FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41743

FusionGeneSummary for WASF2_FGR

check button Fusion gene summary
Fusion gene informationFusion gene name: WASF2_FGR
Fusion gene ID: 41743
HgeneTgene
Gene symbol

WASF2

FGR

Gene ID

10163

2268

Gene nameWAS protein family member 2FGR proto-oncogene, Src family tyrosine kinase
SynonymsIMD2|SCAR2|WASF4|WAVE2|dJ393P12.2SRC2|c-fgr|c-src2|p55-Fgr|p55c-fgr|p58-Fgr|p58c-fgr
Cytomap

1p36.11

1p35.3

Type of geneprotein-codingprotein-coding
Descriptionwiskott-Aldrich syndrome protein family member 2WASP family Verprolin-homologous protein 2WASP family protein member 2WASP family protein member 4protein WAVE-2putative Wiskott-Aldrich syndrome protein family member 4suppressor of cyclic-AMP receptotyrosine-protein kinase FgrGardner-Rasheed feline sarcoma viral (v-fgr) oncogene homologc-fgr protooncogenec-src-2 proto-oncogenefeline Gardner-Rasheed sarcoma viral oncogene homologp55-c-fgr proteinproto-oncogene c-Fgrproto-oncogene tyrosine-prote
Modification date2018052220180523
UniProtAcc

Q9Y6W5

P09769

Ensembl transtripts involved in fusion geneENST00000430629, ENST00000536657, 
ENST00000374005, ENST00000399173, 
ENST00000545953, ENST00000374004, 
ENST00000468038, 
Fusion gene scores* DoF score9 X 2 X 11=1984 X 5 X 7=140
# samples 2311
** MAII scorelog2(23/198*10)=0.216133430864766
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(11/140*10)=-0.347923303420307
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: WASF2 [Title/Abstract] AND FGR [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneFGR

GO:0018108

peptidyl-tyrosine phosphorylation

7519620|8327512

TgeneFGR

GO:0046777

protein autophosphorylation

2181286|8327512


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-BH-A1FD-01AWASF2chr1

27755271

-FGRchr1

27939861

-
TCGARVESCATCGA-L5-A891-01AWASF2chr1

27816497

-FGRchr1

27951662

-
TCGARVLUSCTCGA-66-2759-01AWASF2chr1

27816497

-FGRchr1

27951662

-
TCGALDOVTCGA-13-0893-01BWASF2chr1

27816497

-FGRchr1

27951662

-
TCGALDOVTCGA-23-2078-01AWASF2chr1

27816497

-FGRchr1

27951662

-
TCGARVSKCMTCGA-ER-A19W-06AWASF2chr1

27816497

-FGRchr1

27951662

-
TCGARVUCSTCGA-NA-A4R1-01AWASF2chr1

27816497

-FGRchr1

27951662

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000430629ENST00000374005WASF2chr1

