FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4152

FusionGeneSummary for BICC1_FGFR2

check button Fusion gene summary
Fusion gene informationFusion gene name: BICC1_FGFR2
Fusion gene ID: 4152
HgeneTgene
Gene symbol

BICC1

FGFR2

Gene ID

80114

2263

Gene nameBicC family RNA binding protein 1fibroblast growth factor receptor 2
SynonymsBICC|CYSRDBBDS|BEK|BFR-1|CD332|CEK3|CFD1|ECT1|JWS|K-SAM|KGFR|TK14|TK25
Cytomap

10q21.1

10q26.13

Type of geneprotein-codingprotein-coding
Descriptionprotein bicaudal C homolog 1FGFR2-BICC1 fusion kinase proteinbicaudal C homolog 1fibroblast growth factor receptor 2BEK fibroblast growth factor receptorbacteria-expressed kinasekeratinocyte growth factor receptorprotein tyrosine kinase, receptor like 14
Modification date2018051920180527
UniProtAcc

Q9H694

P21802

Ensembl transtripts involved in fusion geneENST00000373886, ENST00000263103, 
ENST00000476684, 
ENST00000369061, 
ENST00000357555, ENST00000358487, 
ENST00000356226, ENST00000369060, 
ENST00000369059, ENST00000346997, 
ENST00000457416, ENST00000351936, 
ENST00000360144, ENST00000369056, 
ENST00000490349, ENST00000359354, 
ENST00000478859, 
Fusion gene scores* DoF score8 X 8 X 5=3207 X 6 X 7=294
# samples 811
** MAII scorelog2(8/320*10)=-2
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/294*10)=-1.4183126313117
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: BICC1 [Title/Abstract] AND FGFR2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneBICC1

GO:0090090

negative regulation of canonical Wnt signaling pathway

21922595

TgeneFGFR2

GO:0008284

positive regulation of cell proliferation

8663044

TgeneFGFR2

GO:0008543

fibroblast growth factor receptor signaling pathway

8663044|15629145

TgeneFGFR2

GO:0018108

peptidyl-tyrosine phosphorylation

15629145|16844695

TgeneFGFR2

GO:0046777

protein autophosphorylation

15629145


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCHOLTCGA-W5-AA2W-01ABICC1chr10

60563002

+FGFR2chr10

123239535

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000373886ENST00000369061BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000373886ENST00000357555BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000373886ENST00000358487BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000373886ENST00000356226BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000373886ENST00000369060BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000373886ENST00000369059BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000373886ENST00000346997BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000373886ENST00000457416BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000373886ENST00000351936BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000373886ENST00000360144BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000373886ENST00000369056BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000373886ENST00000490349BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000373886ENST00000359354BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000373886ENST00000478859BICC1chr10

60563002

+FGFR2chr10

123239535

-
In-frameENST00000263103ENST00000369061BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000263103ENST00000357555BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000263103ENST00000358487BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000263103ENST00000356226BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000263103ENST00000369060BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000263103ENST00000369059BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000263103ENST00000346997BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000263103ENST00000457416BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000263103ENST00000351936BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000263103ENST00000360144BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000263103ENST00000369056BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000263103ENST00000490349BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000263103ENST00000359354BICC1chr10

