTCCAACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAG
GTGAGGCCACAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATG
TCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGT
GGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAAC
CAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGA
GATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTG

>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000345877_chr11_102033187_+_1641nt
ATGTCTACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGAC
AAGGTCAAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGC
TGTAGCTTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTA
TCTCCCACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATC
TCTTCATCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTG
TCACCATCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAAC
TGGGAACCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTT
AGCATTTCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAG
CTTGCAAGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGA
GATGATCCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCC
CAGATGAACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGCCATGAACCAGAGAATCAGTCAGAGT
GCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATG
CGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGTGAGGCCACAGGAGTTAGCCCTG
CGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACG
ACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGT
GTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAG
AACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAG
GAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAA

>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000531439_chr11_102033187_+_1743nt
ATGTCTACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGAC
AAGGTCAAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGC
TGTAGCTTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTA
TCTCCCACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATC
TCTTCATCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTG
TCACCATCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAAC
TGGGAACCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTT
AGCATTTCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAG
CTTGCAAGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGA
GATGATCCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCC
CAGATGAACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAA
GCCATGACTCAGGATGGAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCC
ATGAACCAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGC
AACTCCAACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAG
GAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTG
AGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATG
AGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTG
CCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAAC
ATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAG

>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000524575_chr11_102033187_+_1791nt
ATGTCTACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGAC
AAGGTCAAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGC
TGTAGCTTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTA
TCTCCCACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATC
TCTTCATCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTG
TCACCATCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAAC
TGGGAACCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTT
AGCATTTCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAG
CTTGCAAGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGA
GATGATCCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCC
CAGATGAACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAA
GCCATGACTCAGGATGGAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCC
ATGAACCAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGC
AACTCCAACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAG
GCAATGCGGAATATCAATCCCAGCACAGCAAATTCTCCAAAATGTCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGAT
GGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGT
GGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAAC
AGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATT
CCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTG

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000526343_chr11_102033187_+_1776nt
ATGCACAAAACTGCCTCCCAAAGACTTTTCCCAGGTCCCTCGTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTCAGAT
TGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGGGGTG
CCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGATGCTG
GATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGCTAGT
CTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTTCAGT
GGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTATGCA
ATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTTTTAT
TATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGAACAC
CGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACATGCA
GCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGGTCGC
AATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTGGTTT
CCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCCACCA
GTGCAGCAGAATATGATGAACTCGGCTTCAGCCATGAACCAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCC
CAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGG
CTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAAT
CCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCT
CGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATG
GATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTG
GACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTT

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000282441_chr11_102033187_+_1938nt
ATGCACAAAACTGCCTCCCAAAGACTTTTCCCAGGTCCCTCGTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTCAGAT
TGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGGGGTG
CCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGATGCTG
GATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGCTAGT
CTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTTCAGT
GGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTATGCA
ATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTTTTAT
TATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGAACAC
CGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACATGCA
GCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGGTCGC
AATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTGGTTT
CCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCCACCA
GTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATGACTCAGGATGGAGAAATTTACTATATA
AACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCCATGAACCAGAGAATCAGTCAGAGTGCTCCAGTG
AAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACTGCAG
CAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGCAATGCGGAATATCAATCCCAGCACAGCAAAT
TCTCCAAAATGTCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGG
ATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGAC
AGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATC
AACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAA
GGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTT

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000537274_chr11_102033187_+_1902nt
ATGCACAAAACTGCCTCCCAAAGACTTTTCCCAGGTCCCTCGTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTCAGAT
TGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGGGGTG
CCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGATGCTG
GATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGCTAGT
CTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTTCAGT
GGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTATGCA
ATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTTTTAT
TATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGAACAC
CGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACATGCA
GCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGGTCGC
AATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTGGTTT
CCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCCACCA
GTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATGACTCAGGATGGAGAAATTTACTATATA
AACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCCATGAACCAGAGAATCAGTCAGAGTGCTCCAGTG
AAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACTGCAG
CAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGTGAGGCCACAGGAGTTAGCCCTGCGTAGCCAG
TTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGC
TCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGA
ACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTC
CCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATG
CCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTT

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000345877_chr11_102033187_+_1788nt
ATGCACAAAACTGCCTCCCAAAGACTTTTCCCAGGTCCCTCGTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTCAGAT
TGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGGGGTG
CCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGATGCTG
GATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGCTAGT
CTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTTCAGT
GGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTATGCA
ATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTTTTAT
TATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGAACAC
CGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACATGCA
GCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGGTCGC
AATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTGGTTT
CCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCCACCA
GTGCAGCAGAATATGATGAACTCGGCTTCAGCCATGAACCAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCC
CAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGG
CTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGTGAGGCCACAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGT
GGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGC
ACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGT
GTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCT
GGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGT

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000531439_chr11_102033187_+_1890nt
ATGCACAAAACTGCCTCCCAAAGACTTTTCCCAGGTCCCTCGTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTCAGAT
TGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGGGGTG
CCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGATGCTG
GATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGCTAGT
CTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTTCAGT
GGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTATGCA
ATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTTTTAT
TATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGAACAC
CGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACATGCA
GCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGGTCGC
AATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTGGTTT
CCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCCACCA
GTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATGACTCAGGATGGAGAAATTTACTATATA
AACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCCATGAACCAGAGAATCAGTCAGAGTGCTCCAGTG
AAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACTGCAG
CAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTG
GAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTC
CTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGAC
TTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTT
GAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAG
GAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAG

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000524575_chr11_102033187_+_1938nt
ATGCACAAAACTGCCTCCCAAAGACTTTTCCCAGGTCCCTCGTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTCAGAT
TGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGGGGTG
CCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGATGCTG
GATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGCTAGT
CTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTTCAGT
GGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTATGCA
ATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTTTTAT
TATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGAACAC
CGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACATGCA
GCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGGTCGC
AATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTGGTTT
CCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCCACCA
GTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATGACTCAGGATGGAGAAATTTACTATATA
AACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCCATGAACCAGAGAATCAGTCAGAGTGCTCCAGTG
AAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACTGCAG
CAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGCAATGCGGAATATCAATCCCAGCACAGCAAAT
TCTCCAAAATGTCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGG
ATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGAC
AGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATC
AACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAA
GGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTT

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000526343_chr11_102033187_+_1713nt
ATGGAAGATAGCACGATCTTGTCAGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCT
ACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTC
AAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGC
TTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCC
ACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCA
TCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCA
TCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAA
CCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATT
TCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCA
AGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGAT
CCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATG
AACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGCCATGAACCAGAGAATCAGTCAGAGTGCTCCA
GTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACTG
CAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACA
CTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCT
TTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGAT
GACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTAC
CTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTG
CAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTA

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000282441_chr11_102033187_+_1875nt
ATGGAAGATAGCACGATCTTGTCAGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCT
ACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTC
AAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGC
TTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCC
ACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCA
TCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCA
TCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAA
CCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATT
TCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCA
AGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGAT
CCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATG
AACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATG
ACTCAGGATGGAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCCATGAAC
CAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCC
AACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGCAATG
CGGAATATCAATCCCAGCACAGCAAATTCTCCAAAATGTCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGG
ACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACC
TATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTG
GATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGG
ACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCT

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000537274_chr11_102033187_+_1839nt
ATGGAAGATAGCACGATCTTGTCAGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCT
ACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTC
AAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGC
TTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCC
ACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCA
TCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCA
TCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAA
CCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATT
TCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCA
AGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGAT
CCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATG
AACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATG
ACTCAGGATGGAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCCATGAAC
CAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCC
AACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGTGAGG
CCACAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAG
GAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTA
AGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGC
ACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGA
ATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCC

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000345877_chr11_102033187_+_1725nt
ATGGAAGATAGCACGATCTTGTCAGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCT
ACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTC
AAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGC
TTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCC
ACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCA
TCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCA
TCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAA
CCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATT
TCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCA
AGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGAT
CCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATG
AACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGCCATGAACCAGAGAATCAGTCAGAGTGCTCCA
GTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACTG
CAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGTGAGGCCACAGGAGTTAGCCCTGCGTAGC
CAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAAT
AGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCT
CGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGT
TTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTG
ATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTT

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000531439_chr11_102033187_+_1827nt
ATGGAAGATAGCACGATCTTGTCAGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCT
ACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTC
AAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGC
TTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCC
ACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCA
TCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCA
TCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAA
CCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATT
TCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCA
AGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGAT
CCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATG
AACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATG
ACTCAGGATGGAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCCATGAAC
CAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCC
AACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGAGTTA
GCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACA
ATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000524575_chr11_102033187_+_1875nt
ATGGAAGATAGCACGATCTTGTCAGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCT
ACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTC
AAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGC
TTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCC
ACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCA
TCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCA
TCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAA
CCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATT
TCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCA
AGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGAT
CCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATG
AACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATG
ACTCAGGATGGAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCCATGAAC
CAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCC
AACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGCAATG
CGGAATATCAATCCCAGCACAGCAAATTCTCCAAAATGTCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGG
ACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACC
TATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTG
GATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGG
ACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000526343_chr11_102033187_+_2445nt
ATCGTGCGTCAGAGTGAGCCCGGATGGGGCGGCGGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGC
GCCGCTGATTCCCGGCTCTGCGGAGGCCTCTAGGCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGAATGTCTACATATTCAA
CTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCT
GTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGA
ATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAAC
ATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTA
ACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGG
CAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATG
ATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGA
GCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTT
TTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAG
AACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAG
CCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGCCATGAACCAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGC
CACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACTGCAGCAACTGC
AGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGG
ATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACA
GTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGA
ACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCA
TTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTT
TGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTC
AGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATAC
AGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCT
CTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAA
GTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAG
ATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAA
GCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTAT
TTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAA

>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000282441_chr11_102033187_+_5438nt
ATCGTGCGTCAGAGTGAGCCCGGATGGGGCGGCGGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGC
GCCGCTGATTCCCGGCTCTGCGGAGGCCTCTAGGCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGAATGTCTACATATTCAA
CTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCT
GTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGA
ATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAAC
ATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTA
ACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGG
CAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATG
ATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGA
GCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTT
TTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAG
AACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAG
CCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATGACTCAGGATG
GAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCCATGAACCAGAGAATCA
GTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGC
AACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGCAATGCGGAATATCA
ATCCCAGCACAGCAAATTCTCCAAAATGTCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATC
CAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTC
GAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGG
ATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGG
ACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTA
ATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAA
ATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAAC
GTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTA
AAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGA
TGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCA
TTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCT
GATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTG
CTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCAC
ATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGG
GTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGA
TGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATA
TACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTA
AAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGAT
GTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATAT
TATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTA
GGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAA
ATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGC
TCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATT
GGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTAC
AGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTG
GTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCAT
AACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATC
TAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAA
TCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAAT
CTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATG
AATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAG
ATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGG
GACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTT
TCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGT
TGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTT
TTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGG
GTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTAC
ATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTAT
TTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAA
GTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATAC
CAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAG
TGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAG
TATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTA
TTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAATACCTTTTTGTTT

>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000537274_chr11_102033187_+_5402nt
ATCGTGCGTCAGAGTGAGCCCGGATGGGGCGGCGGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGC
GCCGCTGATTCCCGGCTCTGCGGAGGCCTCTAGGCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGAATGTCTACATATTCAA
CTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCT
GTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGA
ATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAAC
ATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTA
ACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGG
CAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATG
ATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGA
GCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTT
TTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAG
AACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAG
CCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATGACTCAGGATG
GAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCCATGAACCAGAGAATCA
GTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGC
AACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGTGAGGCCACAGGAGT
TAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAA
CAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCA
GCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCT
CACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAG
AAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAG
ATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAA
ATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTT
CCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGC
TATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACC
AATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTT
TGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGC
TGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTT
AGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGG
GTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTC
GGAACCTAGGCAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTC
CTGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGT
GTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGA
CTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTA
CTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGG
CTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAG
TGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACAT
TAACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAA
TACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCAT
GATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAA
GGAACAAAACGAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGT
GTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGC
TATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAA
AGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCA
CTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGA
TGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGT
GCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTT
TAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTT
TAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAAT
ATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGA
TCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGT
TTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTG
AATTGCTTTTACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTA
CTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAA
AGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACA
TGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGG
TGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTT
ATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAAT
TCTTTAATGCACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTT
AGGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAATACCTTTTTGTTTGTTTATGTGGTTCAAATATATTCTTTCCTTAAACTC

>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000345877_chr11_102033187_+_5288nt
ATCGTGCGTCAGAGTGAGCCCGGATGGGGCGGCGGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGC
GCCGCTGATTCCCGGCTCTGCGGAGGCCTCTAGGCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGAATGTCTACATATTCAA
CTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCT
GTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGA
ATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAAC
ATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTA
ACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGG
CAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATG
ATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGA
GCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTT
TTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAG
AACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAG
CCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGCCATGAACCAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGC
CACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACTGCAGCAACTGC
AGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGTGAGGCCACAGGAGTTAGCCCTGCGTAGCCAGTTACCAA
CACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATC
CTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAG
ATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACT
ACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTC
TGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGT
TATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTT
TCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATG
TATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGG
GGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGA
CTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTA
CTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTT
TACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAA
TTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTGTT
GGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATT
AGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTATTT
AAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTT
TAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGGTA
GTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTG
CTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTAAT
TTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGG
AAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTGCC
TTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTG
GAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAGGA
AGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAAC
TCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTTTC
TAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAG
ATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTATTT
TAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCT
TTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGAAA
TTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAA
GGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAG
TTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGT
GCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCTCA
ACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGAC
CTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGTAA
AAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATT
TTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATTGA
TTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTG
ACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAACA
GTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACT
TTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTATC
ATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATA
TATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTACAT

>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000531439_chr11_102033187_+_1930nt
ATCGTGCGTCAGAGTGAGCCCGGATGGGGCGGCGGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGC
GCCGCTGATTCCCGGCTCTGCGGAGGCCTCTAGGCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGAATGTCTACATATTCAA
CTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCT
GTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGA
ATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAAC
ATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTA
ACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGG
CAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATG
ATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGA
GCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTT
TTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAG
AACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAG
CCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATGACTCAGGATG
GAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCCATGAACCAGAGAATCA
GTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGC
AACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGAGTTAGCCCTGCGTA
GCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCA
ATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCC
CTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACC
GTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGC
TGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCT

>In-frame_BIRC2_ENST00000530675_chr11_102221674_+_YAP1_ENST00000524575_chr11_102033187_+_2167nt
ATCGTGCGTCAGAGTGAGCCCGGATGGGGCGGCGGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGC
GCCGCTGATTCCCGGCTCTGCGGAGGCCTCTAGGCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGAATGTCTACATATTCAA
CTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCT
GTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGA
ATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAAC
ATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTA
ACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGG
CAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATG
ATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGA
GCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTT
TTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAG
AACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAG
CCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATGACTCAGGATG
GAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCCATGAACCAGAGAATCA
GTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGC
AACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGCAATGCGGAATATCA
ATCCCAGCACAGCAAATTCTCCAAAATGTCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATC
CAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTC
GAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGG
ATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGG
ACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTA
ATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAA
ATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAAC
GTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTA

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000526343_chr11_102033187_+_3827nt
GGATGGGGCGGCGGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGCGCCGCTGATTCCCGGCTCTGC
GGAGGCCTCTAGGCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGATTTACAACCCTGAAGAATCTCCCTATCCCTATTTTGT
CCCCCTGCAGTAATAAATCCCATTATGGAGATCTCGAAACTTTATAAAGGGATATAGTTTGAATTCTATGGAGTGTAATTTTGTGTATGA
ATTATATTTTTAAAACATTGAAGAGTTTTCAGAAAGAAGGCTAGTAGAGTTGATTACTGATACTTTATGCTAAGCAGTACTTTTTTGGTA
GTACAATATTTTGTTAGGCGTTTCTGATAACACTAGAAAGGACAAGTTTTATCTTGTGATAAATTGATTAATGTTTACAACATGACTGAT
AATTATAGCTGAATAGTCCTTAAATGATGAACAGGTTATTTAGTTTTTAAATGCAGTGTAAAAAGTGTGCTGTGGAAATTTTATGGCTAA
CTAAGTTTATGGAGAAAATACCTTCAGTTGATCAAGAATAATAGTGGTATACAAAGTTAGGAAGAAAGTCAACATGATGCTGCAGGAAAT
GGAAACAAATACAAATGATATTTAACAAAGATAGAGTTTACAGTTTTTGAACTTTAAGCCAAATTCATTTGACATCAAGCACTATAGCAG
GCACAGGTTCAACAAAGCTTGTGGGTATTGACTTCCCCCAAAAGTTGTCAGCTGAAGTAATTTAGCCCACTTAAGTAAATACTATGATGA
TAAGCTGTGTGAACTTAGCTTTTAAATAGTGTGACCATATGAAGGTTTTAATTACTTTTGTTTATTGGAATAAAATGAGATTTTTTGGGT
TGTCATGTTAAAGTGCTTATAGGGAAAGAAGCCTGCATATAATTTTTTACCTTGTGGCATAATCAGTAATTGGTCTGTTATTCAGGCTTC
ATAGCTTGTAACCAAATATAAATAAAAGGCATAATTTAGGTATTCTATAGTTGCTTAGAATTTTGTTAATATAAATCTCTGTGAAAAATC
AAGGAGTTTTAATATTTTCAGAAGTGCATCCACCTTTCAGGGCTTTAAGTTAGTATTACTCAAGATTATGAACAAATAGCACTTAGGTTA
CCTGAAAGAGTTACTACAACCCCAAAGAGTTGTGTTCTAAGTAGTATCTTGGTAATTCAGAGAGATACTCATCCTACCTGAATATAAACT
GAGATAAATCCAGTAAAGAAAGTGTAGTAAATTCTACATAAGAGTCTATCATTGATTTCTTTTTGTGGTAAAAATCTTAGTTCATGTGAA
GAAATTTCATGTGAATGTTTTAGCTATCAAACAGTACTGTCACCTACTCATGCACAAAACTGCCTCCCAAAGACTTTTCCCAGGTCCCTC
GTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTCAGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTC
CTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTA
TACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAA
ACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAG
TTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAG
AGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTG
GCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGG
TGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCT
AGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCC
AGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAG
GTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAG
GAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGCCATGAACCA
GAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAA
CCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGAGTTAGC
CCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAAT
GACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTA
CAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACA
GCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGG
AGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAA
AGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTT
CCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTT
GTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATT
AAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATC
ATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTC
CAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAA
ACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGA

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000282441_chr11_102033187_+_6820nt
GGATGGGGCGGCGGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGCGCCGCTGATTCCCGGCTCTGC
GGAGGCCTCTAGGCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGATTTACAACCCTGAAGAATCTCCCTATCCCTATTTTGT
CCCCCTGCAGTAATAAATCCCATTATGGAGATCTCGAAACTTTATAAAGGGATATAGTTTGAATTCTATGGAGTGTAATTTTGTGTATGA
ATTATATTTTTAAAACATTGAAGAGTTTTCAGAAAGAAGGCTAGTAGAGTTGATTACTGATACTTTATGCTAAGCAGTACTTTTTTGGTA
GTACAATATTTTGTTAGGCGTTTCTGATAACACTAGAAAGGACAAGTTTTATCTTGTGATAAATTGATTAATGTTTACAACATGACTGAT
AATTATAGCTGAATAGTCCTTAAATGATGAACAGGTTATTTAGTTTTTAAATGCAGTGTAAAAAGTGTGCTGTGGAAATTTTATGGCTAA
CTAAGTTTATGGAGAAAATACCTTCAGTTGATCAAGAATAATAGTGGTATACAAAGTTAGGAAGAAAGTCAACATGATGCTGCAGGAAAT
GGAAACAAATACAAATGATATTTAACAAAGATAGAGTTTACAGTTTTTGAACTTTAAGCCAAATTCATTTGACATCAAGCACTATAGCAG
GCACAGGTTCAACAAAGCTTGTGGGTATTGACTTCCCCCAAAAGTTGTCAGCTGAAGTAATTTAGCCCACTTAAGTAAATACTATGATGA
TAAGCTGTGTGAACTTAGCTTTTAAATAGTGTGACCATATGAAGGTTTTAATTACTTTTGTTTATTGGAATAAAATGAGATTTTTTGGGT
TGTCATGTTAAAGTGCTTATAGGGAAAGAAGCCTGCATATAATTTTTTACCTTGTGGCATAATCAGTAATTGGTCTGTTATTCAGGCTTC
ATAGCTTGTAACCAAATATAAATAAAAGGCATAATTTAGGTATTCTATAGTTGCTTAGAATTTTGTTAATATAAATCTCTGTGAAAAATC
AAGGAGTTTTAATATTTTCAGAAGTGCATCCACCTTTCAGGGCTTTAAGTTAGTATTACTCAAGATTATGAACAAATAGCACTTAGGTTA
CCTGAAAGAGTTACTACAACCCCAAAGAGTTGTGTTCTAAGTAGTATCTTGGTAATTCAGAGAGATACTCATCCTACCTGAATATAAACT
GAGATAAATCCAGTAAAGAAAGTGTAGTAAATTCTACATAAGAGTCTATCATTGATTTCTTTTTGTGGTAAAAATCTTAGTTCATGTGAA
GAAATTTCATGTGAATGTTTTAGCTATCAAACAGTACTGTCACCTACTCATGCACAAAACTGCCTCCCAAAGACTTTTCCCAGGTCCCTC
GTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTCAGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTC
CTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTA
TACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAA
ACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAG
TTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAG
AGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTG
GCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGG
TGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCT
AGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCC
AGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAG
GTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAG
GAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCC
TGATGGATGGGAACAAGCCATGACTCAGGATGGAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCT
TGACCCTCGTTTTGCCATGAACCAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGG
CGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCA
AGAACTGCTTCGGCAGGCAATGCGGAATATCAATCCCAGCACAGCAAATTCTCCAAAATGTCAGGAGTTAGCCCTGCGTAGCCAGTTACC
AACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGA
TCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCC
AGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGA
CTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAG
TCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATG
GTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGT
TTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAA
TGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTT
GGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCA
GACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATT
TACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGT
TTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGAC
AATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTG
TTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATA
TTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTAT
TTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTT
TTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGG
TAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAG
TGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTA
ATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTT
GGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTG
CCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGC
TGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAG
GAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTA
ACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTT
TCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGA
AGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTAT
TTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGG
CTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGA
AATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGG
AAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAA
AGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACC
GTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCT
CAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTG
ACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGT
AAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAA
TTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATT
GATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAG
TGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAA
CAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACA
CTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTA
TCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAA
TATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTAC

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000537274_chr11_102033187_+_6784nt
GGATGGGGCGGCGGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGCGCCGCTGATTCCCGGCTCTGC
GGAGGCCTCTAGGCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGATTTACAACCCTGAAGAATCTCCCTATCCCTATTTTGT
CCCCCTGCAGTAATAAATCCCATTATGGAGATCTCGAAACTTTATAAAGGGATATAGTTTGAATTCTATGGAGTGTAATTTTGTGTATGA
ATTATATTTTTAAAACATTGAAGAGTTTTCAGAAAGAAGGCTAGTAGAGTTGATTACTGATACTTTATGCTAAGCAGTACTTTTTTGGTA
GTACAATATTTTGTTAGGCGTTTCTGATAACACTAGAAAGGACAAGTTTTATCTTGTGATAAATTGATTAATGTTTACAACATGACTGAT
AATTATAGCTGAATAGTCCTTAAATGATGAACAGGTTATTTAGTTTTTAAATGCAGTGTAAAAAGTGTGCTGTGGAAATTTTATGGCTAA
CTAAGTTTATGGAGAAAATACCTTCAGTTGATCAAGAATAATAGTGGTATACAAAGTTAGGAAGAAAGTCAACATGATGCTGCAGGAAAT
GGAAACAAATACAAATGATATTTAACAAAGATAGAGTTTACAGTTTTTGAACTTTAAGCCAAATTCATTTGACATCAAGCACTATAGCAG
GCACAGGTTCAACAAAGCTTGTGGGTATTGACTTCCCCCAAAAGTTGTCAGCTGAAGTAATTTAGCCCACTTAAGTAAATACTATGATGA
TAAGCTGTGTGAACTTAGCTTTTAAATAGTGTGACCATATGAAGGTTTTAATTACTTTTGTTTATTGGAATAAAATGAGATTTTTTGGGT
TGTCATGTTAAAGTGCTTATAGGGAAAGAAGCCTGCATATAATTTTTTACCTTGTGGCATAATCAGTAATTGGTCTGTTATTCAGGCTTC
ATAGCTTGTAACCAAATATAAATAAAAGGCATAATTTAGGTATTCTATAGTTGCTTAGAATTTTGTTAATATAAATCTCTGTGAAAAATC
AAGGAGTTTTAATATTTTCAGAAGTGCATCCACCTTTCAGGGCTTTAAGTTAGTATTACTCAAGATTATGAACAAATAGCACTTAGGTTA
CCTGAAAGAGTTACTACAACCCCAAAGAGTTGTGTTCTAAGTAGTATCTTGGTAATTCAGAGAGATACTCATCCTACCTGAATATAAACT
GAGATAAATCCAGTAAAGAAAGTGTAGTAAATTCTACATAAGAGTCTATCATTGATTTCTTTTTGTGGTAAAAATCTTAGTTCATGTGAA
GAAATTTCATGTGAATGTTTTAGCTATCAAACAGTACTGTCACCTACTCATGCACAAAACTGCCTCCCAAAGACTTTTCCCAGGTCCCTC
GTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTCAGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTC
CTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTA
TACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAA
ACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAG
TTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAG
AGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTG
GCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGG
TGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCT
AGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCC
AGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAG
GTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAG
GAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCC
TGATGGATGGGAACAAGCCATGACTCAGGATGGAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCT
TGACCCTCGTTTTGCCATGAACCAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGG
CGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCA
AGAACTGCTTCGGCAGGTGAGGCCACAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGT
GTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGA
TGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATAC
AGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCT
TGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGA
CATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCT
GTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCC
AGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGA
ATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGA
TGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTA
GTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATA
TTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTAT
CATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATAC
TCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCG
GTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGT
TATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACA
TACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAAT
GGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTT
GAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATC
TGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTT
CATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTC
TAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCT
ACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTA
GTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGA
GTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTG
TGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACA
GGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAG
TATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCAC
TGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTG
AATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATT
ACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTA
AGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACC
TTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAG
TCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTA
GCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGA
GTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAG
CATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTT
GTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGT
TGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTAT
TCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAAT
CAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCT
CAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATT
CTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTTT
TTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAATACCTTTTTGTTTGTTT

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000345877_chr11_102033187_+_6670nt
GGATGGGGCGGCGGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGCGCCGCTGATTCCCGGCTCTGC
GGAGGCCTCTAGGCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGATTTACAACCCTGAAGAATCTCCCTATCCCTATTTTGT
CCCCCTGCAGTAATAAATCCCATTATGGAGATCTCGAAACTTTATAAAGGGATATAGTTTGAATTCTATGGAGTGTAATTTTGTGTATGA
ATTATATTTTTAAAACATTGAAGAGTTTTCAGAAAGAAGGCTAGTAGAGTTGATTACTGATACTTTATGCTAAGCAGTACTTTTTTGGTA
GTACAATATTTTGTTAGGCGTTTCTGATAACACTAGAAAGGACAAGTTTTATCTTGTGATAAATTGATTAATGTTTACAACATGACTGAT
AATTATAGCTGAATAGTCCTTAAATGATGAACAGGTTATTTAGTTTTTAAATGCAGTGTAAAAAGTGTGCTGTGGAAATTTTATGGCTAA
CTAAGTTTATGGAGAAAATACCTTCAGTTGATCAAGAATAATAGTGGTATACAAAGTTAGGAAGAAAGTCAACATGATGCTGCAGGAAAT
GGAAACAAATACAAATGATATTTAACAAAGATAGAGTTTACAGTTTTTGAACTTTAAGCCAAATTCATTTGACATCAAGCACTATAGCAG
GCACAGGTTCAACAAAGCTTGTGGGTATTGACTTCCCCCAAAAGTTGTCAGCTGAAGTAATTTAGCCCACTTAAGTAAATACTATGATGA
TAAGCTGTGTGAACTTAGCTTTTAAATAGTGTGACCATATGAAGGTTTTAATTACTTTTGTTTATTGGAATAAAATGAGATTTTTTGGGT
TGTCATGTTAAAGTGCTTATAGGGAAAGAAGCCTGCATATAATTTTTTACCTTGTGGCATAATCAGTAATTGGTCTGTTATTCAGGCTTC
ATAGCTTGTAACCAAATATAAATAAAAGGCATAATTTAGGTATTCTATAGTTGCTTAGAATTTTGTTAATATAAATCTCTGTGAAAAATC
AAGGAGTTTTAATATTTTCAGAAGTGCATCCACCTTTCAGGGCTTTAAGTTAGTATTACTCAAGATTATGAACAAATAGCACTTAGGTTA
CCTGAAAGAGTTACTACAACCCCAAAGAGTTGTGTTCTAAGTAGTATCTTGGTAATTCAGAGAGATACTCATCCTACCTGAATATAAACT
GAGATAAATCCAGTAAAGAAAGTGTAGTAAATTCTACATAAGAGTCTATCATTGATTTCTTTTTGTGGTAAAAATCTTAGTTCATGTGAA
GAAATTTCATGTGAATGTTTTAGCTATCAAACAGTACTGTCACCTACTCATGCACAAAACTGCCTCCCAAAGACTTTTCCCAGGTCCCTC
GTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTCAGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTC
CTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTA
TACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAA
ACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAG
TTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAG
AGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTG
GCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGG
TGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCT
AGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCC
AGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAG
GTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAG
GAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGCCATGAACCA
GAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAA
CCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGTGAGGCC
ACAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGA
ATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAG
CATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCAC
CCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAAT
GAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCAC
CAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATG
CACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATT
TTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATT
TCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAA
TGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCA
GCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAA
GAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGAT
TTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAA
TTTTGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTG
GTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATC
TTCATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTT
ATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGA
ATACATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAG
AGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACC
AGAAATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAG
CTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAAT
GAACACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCT
GGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAG
ATAATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTAT
TTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGC
ACCTCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCA
AAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGG
AGGGCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAG
GTTGATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCC
ACTGCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTT
TTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAG
ATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTC
TTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACA
ATATGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAG
TGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGG
TCTCTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGG
TATTCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCT
TAGATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGT
GCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTAT
ATGGAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCA
AAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGC
ATGTTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATAT
TAGAGAATTCTTTAATGCACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCT
CATATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAATACCTTTTTGTTTGTTTATGTGGTTCAAATATATTCTTTCC

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000531439_chr11_102033187_+_3312nt
GGATGGGGCGGCGGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGCGCCGCTGATTCCCGGCTCTGC
GGAGGCCTCTAGGCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGATTTACAACCCTGAAGAATCTCCCTATCCCTATTTTGT
CCCCCTGCAGTAATAAATCCCATTATGGAGATCTCGAAACTTTATAAAGGGATATAGTTTGAATTCTATGGAGTGTAATTTTGTGTATGA
ATTATATTTTTAAAACATTGAAGAGTTTTCAGAAAGAAGGCTAGTAGAGTTGATTACTGATACTTTATGCTAAGCAGTACTTTTTTGGTA
GTACAATATTTTGTTAGGCGTTTCTGATAACACTAGAAAGGACAAGTTTTATCTTGTGATAAATTGATTAATGTTTACAACATGACTGAT
AATTATAGCTGAATAGTCCTTAAATGATGAACAGGTTATTTAGTTTTTAAATGCAGTGTAAAAAGTGTGCTGTGGAAATTTTATGGCTAA
CTAAGTTTATGGAGAAAATACCTTCAGTTGATCAAGAATAATAGTGGTATACAAAGTTAGGAAGAAAGTCAACATGATGCTGCAGGAAAT
GGAAACAAATACAAATGATATTTAACAAAGATAGAGTTTACAGTTTTTGAACTTTAAGCCAAATTCATTTGACATCAAGCACTATAGCAG
GCACAGGTTCAACAAAGCTTGTGGGTATTGACTTCCCCCAAAAGTTGTCAGCTGAAGTAATTTAGCCCACTTAAGTAAATACTATGATGA
TAAGCTGTGTGAACTTAGCTTTTAAATAGTGTGACCATATGAAGGTTTTAATTACTTTTGTTTATTGGAATAAAATGAGATTTTTTGGGT
TGTCATGTTAAAGTGCTTATAGGGAAAGAAGCCTGCATATAATTTTTTACCTTGTGGCATAATCAGTAATTGGTCTGTTATTCAGGCTTC
ATAGCTTGTAACCAAATATAAATAAAAGGCATAATTTAGGTATTCTATAGTTGCTTAGAATTTTGTTAATATAAATCTCTGTGAAAAATC
AAGGAGTTTTAATATTTTCAGAAGTGCATCCACCTTTCAGGGCTTTAAGTTAGTATTACTCAAGATTATGAACAAATAGCACTTAGGTTA
CCTGAAAGAGTTACTACAACCCCAAAGAGTTGTGTTCTAAGTAGTATCTTGGTAATTCAGAGAGATACTCATCCTACCTGAATATAAACT
GAGATAAATCCAGTAAAGAAAGTGTAGTAAATTCTACATAAGAGTCTATCATTGATTTCTTTTTGTGGTAAAAATCTTAGTTCATGTGAA
GAAATTTCATGTGAATGTTTTAGCTATCAAACAGTACTGTCACCTACTCATGCACAAAACTGCCTCCCAAAGACTTTTCCCAGGTCCCTC
GTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTCAGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTC
CTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTA
TACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAA
ACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAG
TTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAG
AGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTG
GCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGG
TGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCT
AGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCC
AGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAG
GTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAG
GAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCC
TGATGGATGGGAACAAGCCATGACTCAGGATGGAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCT
TGACCCTCGTTTTGCCATGAACCAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGG
CGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCA
AGAACTGCTTCGGCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGG
GATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGA
CAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTAT
CAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGA
AGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGT

>In-frame_BIRC2_ENST00000227758_chr11_102221674_+_YAP1_ENST00000524575_chr11_102033187_+_3549nt
GGATGGGGCGGCGGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGCGCCGCTGATTCCCGGCTCTGC
GGAGGCCTCTAGGCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGATTTACAACCCTGAAGAATCTCCCTATCCCTATTTTGT
CCCCCTGCAGTAATAAATCCCATTATGGAGATCTCGAAACTTTATAAAGGGATATAGTTTGAATTCTATGGAGTGTAATTTTGTGTATGA
ATTATATTTTTAAAACATTGAAGAGTTTTCAGAAAGAAGGCTAGTAGAGTTGATTACTGATACTTTATGCTAAGCAGTACTTTTTTGGTA
GTACAATATTTTGTTAGGCGTTTCTGATAACACTAGAAAGGACAAGTTTTATCTTGTGATAAATTGATTAATGTTTACAACATGACTGAT
AATTATAGCTGAATAGTCCTTAAATGATGAACAGGTTATTTAGTTTTTAAATGCAGTGTAAAAAGTGTGCTGTGGAAATTTTATGGCTAA
CTAAGTTTATGGAGAAAATACCTTCAGTTGATCAAGAATAATAGTGGTATACAAAGTTAGGAAGAAAGTCAACATGATGCTGCAGGAAAT
GGAAACAAATACAAATGATATTTAACAAAGATAGAGTTTACAGTTTTTGAACTTTAAGCCAAATTCATTTGACATCAAGCACTATAGCAG
GCACAGGTTCAACAAAGCTTGTGGGTATTGACTTCCCCCAAAAGTTGTCAGCTGAAGTAATTTAGCCCACTTAAGTAAATACTATGATGA
TAAGCTGTGTGAACTTAGCTTTTAAATAGTGTGACCATATGAAGGTTTTAATTACTTTTGTTTATTGGAATAAAATGAGATTTTTTGGGT
TGTCATGTTAAAGTGCTTATAGGGAAAGAAGCCTGCATATAATTTTTTACCTTGTGGCATAATCAGTAATTGGTCTGTTATTCAGGCTTC
ATAGCTTGTAACCAAATATAAATAAAAGGCATAATTTAGGTATTCTATAGTTGCTTAGAATTTTGTTAATATAAATCTCTGTGAAAAATC
AAGGAGTTTTAATATTTTCAGAAGTGCATCCACCTTTCAGGGCTTTAAGTTAGTATTACTCAAGATTATGAACAAATAGCACTTAGGTTA
CCTGAAAGAGTTACTACAACCCCAAAGAGTTGTGTTCTAAGTAGTATCTTGGTAATTCAGAGAGATACTCATCCTACCTGAATATAAACT
GAGATAAATCCAGTAAAGAAAGTGTAGTAAATTCTACATAAGAGTCTATCATTGATTTCTTTTTGTGGTAAAAATCTTAGTTCATGTGAA
GAAATTTCATGTGAATGTTTTAGCTATCAAACAGTACTGTCACCTACTCATGCACAAAACTGCCTCCCAAAGACTTTTCCCAGGTCCCTC
GTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTCAGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTC
CTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGGGGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTA
TACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGATGCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAA
ACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGCTAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAG
TTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTTCAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAG
AGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTATGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTG
GCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTTTTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGG
TGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGAACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCT
AGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACATGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCC
AGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGGTCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAG
GTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTGGTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAG
GAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCC
TGATGGATGGGAACAAGCCATGACTCAGGATGGAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCT
TGACCCTCGTTTTGCCATGAACCAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGG
CGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCA
AGAACTGCTTCGGCAGGCAATGCGGAATATCAATCCCAGCACAGCAAATTCTCCAAAATGTCAGGAGTTAGCCCTGCGTAGCCAGTTACC
AACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGA
TCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCC
AGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGA
CTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAG
TCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATG
GTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGT
TTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAA

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000526343_chr11_102033187_+_2702nt
GGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGCGCCGCTGATTCCCGGCTCTGCGGAGGCCTCTAG
GCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGATTTACAACCCTGAAGAATCTCCCTATCCCTATTTTGTCCCCCTGCAGTA
ATAAATCCCATTATGGAGATCTCGAAACTTTATAAAGGGATATAGTTTGAATTCTATGGAGTGTAATTTTGTGTATGAATTATATTTTTA
AAACATTGAAGAGTTTTCAGAAAGAAGACTTTTCCCAGGTCCCTCGTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTC
AGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGG
GGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGAT
GCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGC
TAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTT
CAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTA
TGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTT
TTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGA
ACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACA
TGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGG
TCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTG
GTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCC
ACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGCCATGAACCAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGC
TCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGA
GAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCA
AAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCA
CTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGA
GATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAA
TGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACAT
CCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAAT
TCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAA
CAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGG
CTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTG
GATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCA
CAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTA
TATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCC
TAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATT

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000282441_chr11_102033187_+_5695nt
GGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGCGCCGCTGATTCCCGGCTCTGCGGAGGCCTCTAG
GCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGATTTACAACCCTGAAGAATCTCCCTATCCCTATTTTGTCCCCCTGCAGTA
ATAAATCCCATTATGGAGATCTCGAAACTTTATAAAGGGATATAGTTTGAATTCTATGGAGTGTAATTTTGTGTATGAATTATATTTTTA
AAACATTGAAGAGTTTTCAGAAAGAAGACTTTTCCCAGGTCCCTCGTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTC
AGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGG
GGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGAT
GCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGC
TAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTT
CAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTA
TGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTT
TTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGA
ACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACA
TGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGG
TCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTG
GTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCC
ACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATGACTCAGGATGGAGAAATTTACTA
TATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCCATGAACCAGAGAATCAGTCAGAGTGCTCC
AGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACT
GCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGCAATGCGGAATATCAATCCCAGCACAGC
AAATTCTCCAAAATGTCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCC
CGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTAC
AGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATAC
TATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACT
GGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTC
TGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGAT
CTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATA
CTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGA
AAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCC
TTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCA
ACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACT
TAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCA
CATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATA
GATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGG
TTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGT
TGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACAC
CCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCT
TTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTT
TAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATT
GGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTG
CATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTA
GTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATG
CTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTT
AGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATG
GTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAA
GTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAA
TCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGC
CCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTA
TATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTC
TGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCAT
GTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATAT
CTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAG
AACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAG
TACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTG
TGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATC
ATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGAT
AAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTT
TCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAAC
TTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAA
ATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGA
AACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGAT
TTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATT
TTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAG
ATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAATACCTTTTTGTTTGTTTATGTGGTTC