27755271

-FGRchr1

27939861

-
In-frameENST00000430629ENST00000399173WASF2chr1

27755271

-FGRchr1

27939861

-
In-frameENST00000430629ENST00000545953WASF2chr1

27755271

-FGRchr1

27939861

-
In-frameENST00000430629ENST00000374004WASF2chr1

27755271

-FGRchr1

27939861

-
5CDS-intronENST00000430629ENST00000468038WASF2chr1

27755271

-FGRchr1

27939861

-
In-frameENST00000536657ENST00000374005WASF2chr1

27755271

-FGRchr1

27939861

-
In-frameENST00000536657ENST00000399173WASF2chr1

27755271

-FGRchr1

27939861

-
In-frameENST00000536657ENST00000545953WASF2chr1

27755271

-FGRchr1

27939861

-
In-frameENST00000536657ENST00000374004WASF2chr1

27755271

-FGRchr1

27939861

-
5CDS-intronENST00000536657ENST00000468038WASF2chr1

27755271

-FGRchr1

27939861

-
5UTR-5UTRENST00000430629ENST00000374005WASF2chr1

27816497

-FGRchr1

27951662

-
5UTR-5UTRENST00000430629ENST00000399173WASF2chr1

27816497

-FGRchr1

27951662

-
5UTR-5UTRENST00000430629ENST00000545953WASF2chr1

27816497

-FGRchr1

27951662

-
5UTR-intronENST00000430629ENST00000374004WASF2chr1

27816497

-FGRchr1

27951662

-
5UTR-5UTRENST00000430629ENST00000468038WASF2chr1

27816497

-FGRchr1

27951662

-
5UTR-5UTRENST00000536657ENST00000374005WASF2chr1

27816497

-FGRchr1

27951662

-
5UTR-5UTRENST00000536657ENST00000399173WASF2chr1

27816497

-FGRchr1

27951662

-
5UTR-5UTRENST00000536657ENST00000545953WASF2chr1

27816497

-FGRchr1

27951662

-
5UTR-intronENST00000536657ENST00000374004WASF2chr1

27816497

-FGRchr1

27951662

-
5UTR-5UTRENST00000536657ENST00000468038WASF2chr1

27816497

-FGRchr1

27951662

-

Top

FusionProtFeatures for WASF2_FGR


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
WASF2

Q9Y6W5

FGR

P09769

Downstream effector molecule involved in thetransmission of signals from tyrosine kinase receptors and smallGTPases to the actin cytoskeleton. Promotes formation of actinfilaments. Part of the WAVE complex that regulates lamellipodiaformation. The WAVE complex regulates actin filamentreorganization via its interaction with the Arp2/3 complex.{ECO:0000269|PubMed:10381382, ECO:0000269|PubMed:16275905}. Non-receptor tyrosine-protein kinase that transmitssignals from cell surface receptors devoid of kinase activity andcontributes to the regulation of immune responses, includingneutrophil, monocyte, macrophage and mast cell functions,cytoskeleton remodeling in response to extracellular stimuli,phagocytosis, cell adhesion and migration. Promotes mast celldegranulation, release of inflammatory cytokines and IgE-mediatedanaphylaxis. Acts downstream of receptors that bind the Fc regionof immunoglobulins, such as MS4A2/FCER1B, FCGR2A and/or FCGR2B.Acts downstream of ITGB1 and ITGB2, and regulates actincytoskeleton reorganization, cell spreading and adhesion.Depending on the context, activates or inhibits cellularresponses. Functions as negative regulator of ITGB2 signaling,phagocytosis and SYK activity in monocytes. Required for normalITGB1 and ITGB2 signaling, normal cell spreading and adhesion inneutrophils and macrophages. Functions as positive regulator ofcell migration and regulates cytoskeleton reorganization via RAC1activation. Phosphorylates SYK (in vitro) and promotes SYK-dependent activation of AKT1 and MAP kinase signaling.Phosphorylates PLD2 in antigen-stimulated mast cells, leading toPLD2 activation and the production of the signaling moleculeslysophosphatidic acid and diacylglycerol. Promotes activation ofPIK3R1. Phosphorylates FASLG, and thereby regulates itsubiquitination and subsequent internalization. PhosphorylatesABL1. Promotes phosphorylation of CBL, CTTN, PIK3R1, PTK2/FAK1,PTK2B/PYK2 and VAV2. Phosphorylates HCLS1 that has already beenphosphorylated by SYK, but not unphosphorylated HCLS1.{ECO:0000269|PubMed:10739672, ECO:0000269|PubMed:17164290,ECO:0000269|PubMed:1737799, ECO:0000269|PubMed:7519620}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneWASF2chr1:27755271chr1:27939861ENST00000430629-29268_27143499Compositional biasNote=Poly-Pro
HgeneWASF2chr1:27755271chr1:27939861ENST00000430629-29318_32843499Compositional biasNote=Poly-Pro
HgeneWASF2chr1:27755271chr1:27939861ENST00000430629-29333_33843499Compositional biasNote=Poly-Pro
HgeneWASF2chr1:27755271chr1:27939861ENST00000430629-29347_35043499Compositional biasNote=Poly-Pro
HgeneWASF2chr1:27755271chr1:27939861ENST00000430629-29364_37143499Compositional biasNote=Poly-Pro
HgeneWASF2chr1:27755271chr1:27939861ENST00000430629-29379_38243499Compositional biasNote=Poly-Pro
HgeneWASF2chr1:27755271chr1:27939861ENST00000430629-29391_40643499Compositional biasNote=Poly-Pro
HgeneWASF2chr1:27755271chr1:27939861ENST00000536657-28268_27143282Compositional biasNote=Poly-Pro
HgeneWASF2chr1:27755271chr1:27939861ENST00000536657-28318_32843282Compositional biasNote=Poly-Pro
HgeneWASF2chr1:27755271chr1:27939861ENST00000536657-28333_33843282Compositional biasNote=Poly-Pro
HgeneWASF2chr1:27755271chr1:27939861ENST00000536657-28347_35043282Compositional biasNote=Poly-Pro
HgeneWASF2chr1:27755271chr1:27939861ENST00000536657-28364_37143282Compositional biasNote=Poly-Pro
HgeneWASF2chr1:27755271chr1:27939861ENST00000536657-28379_38243282Compositional biasNote=Poly-Pro
HgeneWASF2chr1:27755271chr1:27939861ENST00000536657-28391_40643282Compositional biasNote=Poly-Pro
HgeneWASF2chr1:27755271chr1:27939861ENST00000430629-29436_45343499DomainWH2
HgeneWASF2chr1:27755271chr1:27939861ENST00000536657-28436_45343282DomainWH2
TgeneFGRchr1:27755271chr1:27939861ENST00000374004-811144_241416530DomainSH2
TgeneFGRchr1:27755271chr1:27939861ENST00000374004-811263_516416530DomainProtein kinase
TgeneFGRchr1:27755271chr1:27939861ENST00000374004-81177_138416530DomainSH3
TgeneFGRchr1:27755271chr1:27939861ENST00000374005-1013144_241416530DomainSH2
TgeneFGRchr1:27755271chr1:27939861ENST00000374005-1013263_516416530DomainProtein kinase
TgeneFGRchr1:27755271chr1:27939861ENST00000374005-101377_138416530DomainSH3
TgeneFGRchr1:27755271chr1:27939861ENST00000399173-1013144_241416530DomainSH2
TgeneFGRchr1:27755271chr1:27939861ENST00000399173-1013263_516416530DomainProtein kinase
TgeneFGRchr1:27755271chr1:27939861ENST00000399173-101377_138416530DomainSH3
TgeneFGRchr1:27755271chr1:27939861ENST00000374004-811269_277416530Nucleotide bindingATP
TgeneFGRchr1:27755271chr1:27939861ENST00000374005-1013269_277416530Nucleotide bindingATP
TgeneFGRchr1:27755271chr1:27939861ENST00000399173-1013269_277416530Nucleotide bindingATP


Top

FusionGeneSequence for WASF2_FGR


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_WASF2_ENST00000430629_chr1_27755271_-_FGR_ENST00000374005_chr1_27939861_-_157aa
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMN

>In-frame_WASF2_ENST00000430629_chr1_27755271_-_FGR_ENST00000399173_chr1_27939861_-_157aa
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMN

>In-frame_WASF2_ENST00000430629_chr1_27755271_-_FGR_ENST00000545953_chr1_27939861_-_157aa
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMN

>In-frame_WASF2_ENST00000430629_chr1_27755271_-_FGR_ENST00000374004_chr1_27939861_-_157aa
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMN

>In-frame_WASF2_ENST00000536657_chr1_27755271_-_FGR_ENST00000374005_chr1_27939861_-_157aa
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMN

>In-frame_WASF2_ENST00000536657_chr1_27755271_-_FGR_ENST00000399173_chr1_27939861_-_157aa
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMN

>In-frame_WASF2_ENST00000536657_chr1_27755271_-_FGR_ENST00000545953_chr1_27939861_-_157aa
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMN

>In-frame_WASF2_ENST00000536657_chr1_27755271_-_FGR_ENST00000374004_chr1_27939861_-_157aa
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_WASF2_ENST00000430629_chr1_27755271_-_FGR_ENST00000374005_chr1_27939861_-_471nt
ATGCCGTTAGTAACGAGGAACATCGAGCCAAGGCACCTGTGCCGTCAGACGTTGCCTAGCGTTAGAAGCGAGCTGGAATGCGTGACCAAC
ATCACCCTGGCAAATGTCATCCGACAGCTGGGCAGCCTGAGTTCCAAGTTCCCCATCAAGTGGACAGCCCCAGAAGCTGCCCTCTTTGGC
AGATTCACCATCAAGTCAGACGTGTGGTCCTTTGGGATCCTGCTCACTGAGCTCATCACCAAGGGCCGAATCCCCTACCCAGGCATGAAT
AAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCTCCAGGCTGCCCAGCATCCCTGTACGAGGCCATGGAACAG
ACCTGGCGTCTGGACCCGGAGGAGAGGCCTACCTTCGAGTACCTGCAGTCCTTCCTGGAGGACTACTTCACCTCCGCTGAACCACAGTAC

>In-frame_WASF2_ENST00000430629_chr1_27755271_-_FGR_ENST00000399173_chr1_27939861_-_471nt
ATGCCGTTAGTAACGAGGAACATCGAGCCAAGGCACCTGTGCCGTCAGACGTTGCCTAGCGTTAGAAGCGAGCTGGAATGCGTGACCAAC
ATCACCCTGGCAAATGTCATCCGACAGCTGGGCAGCCTGAGTTCCAAGTTCCCCATCAAGTGGACAGCCCCAGAAGCTGCCCTCTTTGGC
AGATTCACCATCAAGTCAGACGTGTGGTCCTTTGGGATCCTGCTCACTGAGCTCATCACCAAGGGCCGAATCCCCTACCCAGGCATGAAT
AAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCTCCAGGCTGCCCAGCATCCCTGTACGAGGCCATGGAACAG
ACCTGGCGTCTGGACCCGGAGGAGAGGCCTACCTTCGAGTACCTGCAGTCCTTCCTGGAGGACTACTTCACCTCCGCTGAACCACAGTAC

>In-frame_WASF2_ENST00000430629_chr1_27755271_-_FGR_ENST00000545953_chr1_27939861_-_471nt
ATGCCGTTAGTAACGAGGAACATCGAGCCAAGGCACCTGTGCCGTCAGACGTTGCCTAGCGTTAGAAGCGAGCTGGAATGCGTGACCAAC
ATCACCCTGGCAAATGTCATCCGACAGCTGGGCAGCCTGAGTTCCAAGTTCCCCATCAAGTGGACAGCCCCAGAAGCTGCCCTCTTTGGC
AGATTCACCATCAAGTCAGACGTGTGGTCCTTTGGGATCCTGCTCACTGAGCTCATCACCAAGGGCCGAATCCCCTACCCAGGCATGAAT
AAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCTCCAGGCTGCCCAGCATCCCTGTACGAGGCCATGGAACAG
ACCTGGCGTCTGGACCCGGAGGAGAGGCCTACCTTCGAGTACCTGCAGTCCTTCCTGGAGGACTACTTCACCTCCGCTGAACCACAGTAC

>In-frame_WASF2_ENST00000430629_chr1_27755271_-_FGR_ENST00000374004_chr1_27939861_-_471nt
ATGCCGTTAGTAACGAGGAACATCGAGCCAAGGCACCTGTGCCGTCAGACGTTGCCTAGCGTTAGAAGCGAGCTGGAATGCGTGACCAAC
ATCACCCTGGCAAATGTCATCCGACAGCTGGGCAGCCTGAGTTCCAAGTTCCCCATCAAGTGGACAGCCCCAGAAGCTGCCCTCTTTGGC
AGATTCACCATCAAGTCAGACGTGTGGTCCTTTGGGATCCTGCTCACTGAGCTCATCACCAAGGGCCGAATCCCCTACCCAGGCATGAAT
AAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCTCCAGGCTGCCCAGCATCCCTGTACGAGGCCATGGAACAG
ACCTGGCGTCTGGACCCGGAGGAGAGGCCTACCTTCGAGTACCTGCAGTCCTTCCTGGAGGACTACTTCACCTCCGCTGAACCACAGTAC

>In-frame_WASF2_ENST00000536657_chr1_27755271_-_FGR_ENST00000374005_chr1_27939861_-_471nt
ATGCCGTTAGTAACGAGGAACATCGAGCCAAGGCACCTGTGCCGTCAGACGTTGCCTAGCGTTAGAAGCGAGCTGGAATGCGTGACCAAC
ATCACCCTGGCAAATGTCATCCGACAGCTGGGCAGCCTGAGTTCCAAGTTCCCCATCAAGTGGACAGCCCCAGAAGCTGCCCTCTTTGGC
AGATTCACCATCAAGTCAGACGTGTGGTCCTTTGGGATCCTGCTCACTGAGCTCATCACCAAGGGCCGAATCCCCTACCCAGGCATGAAT
AAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCTCCAGGCTGCCCAGCATCCCTGTACGAGGCCATGGAACAG
ACCTGGCGTCTGGACCCGGAGGAGAGGCCTACCTTCGAGTACCTGCAGTCCTTCCTGGAGGACTACTTCACCTCCGCTGAACCACAGTAC