60563002

+FGFR2chr10

123239535

-
5CDS-intronENST00000263103ENST00000478859BICC1chr10

60563002

+FGFR2chr10

123239535

-
intron-3CDSENST00000476684ENST00000369061BICC1chr10

60563002

+FGFR2chr10

123239535

-
intron-intronENST00000476684ENST00000357555BICC1chr10

60563002

+FGFR2chr10

123239535

-
intron-intronENST00000476684ENST00000358487BICC1chr10

60563002

+FGFR2chr10

123239535

-
intron-intronENST00000476684ENST00000356226BICC1chr10

60563002

+FGFR2chr10

123239535

-
intron-intronENST00000476684ENST00000369060BICC1chr10

60563002

+FGFR2chr10

123239535

-
intron-intronENST00000476684ENST00000369059BICC1chr10

60563002

+FGFR2chr10

123239535

-
intron-intronENST00000476684ENST00000346997BICC1chr10

60563002

+FGFR2chr10

123239535

-
intron-intronENST00000476684ENST00000457416BICC1chr10

60563002

+FGFR2chr10

123239535

-
intron-intronENST00000476684ENST00000351936BICC1chr10

60563002

+FGFR2chr10

123239535

-
intron-intronENST00000476684ENST00000360144BICC1chr10

60563002

+FGFR2chr10

123239535

-
intron-intronENST00000476684ENST00000369056BICC1chr10

60563002

+FGFR2chr10

123239535

-
intron-intronENST00000476684ENST00000490349BICC1chr10

60563002

+FGFR2chr10

123239535

-
intron-intronENST00000476684ENST00000359354BICC1chr10

60563002

+FGFR2chr10

123239535

-
intron-intronENST00000476684ENST00000478859BICC1chr10

60563002

+FGFR2chr10

123239535

-

Top

FusionProtFeatures for BICC1_FGFR2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BICC1