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000537274_chr11_102033187_+_5659nt
GGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGCGCCGCTGATTCCCGGCTCTGCGGAGGCCTCTAG
GCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGATTTACAACCCTGAAGAATCTCCCTATCCCTATTTTGTCCCCCTGCAGTA
ATAAATCCCATTATGGAGATCTCGAAACTTTATAAAGGGATATAGTTTGAATTCTATGGAGTGTAATTTTGTGTATGAATTATATTTTTA
AAACATTGAAGAGTTTTCAGAAAGAAGACTTTTCCCAGGTCCCTCGTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTC
AGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGG
GGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGAT
GCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGC
TAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTT
CAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTA
TGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTT
TTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGA
ACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACA
TGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGG
TCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTG
GTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCC
ACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATGACTCAGGATGGAGAAATTTACTA
TATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCCATGAACCAGAGAATCAGTCAGAGTGCTCC
AGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACT
GCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGTGAGGCCACAGGAGTTAGCCCTGCGTAG
CCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAA
TAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCC
TCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCG
TTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCT
GATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTT
TCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCC
AGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGC
TGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACT
GTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACT
AAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAA
AACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCT
GAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAG
GCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGT
TCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAA
ATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTA
CCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAAT
GTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATA
TTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGC
CTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCC
CTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCA
TTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATT
AAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTT
TGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTA
TTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAG
CATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCT
TTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTC
AGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAG
AAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTG
ACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAG
TAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAA
GCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGA
GGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTG
TCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCC
TTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCC
TCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGT
TCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACA
ATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATG
GAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAAC
ACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACT
GAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAG
TGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGG
GTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACA
CTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATA

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000345877_chr11_102033187_+_5545nt
GGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGCGCCGCTGATTCCCGGCTCTGCGGAGGCCTCTAG
GCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGATTTACAACCCTGAAGAATCTCCCTATCCCTATTTTGTCCCCCTGCAGTA
ATAAATCCCATTATGGAGATCTCGAAACTTTATAAAGGGATATAGTTTGAATTCTATGGAGTGTAATTTTGTGTATGAATTATATTTTTA
AAACATTGAAGAGTTTTCAGAAAGAAGACTTTTCCCAGGTCCCTCGTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTC
AGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGG
GGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGAT
GCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGC
TAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTT
CAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTA
TGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTT
TTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGA
ACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACA
TGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGG
TCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTG
GTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCC
ACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGCCATGAACCAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGC
TCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGA
GAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGTGAGGCCACAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGA
TGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAG
TGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAA
CAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCAT
TCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTT
GAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCA
GGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACA
GAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTC
TTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAG
TGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGA
TGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAG
CCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATT
TTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAAT
ATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTT
TTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTTA
ATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTAT
CTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGC
TTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGT
TGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCT
GGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGA
TTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGC
CTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTTC
TTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAG
ATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTAA
CTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAAG
CTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCT
TATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTC
CCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAG
TGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAA
CAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAAT
GCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAA
TTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGG
TTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAG
GCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCC
CAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCT
AAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTG
CTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTAA
ATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAG
ATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAA
TAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTG
TAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGG
TACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTT
TCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATATATATATATAGTA
CCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTAT

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000531439_chr11_102033187_+_2187nt
GGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGCGCCGCTGATTCCCGGCTCTGCGGAGGCCTCTAG
GCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGATTTACAACCCTGAAGAATCTCCCTATCCCTATTTTGTCCCCCTGCAGTA
ATAAATCCCATTATGGAGATCTCGAAACTTTATAAAGGGATATAGTTTGAATTCTATGGAGTGTAATTTTGTGTATGAATTATATTTTTA
AAACATTGAAGAGTTTTCAGAAAGAAGACTTTTCCCAGGTCCCTCGTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTC
AGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGG
GGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGAT
GCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGC
TAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTT
CAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTA
TGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTT
TTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGA
ACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACA
TGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGG
TCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTG
GTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCC
ACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATGACTCAGGATGGAGAAATTTACTA
TATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCCATGAACCAGAGAATCAGTCAGAGTGCTCC
AGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACT
GCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGAGTTAGCCCTGCGTAGCCAGTTACCAAC
ACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCC
TTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGA
TGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTA
CCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCT
GCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTT

>In-frame_BIRC2_ENST00000532672_chr11_102221674_+_YAP1_ENST00000524575_chr11_102033187_+_2424nt
GGGCTTCGGGAGCGCCCGGGCTGATCCGAGCCGAGCGGGCCGTATCTCCTTGTCGGCGCCGCTGATTCCCGGCTCTGCGGAGGCCTCTAG
GCAGCCGCGCAGCTTCCGTGTTTGCTGCGCCCGCACTGCGATTTACAACCCTGAAGAATCTCCCTATCCCTATTTTGTCCCCCTGCAGTA
ATAAATCCCATTATGGAGATCTCGAAACTTTATAAAGGGATATAGTTTGAATTCTATGGAGTGTAATTTTGTGTATGAATTATATTTTTA
AAACATTGAAGAGTTTTCAGAAAGAAGACTTTTCCCAGGTCCCTCGTATCAAAACATTAAGAGTATAATGGAAGATAGCACGATCTTGTC
AGATTGGACAAACAGCAACAAACAAAAAATGAAGTATGACTTTTCCTGTGAACTCTACAGAATGTCTACATATTCAACTTTCCCCGCCGG
GGTGCCTGTCTCAGAAAGGAGTCTTGCTCGTGCTGGTTTTTATTATACTGGTGTGAATGACAAGGTCAAATGCTTCTGTTGTGGCCTGAT
GCTGGATAACTGGAAACTAGGAGACAGTCCTATTCAAAAGCATAAACAGCTATATCCTAGCTGTAGCTTTATTCAGAATCTGGTTTCAGC
TAGTCTGGGATCCACCTCTAAGAATACGTCTCCAATGAGAAACAGTTTTGCACATTCATTATCTCCCACCTTGGAACATAGTAGCTTGTT
CAGTGGTTCTTACTCCAGCCTTTCTCCAAACCCTCTTAATTCTAGAGCAGTTGAAGACATCTCTTCATCGAGGACTAACCCCTACAGTTA
TGCAATGAGTACTGAAGAAGCCAGATTTCTTACCTACCATATGTGGCCATTAACTTTTTTGTCACCATCAGAATTGGCAAGAGCTGGTTT
TTATTATATAGGACCTGGAGATAGGGTAGCCTGCTTTGCCTGTGGTGGGAAGCTCAGTAACTGGGAACCAAAGGATGATGCTATGTCAGA
ACACCGGAGGCATTTTCCCAACTGTCCATTTTTGGAAAATTCTCTAGAAACTCTGAGGTTTAGCATTTCAAATCTGAGCATGCAGACACA
TGCAGCTCGAATGAGAACATTTATGTACTGGCCATCTAGTGTTCCAGTTCAGCCTGAGCAGCTTGCAAGTGCTGGTTTTTATTATGTGGG
TCGCAATGATGATGTCAAATGCTTTTGTTGTGATGGTGGCTTGAGGTGTTGGGAATCTGGAGATGATCCATGGGTAGAACATGCCAAGTG
GTTTCCAAGTCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCC
ACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATGACTCAGGATGGAGAAATTTACTA
TATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCCATGAACCAGAGAATCAGTCAGAGTGCTCC
AGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACT
GCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGCAATGCGGAATATCAATCCCAGCACAGC
AAATTCTCCAAAATGTCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCC
CGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTAC
AGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATAC
TATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACT
GGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTC
TGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGAT
CTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATA


Top

FusionGenePPI for BIRC2_YAP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BIRC2MAGEA11, JUP, TRAF2, CASP8, DIABLO, HTRA2, GSPT1, RIPK2, CASP9, TNFSF14, TRAF1, CASP3, CASP7, TNFRSF1A, BCL10, BIRC2, RAF1, ADRM1, RIPK1, HSP90B1, XAF1, UBE2J1, UBE2W, FBXO7, XIAP, BIRC5, IKBKG, UBE2L3, UBE2D3, UBE2D1, TNF, TNFRSF12A, TSG101, UBE2B, UBE2D2, UBE2Q2, UBE2S, BIRC7, UBC, TRAF3, TRAF6, MAVS, RIPK3, RIPK4, UBXN7, USP19, MAP3K14, TANK, TOLLIP, TRIM32, NOD2, SH3KBP1, AIMP2, RAC1, BIRC3, CASP2, CD40, DHX9, ILF3, ILF2, IGF2BP1, E2F1, GSK3B, UBE2V1, MXD1, PGAM5, IKBKE, NFKB2, RNF31, UBA1, UBR4, UBR5, WDR1, DCAF7, WDR82, USP15, USP7, USP9X, OTUB1, TNFSF12, CBLC, TRIM34, RNF181, DZIP3, CD40LG, TNFAIP3, EGFR, RHOA, CDC42, PACS2, MAP3K2, MAP3K3, PCSK9, ENDOG, GFAP, NMB, BOLA1, WDYHV1, EAF2, EXOSC5, GCC1, TSGA10, PPM1K, CASP10, UBE2L6, PRDX3, CD27, TAS2R7, FSD1, NFKBIA, DNAJB2, DNASE2B, CLEC11A, LTBR, VPS4B, UBXN1, TUFT1, ABHD17A, EGLN3, CSE1L, TLR3, ULK1, TOMM20, LRRN2, LPIN3, ADAMTS4, RABGEF1, TMEM9B, SPINK7, LYG2, CSTF2T, C19orf44, CCNYL1, ZFAND6, GNAZ, DCAF12, C1R, FAM19A3, GPR107, GAP43, CYLD, GLMN, UBE2N, TRIM25YAP1ERBB4, TP53BP2, KIF5A, SLC9A3R1, YWHAQ, RUNX3, RUNX2, RUNX1, TP73, TP63, WBP1, SMAD7, SMAD6, SCAMP3, AMOT, ITCH, EP300, BTRC, YWHAG, FBXW11, SMAD1, SMAD5, SMAD3, EGFR, ELAVL1, KLF5, LATS2, LATS1, PML, SUMO1, PTPN14, NFE2, POLR2A, AMOTL2, SRSF2, AHCYL1, UBQLN2, SULT1A1, UNK, UBA2, ZFYVE19, VPS4B, PRDX1, IGBP1, THUMPD1, ZPR1, NUBP2, UBE2L3, PIN1, USP9X, TTC9C, UCHL3, UBE2D1, UFM1, UBE2C, UBXN7, VPS25, TEAD1, CREB1, PPP1CA, AMOTL1, ARID1A, ARID1B, ATPIF1, BCL9L, CCDC85C, DPF2, INADL, LIN7C, MPDZ, MPP5, NF2, PARD3, PDLIM7, RAE1, RAPGEF2, RASSF8, SLC9A3R2, SMARCD1, TEAD3, TJP2, WBP2, YWHAB, YWHAE, YWHAH, YWHAZ, MAP2K1, ARFIP1, PAPOLA, PRMT3, RTF1, STAT1, TSNAX, TOM1, FBXW7, ABL1, ENO1, MOV10, NXF1, FAM189B, PRRG4, CYYR1, TEAD4, ARRDC1, LDLRAD4, STUB1, CPVL, ERP44, FASN, HSPH1, HSPA4L, HSPA4, HYOU1, MCMBP, RAPGEF6, PTCH1, PRRG2, NEDD8, TEAD2, XPO1, SMAD2, ENAH, CDH1, PTPN21, DEFA6, BAG4, CTNNB1, NUDT5, PRKD1, XRCC5, XRCC6, AHNAK, EPRS, THBS1, EEF1A1, EEF1A1P5, WWC3, TUBB, HRNR, PFKP, RPL6, COPA, VCP, EIF3B, CAD, RBM10, SUN2, SLC25A5, PSMD2, ACTN1, RRBP1, DDX3X, RPS4X, FAM120A, NCL, CSTF1, TMPO, MAP4, USP15, RPL7A, SNRPB, RPL18, SF3B3, FLG2, HSPB1, CCT2, SND1, PRPF8, EIF4B, HSP90B1, NPM1, PPP2R1A, CYFIP1, MATR3, TUBB6, HNRNPA2B1, RPS6, PSMC2, EIF3L, HNRNPR, IMMT, PHB2, RPS8, PTRF, RPL10A, PARP1, HIST1H1E, LMNB1, PA2G4, HNRNPF, ITGB1, NUMA1, SRSF6, TGM2, OGDH, PDIA3, RPL24, PHGDH, IPO5, TSR1, TRIP6, YBX1, SMARCA4, ATAD3A, RPL19, CCT5, PGAM5, SEC16A, AJUBA, PSMC5, UPF1, RPL15, XRN2, RPL13A, PSMC6, CNN2, HDAC1, HDAC2, SFN, SUPT16H, RBBP7, PRDX6, SEPT2, UQCRC2, MVD, MYH10, PLOD2, PSMD6, ADSS, PAICS, FUBP1, CIAPIN1, SFXN1, PSMA5, RPL9, DNAJC10, PTBP1, ANXA5, KPNA2, WDR1, C11orf84, H2AFY, JUN, RTN4, RPL14, H1FX, IGFBP7, ACTL6A, RPL17, ZYX, PSMB4, TWF1, HIST1H1B, TK1, CDC20, RAN, RPL21, SV2B, HN1L


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BIRC2_YAP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for BIRC2_YAP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneBIRC2C0019693HIV Infections1CTD_human
HgeneBIRC2C0023418leukemia1CTD_human
HgeneBIRC2C0038356Stomach Neoplasms1CTD_human
HgeneBIRC2C1458155Mammary Neoplasms1CTD_human
TgeneYAP1C0027819Neuroblastoma1CTD_human
TgeneYAP1C0919267ovarian neoplasm1CTD_human
TgeneYAP1C1168401Squamous cell carcinoma of the head and neck1CTD_human