>In-frame_WASF2_ENST00000536657_chr1_27755271_-_FGR_ENST00000399173_chr1_27939861_-_471nt
ATGCCGTTAGTAACGAGGAACATCGAGCCAAGGCACCTGTGCCGTCAGACGTTGCCTAGCGTTAGAAGCGAGCTGGAATGCGTGACCAAC
ATCACCCTGGCAAATGTCATCCGACAGCTGGGCAGCCTGAGTTCCAAGTTCCCCATCAAGTGGACAGCCCCAGAAGCTGCCCTCTTTGGC
AGATTCACCATCAAGTCAGACGTGTGGTCCTTTGGGATCCTGCTCACTGAGCTCATCACCAAGGGCCGAATCCCCTACCCAGGCATGAAT
AAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCTCCAGGCTGCCCAGCATCCCTGTACGAGGCCATGGAACAG
ACCTGGCGTCTGGACCCGGAGGAGAGGCCTACCTTCGAGTACCTGCAGTCCTTCCTGGAGGACTACTTCACCTCCGCTGAACCACAGTAC

>In-frame_WASF2_ENST00000536657_chr1_27755271_-_FGR_ENST00000545953_chr1_27939861_-_471nt
ATGCCGTTAGTAACGAGGAACATCGAGCCAAGGCACCTGTGCCGTCAGACGTTGCCTAGCGTTAGAAGCGAGCTGGAATGCGTGACCAAC
ATCACCCTGGCAAATGTCATCCGACAGCTGGGCAGCCTGAGTTCCAAGTTCCCCATCAAGTGGACAGCCCCAGAAGCTGCCCTCTTTGGC
AGATTCACCATCAAGTCAGACGTGTGGTCCTTTGGGATCCTGCTCACTGAGCTCATCACCAAGGGCCGAATCCCCTACCCAGGCATGAAT
AAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCTCCAGGCTGCCCAGCATCCCTGTACGAGGCCATGGAACAG
ACCTGGCGTCTGGACCCGGAGGAGAGGCCTACCTTCGAGTACCTGCAGTCCTTCCTGGAGGACTACTTCACCTCCGCTGAACCACAGTAC

>In-frame_WASF2_ENST00000536657_chr1_27755271_-_FGR_ENST00000374004_chr1_27939861_-_471nt
ATGCCGTTAGTAACGAGGAACATCGAGCCAAGGCACCTGTGCCGTCAGACGTTGCCTAGCGTTAGAAGCGAGCTGGAATGCGTGACCAAC
ATCACCCTGGCAAATGTCATCCGACAGCTGGGCAGCCTGAGTTCCAAGTTCCCCATCAAGTGGACAGCCCCAGAAGCTGCCCTCTTTGGC
AGATTCACCATCAAGTCAGACGTGTGGTCCTTTGGGATCCTGCTCACTGAGCTCATCACCAAGGGCCGAATCCCCTACCCAGGCATGAAT
AAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCTCCAGGCTGCCCAGCATCCCTGTACGAGGCCATGGAACAG
ACCTGGCGTCTGGACCCGGAGGAGAGGCCTACCTTCGAGTACCTGCAGTCCTTCCTGGAGGACTACTTCACCTCCGCTGAACCACAGTAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_WASF2_ENST00000430629_chr1_27755271_-_FGR_ENST00000374005_chr1_27939861_-_1537nt
GGGGAATCGCGTAATGGCGGACACAGGCAGGGCGAGCGCGGCTGGGGGCGTAGCGCGCTGAGGGGGTCCGGCCGTTTGGCAGCCCGCGAG
GCGGTCCGCGGGAGCACACTCTGTGCGGAGACTGGGCGGCCGGCCGACCCTTCCTGTCGCTGACGGCGACTGCGGGAGGCCAGGTTGTTT
TTCACCATTCAGAACATTGCCTGAAGCAGGTCCACCATGCCGTTAGTAACGAGGAACATCGAGCCAAGGCACCTGTGCCGTCAGACGTTG
CCTAGCGTTAGAAGCGAGCTGGAATGCGTGACCAACATCACCCTGGCAAATGTCATCCGACAGCTGGGCAGCCTGAGTTCCAAGTTCCCC
ATCAAGTGGACAGCCCCAGAAGCTGCCCTCTTTGGCAGATTCACCATCAAGTCAGACGTGTGGTCCTTTGGGATCCTGCTCACTGAGCTC
ATCACCAAGGGCCGAATCCCCTACCCAGGCATGAATAAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCTCCA
GGCTGCCCAGCATCCCTGTACGAGGCCATGGAACAGACCTGGCGTCTGGACCCGGAGGAGAGGCCTACCTTCGAGTACCTGCAGTCCTTC
CTGGAGGACTACTTCACCTCCGCTGAACCACAGTACCAGCCCGGGGATCAGACATAGCCTGTCCGGGCATCAACCCTCTCTGGCGGTGGC
CACCAGTCCTTGCCAATCCCCAGAGCTGTTCTTCCAAAGCCCCCAGGCTGGCTTAGAACCCCATAGAGTCCTAGCATCACCGAGGACGTG
GCTGCTCTGACACCACCTAGGGCAACCTACTTGTTTTACAGATGGGGCAAAAGGAGGCCCAGAGCTGATCTCTCATCCGCTCTGGCCCCA
AGCACTATTTCTTCCTTTTCCACTTAGGCCCCTACATGCCTGTAGCCTTTCTCACTCCATCCCCACCCAAAGTGCTCAGACCTTGTCTAG
TTATTTATAAAACTGTATGTACCTCCCTCACTTCTCTCCTATCACTGCTTTCCTACTCTCCTTTTATCTCACTCTAGTCCAGGTGCCAAG
AATTTCCCTTCTACCCTCTATTCTCTTGTGTCTGTAAGTTACAAAGTCAGGAAAAGTCTTGGCTGGACCCCTTTCCTGCTGGGTGGATGC
AGTGGTCCAGGACTGGGGTCTGGGCCCAGGTTTGAGGGAGAAGGTTGCAGAGCACTTCCCACCTCTCTGAATAGTGTGTATGTGTTGGTT
TATTGATTCTGTAAATAAGTAAAATGACAATATGAATCCTCAAACCATGAAATACCCTTGAACCTTCCTTTGGGAGCGGGGGTGGTCAAT
AGGGGGTGAACGGACAGATATGGCTACAGGCAGCAGCAGGGGAAGCTGGAGAGGGCCCTAATGCCTACCAAGCACGGGGCATCCAAGGTG
TGGAGTTTTAGAACACCCAGAGTCCCACTGCTCATCTGCACGTGAGTTTAGAAGACAAGCAGCTGAAGATACATTAAAATGTCCCCTTCG