Q9H694

FGFR2

P21802

Putative RNA-binding protein. Acts as a negativeregulator of Wnt signaling. May be involved in regulating geneexpression during embryonic development.{ECO:0000269|PubMed:21922595}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBICC1chr10:60563002chr10:123239535ENST00000373886+1521132_199727975DomainKH 1
HgeneBICC1chr10:60563002chr10:123239535ENST00000373886+1521284_348727975DomainKH 2
TgeneFGFR2chr10:60563002chr10:123239535ENST00000351936-018154_247-216786DomainNote=Ig-like C2-type 2
TgeneFGFR2chr10:60563002chr10:123239535ENST00000351936-018256_358-216786DomainNote=Ig-like C2-type 3
TgeneFGFR2chr10:60563002chr10:123239535ENST00000351936-01825_125-216786DomainNote=Ig-like C2-type 1
TgeneFGFR2chr10:60563002chr10:123239535ENST00000351936-018481_770-216786DomainProtein kinase
TgeneFGFR2chr10:60563002chr10:123239535ENST00000357555-017154_247-107708DomainNote=Ig-like C2-type 2
TgeneFGFR2chr10:60563002chr10:123239535ENST00000357555-017256_358-107708DomainNote=Ig-like C2-type 3
TgeneFGFR2chr10:60563002chr10:123239535ENST00000357555-01725_125-107708DomainNote=Ig-like C2-type 1
TgeneFGFR2chr10:60563002chr10:123239535ENST00000357555-017481_770-107708DomainProtein kinase
TgeneFGFR2chr10:60563002chr10:123239535ENST00000359354-07154_247-163255DomainNote=Ig-like C2-type 2
TgeneFGFR2chr10:60563002chr10:123239535ENST00000359354-07256_358-163255DomainNote=Ig-like C2-type 3
TgeneFGFR2chr10:60563002chr10:123239535ENST00000359354-0725_125-163255DomainNote=Ig-like C2-type 1
TgeneFGFR2chr10:60563002chr10:123239535ENST00000359354-07481_770-163255DomainProtein kinase
TgeneFGFR2chr10:60563002chr10:123239535ENST00000360144-017154_247-207681DomainNote=Ig-like C2-type 2
TgeneFGFR2chr10:60563002chr10:123239535ENST00000360144-017256_358-207681DomainNote=Ig-like C2-type 3
TgeneFGFR2chr10:60563002chr10:123239535ENST00000360144-01725_125-207681DomainNote=Ig-like C2-type 1
TgeneFGFR2chr10:60563002chr10:123239535ENST00000360144-017481_770-207681DomainProtein kinase
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369056-017154_247-8770DomainNote=Ig-like C2-type 2
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369056-017256_358-8770DomainNote=Ig-like C2-type 3
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369056-01725_125-8770DomainNote=Ig-like C2-type 1
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369056-017481_770-8770DomainProtein kinase
TgeneFGFR2chr10:60563002chr10:123239535ENST00000351936-018487_495-216786Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000351936-018565_567-216786Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000357555-017487_495-107708Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000357555-017565_567-107708Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000359354-07487_495-163255Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000359354-07565_567-163255Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000360144-017487_495-207681Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000360144-017565_567-207681Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369056-017487_495-8770Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369056-017565_567-8770Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000351936-018161_178-216786RegionNote=Heparin-binding
TgeneFGFR2chr10:60563002chr10:123239535ENST00000357555-017161_178-107708RegionNote=Heparin-binding
TgeneFGFR2chr10:60563002chr10:123239535ENST00000359354-07161_178-163255RegionNote=Heparin-binding
TgeneFGFR2chr10:60563002chr10:123239535ENST00000360144-017161_178-207681RegionNote=Heparin-binding
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369056-017161_178-8770RegionNote=Heparin-binding
TgeneFGFR2chr10:60563002chr10:123239535ENST00000351936-01822_377-216786Topological domainExtracellular
TgeneFGFR2chr10:60563002chr10:123239535ENST00000351936-018399_821-216786Topological domainCytoplasmic
TgeneFGFR2chr10:60563002chr10:123239535ENST00000357555-01722_377-107708Topological domainExtracellular
TgeneFGFR2chr10:60563002chr10:123239535ENST00000357555-017399_821-107708Topological domainCytoplasmic
TgeneFGFR2chr10:60563002chr10:123239535ENST00000359354-0722_377-163255Topological domainExtracellular
TgeneFGFR2chr10:60563002chr10:123239535ENST00000359354-07399_821-163255Topological domainCytoplasmic
TgeneFGFR2chr10:60563002chr10:123239535ENST00000360144-01722_377-207681Topological domainExtracellular
TgeneFGFR2chr10:60563002chr10:123239535ENST00000360144-017399_821-207681Topological domainCytoplasmic
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369056-01722_377-8770Topological domainExtracellular
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369056-017399_821-8770Topological domainCytoplasmic
TgeneFGFR2chr10:60563002chr10:123239535ENST00000351936-018378_398-216786TransmembraneHelical
TgeneFGFR2chr10:60563002chr10:123239535ENST00000357555-017378_398-107708TransmembraneHelical
TgeneFGFR2chr10:60563002chr10:123239535ENST00000359354-07378_398-163255TransmembraneHelical
TgeneFGFR2chr10:60563002chr10:123239535ENST00000360144-017378_398-207681TransmembraneHelical
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369056-017378_398-8770TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBICC1chr10:60563002chr10:123239535ENST00000373886+1521873_936727975DomainSAM
TgeneFGFR2chr10:60563002chr10:123239535ENST00000346997-1517154_247765820DomainNote=Ig-like C2-type 2
TgeneFGFR2chr10:60563002chr10:123239535ENST00000346997-1517256_358765820DomainNote=Ig-like C2-type 3
TgeneFGFR2chr10:60563002chr10:123239535ENST00000346997-151725_125765820DomainNote=Ig-like C2-type 1
TgeneFGFR2chr10:60563002chr10:123239535ENST00000346997-1517481_770765820DomainProtein kinase
TgeneFGFR2chr10:60563002chr10:123239535ENST00000356226-1416154_247650705DomainNote=Ig-like C2-type 2
TgeneFGFR2chr10:60563002chr10:123239535ENST00000356226-1416256_358650705DomainNote=Ig-like C2-type 3
TgeneFGFR2chr10:60563002chr10:123239535ENST00000356226-141625_125650705DomainNote=Ig-like C2-type 1
TgeneFGFR2chr10:60563002chr10:123239535ENST00000356226-1416481_770650705DomainProtein kinase
TgeneFGFR2chr10:60563002chr10:123239535ENST00000358487-1618154_247767822DomainNote=Ig-like C2-type 2
TgeneFGFR2chr10:60563002chr10:123239535ENST00000358487-1618256_358767822DomainNote=Ig-like C2-type 3
TgeneFGFR2chr10:60563002chr10:123239535ENST00000358487-161825_125767822DomainNote=Ig-like C2-type 1
TgeneFGFR2chr10:60563002chr10:123239535ENST00000358487-1618481_770767822DomainProtein kinase
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369060-1416154_247651706DomainNote=Ig-like C2-type 2
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369060-1416256_358651706DomainNote=Ig-like C2-type 3
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369060-141625_125651706DomainNote=Ig-like C2-type 1
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369060-1416481_770651706DomainProtein kinase
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369061-1315154_247655710DomainNote=Ig-like C2-type 2
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369061-1315256_358655710DomainNote=Ig-like C2-type 3
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369061-131525_125655710DomainNote=Ig-like C2-type 1
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369061-1315481_770655710DomainProtein kinase
TgeneFGFR2chr10:60563002chr10:123239535ENST00000457416-1618154_247768823DomainNote=Ig-like C2-type 2
TgeneFGFR2chr10:60563002chr10:123239535ENST00000457416-1618256_358768823DomainNote=Ig-like C2-type 3
TgeneFGFR2chr10:60563002chr10:123239535ENST00000457416-161825_125768823DomainNote=Ig-like C2-type 1
TgeneFGFR2chr10:60563002chr10:123239535ENST00000457416-1618481_770768823DomainProtein kinase
TgeneFGFR2chr10:60563002chr10:123239535ENST00000346997-1517487_495765820Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000346997-1517565_567765820Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000356226-1416487_495650705Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000356226-1416565_567650705Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000358487-1618487_495767822Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000358487-1618565_567767822Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369060-1416487_495651706Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369060-1416565_567651706Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369061-1315487_495655710Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369061-1315565_567655710Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000457416-1618487_495768823Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000457416-1618565_567768823Nucleotide bindingATP
TgeneFGFR2chr10:60563002chr10:123239535ENST00000346997-1517161_178765820RegionNote=Heparin-binding
TgeneFGFR2chr10:60563002chr10:123239535ENST00000356226-1416161_178650705RegionNote=Heparin-binding
TgeneFGFR2chr10:60563002chr10:123239535ENST00000358487-1618161_178767822RegionNote=Heparin-binding
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369060-1416161_178651706RegionNote=Heparin-binding
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369061-1315161_178655710RegionNote=Heparin-binding
TgeneFGFR2chr10:60563002chr10:123239535ENST00000457416-1618161_178768823RegionNote=Heparin-binding
TgeneFGFR2chr10:60563002chr10:123239535ENST00000346997-151722_377765820Topological domainExtracellular
TgeneFGFR2chr10:60563002chr10:123239535ENST00000346997-1517399_821765820Topological domainCytoplasmic
TgeneFGFR2chr10:60563002chr10:123239535ENST00000356226-141622_377650705Topological domainExtracellular
TgeneFGFR2chr10:60563002chr10:123239535ENST00000356226-1416399_821650705Topological domainCytoplasmic
TgeneFGFR2chr10:60563002chr10:123239535ENST00000358487-161822_377767822Topological domainExtracellular
TgeneFGFR2chr10:60563002chr10:123239535ENST00000358487-1618399_821767822Topological domainCytoplasmic
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369060-141622_377651706Topological domainExtracellular
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369060-1416399_821651706Topological domainCytoplasmic
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369061-131522_377655710Topological domainExtracellular
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369061-1315399_821655710Topological domainCytoplasmic
TgeneFGFR2chr10:60563002chr10:123239535ENST00000457416-161822_377768823Topological domainExtracellular
TgeneFGFR2chr10:60563002chr10:123239535ENST00000457416-1618399_821768823Topological domainCytoplasmic
TgeneFGFR2chr10:60563002chr10:123239535ENST00000346997-1517378_398765820TransmembraneHelical
TgeneFGFR2chr10:60563002chr10:123239535ENST00000356226-1416378_398650705TransmembraneHelical
TgeneFGFR2chr10:60563002chr10:123239535ENST00000358487-1618378_398767822TransmembraneHelical
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369060-1416378_398651706TransmembraneHelical
TgeneFGFR2chr10:60563002chr10:123239535ENST00000369061-1315378_398655710TransmembraneHelical
TgeneFGFR2chr10:60563002chr10:123239535ENST00000457416-1618378_398768823TransmembraneHelical