>In-frame_WASF2_ENST00000430629_chr1_27755271_-_FGR_ENST00000399173_chr1_27939861_-_1309nt
GGGGAATCGCGTAATGGCGGACACAGGCAGGGCGAGCGCGGCTGGGGGCGTAGCGCGCTGAGGGGGTCCGGCCGTTTGGCAGCCCGCGAG
GCGGTCCGCGGGAGCACACTCTGTGCGGAGACTGGGCGGCCGGCCGACCCTTCCTGTCGCTGACGGCGACTGCGGGAGGCCAGGTTGTTT
TTCACCATTCAGAACATTGCCTGAAGCAGGTCCACCATGCCGTTAGTAACGAGGAACATCGAGCCAAGGCACCTGTGCCGTCAGACGTTG
CCTAGCGTTAGAAGCGAGCTGGAATGCGTGACCAACATCACCCTGGCAAATGTCATCCGACAGCTGGGCAGCCTGAGTTCCAAGTTCCCC
ATCAAGTGGACAGCCCCAGAAGCTGCCCTCTTTGGCAGATTCACCATCAAGTCAGACGTGTGGTCCTTTGGGATCCTGCTCACTGAGCTC
ATCACCAAGGGCCGAATCCCCTACCCAGGCATGAATAAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCTCCA
GGCTGCCCAGCATCCCTGTACGAGGCCATGGAACAGACCTGGCGTCTGGACCCGGAGGAGAGGCCTACCTTCGAGTACCTGCAGTCCTTC
CTGGAGGACTACTTCACCTCCGCTGAACCACAGTACCAGCCCGGGGATCAGACATAGCCTGTCCGGGCATCAACCCTCTCTGGCGGTGGC
CACCAGTCCTTGCCAATCCCCAGAGCTGTTCTTCCAAAGCCCCCAGGCTGGCTTAGAACCCCATAGAGTCCTAGCATCACCGAGGACGTG
GCTGCTCTGACACCACCTAGGGCAACCTACTTGTTTTACAGATGGGGCAAAAGGAGGCCCAGAGCTGATCTCTCATCCGCTCTGGCCCCA
AGCACTATTTCTTCCTTTTCCACTTAGGCCCCTACATGCCTGTAGCCTTTCTCACTCCATCCCCACCCAAAGTGCTCAGACCTTGTCTAG
TTATTTATAAAACTGTATGTACCTCCCTCACTTCTCTCCTATCACTGCTTTCCTACTCTCCTTTTATCTCACTCTAGTCCAGGTGCCAAG
AATTTCCCTTCTACCCTCTATTCTCTTGTGTCTGTAAGTTACAAAGTCAGGAAAAGTCTTGGCTGGACCCCTTTCCTGCTGGGTGGATGC
AGTGGTCCAGGACTGGGGTCTGGGCCCAGGTTTGAGGGAGAAGGTTGCAGAGCACTTCCCACCTCTCTGAATAGTGTGTATGTGTTGGTT

>In-frame_WASF2_ENST00000430629_chr1_27755271_-_FGR_ENST00000545953_chr1_27939861_-_1309nt
GGGGAATCGCGTAATGGCGGACACAGGCAGGGCGAGCGCGGCTGGGGGCGTAGCGCGCTGAGGGGGTCCGGCCGTTTGGCAGCCCGCGAG
GCGGTCCGCGGGAGCACACTCTGTGCGGAGACTGGGCGGCCGGCCGACCCTTCCTGTCGCTGACGGCGACTGCGGGAGGCCAGGTTGTTT
TTCACCATTCAGAACATTGCCTGAAGCAGGTCCACCATGCCGTTAGTAACGAGGAACATCGAGCCAAGGCACCTGTGCCGTCAGACGTTG
CCTAGCGTTAGAAGCGAGCTGGAATGCGTGACCAACATCACCCTGGCAAATGTCATCCGACAGCTGGGCAGCCTGAGTTCCAAGTTCCCC
ATCAAGTGGACAGCCCCAGAAGCTGCCCTCTTTGGCAGATTCACCATCAAGTCAGACGTGTGGTCCTTTGGGATCCTGCTCACTGAGCTC
ATCACCAAGGGCCGAATCCCCTACCCAGGCATGAATAAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCTCCA
GGCTGCCCAGCATCCCTGTACGAGGCCATGGAACAGACCTGGCGTCTGGACCCGGAGGAGAGGCCTACCTTCGAGTACCTGCAGTCCTTC
CTGGAGGACTACTTCACCTCCGCTGAACCACAGTACCAGCCCGGGGATCAGACATAGCCTGTCCGGGCATCAACCCTCTCTGGCGGTGGC
CACCAGTCCTTGCCAATCCCCAGAGCTGTTCTTCCAAAGCCCCCAGGCTGGCTTAGAACCCCATAGAGTCCTAGCATCACCGAGGACGTG
GCTGCTCTGACACCACCTAGGGCAACCTACTTGTTTTACAGATGGGGCAAAAGGAGGCCCAGAGCTGATCTCTCATCCGCTCTGGCCCCA
AGCACTATTTCTTCCTTTTCCACTTAGGCCCCTACATGCCTGTAGCCTTTCTCACTCCATCCCCACCCAAAGTGCTCAGACCTTGTCTAG
TTATTTATAAAACTGTATGTACCTCCCTCACTTCTCTCCTATCACTGCTTTCCTACTCTCCTTTTATCTCACTCTAGTCCAGGTGCCAAG
AATTTCCCTTCTACCCTCTATTCTCTTGTGTCTGTAAGTTACAAAGTCAGGAAAAGTCTTGGCTGGACCCCTTTCCTGCTGGGTGGATGC
AGTGGTCCAGGACTGGGGTCTGGGCCCAGGTTTGAGGGAGAAGGTTGCAGAGCACTTCCCACCTCTCTGAATAGTGTGTATGTGTTGGTT

>In-frame_WASF2_ENST00000430629_chr1_27755271_-_FGR_ENST00000374004_chr1_27939861_-_1301nt
GGGGAATCGCGTAATGGCGGACACAGGCAGGGCGAGCGCGGCTGGGGGCGTAGCGCGCTGAGGGGGTCCGGCCGTTTGGCAGCCCGCGAG
GCGGTCCGCGGGAGCACACTCTGTGCGGAGACTGGGCGGCCGGCCGACCCTTCCTGTCGCTGACGGCGACTGCGGGAGGCCAGGTTGTTT
TTCACCATTCAGAACATTGCCTGAAGCAGGTCCACCATGCCGTTAGTAACGAGGAACATCGAGCCAAGGCACCTGTGCCGTCAGACGTTG
CCTAGCGTTAGAAGCGAGCTGGAATGCGTGACCAACATCACCCTGGCAAATGTCATCCGACAGCTGGGCAGCCTGAGTTCCAAGTTCCCC
ATCAAGTGGACAGCCCCAGAAGCTGCCCTCTTTGGCAGATTCACCATCAAGTCAGACGTGTGGTCCTTTGGGATCCTGCTCACTGAGCTC
ATCACCAAGGGCCGAATCCCCTACCCAGGCATGAATAAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCTCCA
GGCTGCCCAGCATCCCTGTACGAGGCCATGGAACAGACCTGGCGTCTGGACCCGGAGGAGAGGCCTACCTTCGAGTACCTGCAGTCCTTC
CTGGAGGACTACTTCACCTCCGCTGAACCACAGTACCAGCCCGGGGATCAGACATAGCCTGTCCGGGCATCAACCCTCTCTGGCGGTGGC
CACCAGTCCTTGCCAATCCCCAGAGCTGTTCTTCCAAAGCCCCCAGGCTGGCTTAGAACCCCATAGAGTCCTAGCATCACCGAGGACGTG
GCTGCTCTGACACCACCTAGGGCAACCTACTTGTTTTACAGATGGGGCAAAAGGAGGCCCAGAGCTGATCTCTCATCCGCTCTGGCCCCA
AGCACTATTTCTTCCTTTTCCACTTAGGCCCCTACATGCCTGTAGCCTTTCTCACTCCATCCCCACCCAAAGTGCTCAGACCTTGTCTAG
TTATTTATAAAACTGTATGTACCTCCCTCACTTCTCTCCTATCACTGCTTTCCTACTCTCCTTTTATCTCACTCTAGTCCAGGTGCCAAG
AATTTCCCTTCTACCCTCTATTCTCTTGTGTCTGTAAGTTACAAAGTCAGGAAAAGTCTTGGCTGGACCCCTTTCCTGCTGGGTGGATGC
AGTGGTCCAGGACTGGGGTCTGGGCCCAGGTTTGAGGGAGAAGGTTGCAGAGCACTTCCCACCTCTCTGAATAGTGTGTATGTGTTGGTT

>In-frame_WASF2_ENST00000536657_chr1_27755271_-_FGR_ENST00000374005_chr1_27939861_-_1430nt
ACTCTGTGCGGAGACTGGGCGGCCGGCCGACCCTTCCTGTCGCTGACGGCGACTGCGGGAGGCCAGGTTGTTTTTCACCATTCAGAACAT
TGCCTGAAGCAGGTCCACCATGCCGTTAGTAACGAGGAACATCGAGCCAAGGCACCTGTGCCGTCAGACGTTGCCTAGCGTTAGAAGCGA
GCTGGAATGCGTGACCAACATCACCCTGGCAAATGTCATCCGACAGCTGGGCAGCCTGAGTTCCAAGTTCCCCATCAAGTGGACAGCCCC
AGAAGCTGCCCTCTTTGGCAGATTCACCATCAAGTCAGACGTGTGGTCCTTTGGGATCCTGCTCACTGAGCTCATCACCAAGGGCCGAAT
CCCCTACCCAGGCATGAATAAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCTCCAGGCTGCCCAGCATCCCT
GTACGAGGCCATGGAACAGACCTGGCGTCTGGACCCGGAGGAGAGGCCTACCTTCGAGTACCTGCAGTCCTTCCTGGAGGACTACTTCAC
CTCCGCTGAACCACAGTACCAGCCCGGGGATCAGACATAGCCTGTCCGGGCATCAACCCTCTCTGGCGGTGGCCACCAGTCCTTGCCAAT
CCCCAGAGCTGTTCTTCCAAAGCCCCCAGGCTGGCTTAGAACCCCATAGAGTCCTAGCATCACCGAGGACGTGGCTGCTCTGACACCACC
TAGGGCAACCTACTTGTTTTACAGATGGGGCAAAAGGAGGCCCAGAGCTGATCTCTCATCCGCTCTGGCCCCAAGCACTATTTCTTCCTT
TTCCACTTAGGCCCCTACATGCCTGTAGCCTTTCTCACTCCATCCCCACCCAAAGTGCTCAGACCTTGTCTAGTTATTTATAAAACTGTA
TGTACCTCCCTCACTTCTCTCCTATCACTGCTTTCCTACTCTCCTTTTATCTCACTCTAGTCCAGGTGCCAAGAATTTCCCTTCTACCCT
CTATTCTCTTGTGTCTGTAAGTTACAAAGTCAGGAAAAGTCTTGGCTGGACCCCTTTCCTGCTGGGTGGATGCAGTGGTCCAGGACTGGG
GTCTGGGCCCAGGTTTGAGGGAGAAGGTTGCAGAGCACTTCCCACCTCTCTGAATAGTGTGTATGTGTTGGTTTATTGATTCTGTAAATA
AGTAAAATGACAATATGAATCCTCAAACCATGAAATACCCTTGAACCTTCCTTTGGGAGCGGGGGTGGTCAATAGGGGGTGAACGGACAG
ATATGGCTACAGGCAGCAGCAGGGGAAGCTGGAGAGGGCCCTAATGCCTACCAAGCACGGGGCATCCAAGGTGTGGAGTTTTAGAACACC

>In-frame_WASF2_ENST00000536657_chr1_27755271_-_FGR_ENST00000399173_chr1_27939861_-_1202nt
ACTCTGTGCGGAGACTGGGCGGCCGGCCGACCCTTCCTGTCGCTGACGGCGACTGCGGGAGGCCAGGTTGTTTTTCACCATTCAGAACAT
TGCCTGAAGCAGGTCCACCATGCCGTTAGTAACGAGGAACATCGAGCCAAGGCACCTGTGCCGTCAGACGTTGCCTAGCGTTAGAAGCGA
GCTGGAATGCGTGACCAACATCACCCTGGCAAATGTCATCCGACAGCTGGGCAGCCTGAGTTCCAAGTTCCCCATCAAGTGGACAGCCCC
AGAAGCTGCCCTCTTTGGCAGATTCACCATCAAGTCAGACGTGTGGTCCTTTGGGATCCTGCTCACTGAGCTCATCACCAAGGGCCGAAT
CCCCTACCCAGGCATGAATAAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCTCCAGGCTGCCCAGCATCCCT
GTACGAGGCCATGGAACAGACCTGGCGTCTGGACCCGGAGGAGAGGCCTACCTTCGAGTACCTGCAGTCCTTCCTGGAGGACTACTTCAC
CTCCGCTGAACCACAGTACCAGCCCGGGGATCAGACATAGCCTGTCCGGGCATCAACCCTCTCTGGCGGTGGCCACCAGTCCTTGCCAAT
CCCCAGAGCTGTTCTTCCAAAGCCCCCAGGCTGGCTTAGAACCCCATAGAGTCCTAGCATCACCGAGGACGTGGCTGCTCTGACACCACC
TAGGGCAACCTACTTGTTTTACAGATGGGGCAAAAGGAGGCCCAGAGCTGATCTCTCATCCGCTCTGGCCCCAAGCACTATTTCTTCCTT
TTCCACTTAGGCCCCTACATGCCTGTAGCCTTTCTCACTCCATCCCCACCCAAAGTGCTCAGACCTTGTCTAGTTATTTATAAAACTGTA
TGTACCTCCCTCACTTCTCTCCTATCACTGCTTTCCTACTCTCCTTTTATCTCACTCTAGTCCAGGTGCCAAGAATTTCCCTTCTACCCT
CTATTCTCTTGTGTCTGTAAGTTACAAAGTCAGGAAAAGTCTTGGCTGGACCCCTTTCCTGCTGGGTGGATGCAGTGGTCCAGGACTGGG
GTCTGGGCCCAGGTTTGAGGGAGAAGGTTGCAGAGCACTTCCCACCTCTCTGAATAGTGTGTATGTGTTGGTTTATTGATTCTGTAAATA

>In-frame_WASF2_ENST00000536657_chr1_27755271_-_FGR_ENST00000545953_chr1_27939861_-_1202nt
ACTCTGTGCGGAGACTGGGCGGCCGGCCGACCCTTCCTGTCGCTGACGGCGACTGCGGGAGGCCAGGTTGTTTTTCACCATTCAGAACAT
TGCCTGAAGCAGGTCCACCATGCCGTTAGTAACGAGGAACATCGAGCCAAGGCACCTGTGCCGTCAGACGTTGCCTAGCGTTAGAAGCGA
GCTGGAATGCGTGACCAACATCACCCTGGCAAATGTCATCCGACAGCTGGGCAGCCTGAGTTCCAAGTTCCCCATCAAGTGGACAGCCCC
AGAAGCTGCCCTCTTTGGCAGATTCACCATCAAGTCAGACGTGTGGTCCTTTGGGATCCTGCTCACTGAGCTCATCACCAAGGGCCGAAT
CCCCTACCCAGGCATGAATAAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCTCCAGGCTGCCCAGCATCCCT
GTACGAGGCCATGGAACAGACCTGGCGTCTGGACCCGGAGGAGAGGCCTACCTTCGAGTACCTGCAGTCCTTCCTGGAGGACTACTTCAC
CTCCGCTGAACCACAGTACCAGCCCGGGGATCAGACATAGCCTGTCCGGGCATCAACCCTCTCTGGCGGTGGCCACCAGTCCTTGCCAAT
CCCCAGAGCTGTTCTTCCAAAGCCCCCAGGCTGGCTTAGAACCCCATAGAGTCCTAGCATCACCGAGGACGTGGCTGCTCTGACACCACC
TAGGGCAACCTACTTGTTTTACAGATGGGGCAAAAGGAGGCCCAGAGCTGATCTCTCATCCGCTCTGGCCCCAAGCACTATTTCTTCCTT
TTCCACTTAGGCCCCTACATGCCTGTAGCCTTTCTCACTCCATCCCCACCCAAAGTGCTCAGACCTTGTCTAGTTATTTATAAAACTGTA
TGTACCTCCCTCACTTCTCTCCTATCACTGCTTTCCTACTCTCCTTTTATCTCACTCTAGTCCAGGTGCCAAGAATTTCCCTTCTACCCT
CTATTCTCTTGTGTCTGTAAGTTACAAAGTCAGGAAAAGTCTTGGCTGGACCCCTTTCCTGCTGGGTGGATGCAGTGGTCCAGGACTGGG
GTCTGGGCCCAGGTTTGAGGGAGAAGGTTGCAGAGCACTTCCCACCTCTCTGAATAGTGTGTATGTGTTGGTTTATTGATTCTGTAAATA

>In-frame_WASF2_ENST00000536657_chr1_27755271_-_FGR_ENST00000374004_chr1_27939861_-_1194nt
ACTCTGTGCGGAGACTGGGCGGCCGGCCGACCCTTCCTGTCGCTGACGGCGACTGCGGGAGGCCAGGTTGTTTTTCACCATTCAGAACAT
TGCCTGAAGCAGGTCCACCATGCCGTTAGTAACGAGGAACATCGAGCCAAGGCACCTGTGCCGTCAGACGTTGCCTAGCGTTAGAAGCGA
GCTGGAATGCGTGACCAACATCACCCTGGCAAATGTCATCCGACAGCTGGGCAGCCTGAGTTCCAAGTTCCCCATCAAGTGGACAGCCCC
AGAAGCTGCCCTCTTTGGCAGATTCACCATCAAGTCAGACGTGTGGTCCTTTGGGATCCTGCTCACTGAGCTCATCACCAAGGGCCGAAT
CCCCTACCCAGGCATGAATAAACGGGAAGTGTTGGAACAGGTGGAGCAGGGCTACCACATGCCGTGCCCTCCAGGCTGCCCAGCATCCCT
GTACGAGGCCATGGAACAGACCTGGCGTCTGGACCCGGAGGAGAGGCCTACCTTCGAGTACCTGCAGTCCTTCCTGGAGGACTACTTCAC
CTCCGCTGAACCACAGTACCAGCCCGGGGATCAGACATAGCCTGTCCGGGCATCAACCCTCTCTGGCGGTGGCCACCAGTCCTTGCCAAT
CCCCAGAGCTGTTCTTCCAAAGCCCCCAGGCTGGCTTAGAACCCCATAGAGTCCTAGCATCACCGAGGACGTGGCTGCTCTGACACCACC
TAGGGCAACCTACTTGTTTTACAGATGGGGCAAAAGGAGGCCCAGAGCTGATCTCTCATCCGCTCTGGCCCCAAGCACTATTTCTTCCTT
TTCCACTTAGGCCCCTACATGCCTGTAGCCTTTCTCACTCCATCCCCACCCAAAGTGCTCAGACCTTGTCTAGTTATTTATAAAACTGTA
TGTACCTCCCTCACTTCTCTCCTATCACTGCTTTCCTACTCTCCTTTTATCTCACTCTAGTCCAGGTGCCAAGAATTTCCCTTCTACCCT
CTATTCTCTTGTGTCTGTAAGTTACAAAGTCAGGAAAAGTCTTGGCTGGACCCCTTTCCTGCTGGGTGGATGCAGTGGTCCAGGACTGGG
GTCTGGGCCCAGGTTTGAGGGAGAAGGTTGCAGAGCACTTCCCACCTCTCTGAATAGTGTGTATGTGTTGGTTTATTGATTCTGTAAATA


Top

FusionGenePPI for WASF2_FGR


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
WASF2ACTR3, BAIAP2, RYK, ITSN2, WASL, KLF16, YWHAQ, TCERG1, PRPF40A, APBB1, GAS7, POLD1, ZDHHC17, ABI3, ABI1, ABI2, ZNF511, NCK2, LHX4, CYFIP1, CYFIP2, NCKAP1, NTRK1, CEP19, TMEM17, TCF4, CDH1, TIMM50, NHSL2, AMZ1, CCDC53, CBLC, GJB7, HOMER3, CCDC27, EVL, TRIM25FGRWAS, DOK1, CCR3, HCLS1, PTK2, SLAMF1, CBL, SYK, CD24, DAB2, FASLG, IKBKG, KHDRBS1, SH3KBP1, HSP90AA1, ERBB2, STAT3, NR1I2, EGFR, CDK18, CDK9, SMURF1, YES1, CDK14


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for WASF2_FGR


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneFGRP09769DB01254DasatinibTyrosine-protein kinase Fgrsmall moleculeapproved|investigational

Top

RelatedDiseases for WASF2_FGR


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneFGRC0023893Liver Cirrhosis, Experimental1CTD_human