Top

FusionGeneSequence for BICC1_FGFR2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BICC1_ENST00000373886_chr10_60563002_+_FGFR2_ENST00000369061_chr10_123239535_-_782aa
MAAQGEPGYLAAQSDPGSNSERSTDSPVPGSEDDLVAGATLHSPEWSEERFRVDRKKLEAMLQAAAEGKGRSGEDFFQKIMEETNTQIAW
PSKLKIGAKSKKDPHIKVSGKKEDVKEAKEMIMSVLDTKSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEETGCHIHFPDSNRNNQAEKS
NQVSIAGQPAGVESARVRIRELLPLVLMFELPIAGILQPVPDPNSPSIQHISQTYNISVSFKQRSRMTGATVIVRGSQNNTSAVKEGTAM
LLEHLAGSLASAIPVSTQLDIAAQHHLFMMGRNGSNIKHIMQRTGAQIHFPDPSNPQKKSTVYLQGTIESVCLARQTLMGCLPLVLMFDM
KEEIEVDPQFIAQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMTEARKCLLGLESSGVTIATSPSPASCPAGLACPSLDILASAGL
GLTGLGLLGPTTLSLNTSTTPNSLLNALNSSVSPLQSPSSGTPSPTLWAPPLANTSSATGFSAIPHLMIPSTAQATLTNILLSGVPTTGH
TAPSPPPGLTPVDVHINSMQTEGKKISAALNGHAQSPDIKTGAISTSSLGEKVLSANHGDPSIQTSGSEQTSPKSSPTEGCNDAFVEVGM
PRSPSHSGNAGDLKQMMCPSKVSCAKRQTVELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQNSERAHLAPR

>In-frame_BICC1_ENST00000263103_chr10_60563002_+_FGFR2_ENST00000369061_chr10_123239535_-_408aa
MEQLDVFISIKPKPKQPSKSVIVKSVERNALNMTEARKCLLGLESSGVTIATSPSPASCPAGLACPSLDILASAGLGLTGLGLLGPTTLS
LNTSTTPNSLLNALNSSVSPLQSPSSGTPSPTLWAPPLANTSSATGFSAIPHLMIPSTAQATLTNILLSGVPTTGHTAPSPPPGLTPVDV
HINSMQTEGKKISAALNGHAQSPDIKTGAISTSSLGEKVLSANHGDPSIQTSGSEQTSPKSSPTEGCNDAFVEVGMPRSPSHSGNAGDLK
QMMCPSKVSCAKRQTVELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQNSERAHLAPRSSTVNMQEYLDLSQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BICC1_ENST00000373886_chr10_60563002_+_FGFR2_ENST00000369061_chr10_123239535_-_2346nt
ATGGCCGCCCAGGGAGAGCCCGGCTACCTGGCGGCGCAGTCGGACCCCGGCTCCAACAGCGAGCGCAGCACCGACTCCCCAGTGCCCGGC
TCCGAGGACGACTTGGTCGCCGGGGCGACCCTGCACAGCCCGGAGTGGAGCGAGGAGCGCTTCCGCGTGGACAGGAAGAAACTTGAGGCC
ATGTTACAAGCTGCTGCTGAAGGGAAAGGCAGAAGTGGGGAAGACTTTTTTCAAAAGATCATGGAGGAAACAAATACGCAGATTGCTTGG
CCATCAAAACTGAAGATCGGAGCCAAATCCAAGAAAGATCCCCATATTAAGGTTTCTGGAAAGAAAGAAGATGTTAAAGAAGCCAAGGAA
ATGATCATGTCTGTCTTAGACACAAAAAGCAATCGAGTCACACTGAAGATGGATGTTTCACATACAGAACATTCACATGTAATCGGCAAA
GGTGGCAACAATATTAAAAAAGTGATGGAAGAAACCGGATGCCATATCCACTTTCCAGATTCCAACAGGAATAACCAAGCAGAAAAAAGC
AACCAGGTATCTATAGCGGGACAACCAGCAGGAGTAGAATCTGCCCGAGTTAGAATTCGGGAGCTGCTTCCTTTGGTGCTGATGTTTGAG
CTACCAATTGCTGGAATTCTTCAACCGGTTCCTGATCCTAATTCCCCCTCTATTCAGCATATATCACAAACGTACAATATTTCAGTATCA
TTTAAACAGCGTTCCCGAATGTATGGTGCTACTGTCATAGTACGAGGGTCTCAGAATAACACTAGTGCTGTGAAGGAAGGAACTGCCATG
CTGTTAGAACATCTTGCTGGGAGCTTAGCATCAGCTATTCCTGTGAGCACACAACTAGATATTGCAGCTCAACATCATCTCTTTATGATG
GGTCGAAATGGGAGCAACATCAAACATATCATGCAGAGAACAGGTGCTCAGATCCACTTTCCTGATCCCAGTAATCCACAAAAGAAATCT
ACCGTCTACCTCCAGGGCACCATTGAGTCTGTCTGTCTTGCAAGGCAATATCTCATGGGTTGTCTTCCTCTTGTGTTGATGTTTGATATG
AAGGAAGAAATTGAAGTAGATCCACAATTCATTGCGCAGTTGATGGAACAGCTTGATGTCTTCATCAGTATTAAACCAAAGCCCAAACAG
CCAAGCAAGTCTGTGATTGTGAAAAGTGTTGAGCGAAATGCCTTAAATATGTATGAAGCAAGGAAATGTCTCCTCGGACTTGAAAGCAGT
GGGGTTACCATAGCAACCAGTCCATCCCCAGCATCCTGCCCTGCCGGCCTGGCATGTCCCAGCCTGGATATCTTAGCTTCAGCAGGCCTT
GGACTCACTGGACTAGGTCTTTTGGGACCCACCACCTTATCTCTGAACACTTCAACAACCCCAAACTCACTCTTGAATGCTCTTAATAGC
TCAGTCAGTCCTTTGCAAAGTCCAAGTTCTGGTACACCCAGCCCCACATTATGGGCACCCCCACTTGCTAATACTTCAAGTGCCACAGGT
TTTTCTGCTATACCACACCTTATGATTCCATCTACTGCCCAAGCCACATTAACTAATATTTTGTTGTCTGGAGTGCCCACCTATGGGCAC
ACAGCTCCATCTCCCCCTCCTGGCTTGACTCCTGTTGATGTCCATATCAACAGTATGCAGACCGAAGGCAAAAAAATCTCTGCTGCTTTA
AATGGACATGCACAGTCTCCAGATATAAAATATGGTGCAATATCCACTTCATCACTTGGAGAAAAAGTGCTGAGTGCAAATCACGGGGAT
CCGTCCATCCAGACAAGTGGGTCTGAGCAGACATCTCCCAAATCAAGCCCCACTGAAGGTTGTAATGATGCTTTTGTTGAAGTAGGCATG
CCTCGAAGTCCTTCCCATTCTGGGAATGCTGGTGACTTGAAACAGATGATGTGTCCCTCCAAGGTTTCCTGTGCCAAAAGGCAGACAGTG
GAACTATTGCAAGGCACGAAAAACTCACACTTACACAGCACTGACAGGTTGCTCTCAGACCCTGAACTGAGTGCTACCGAAAGCCCTTTG
GCTGACAAGAAGGCTCCAGGGAGTGAGCGCGCTGCAGAGAGGGCAGCAGCTGCCCAGCAAAACTCCGAAAGGGCCCACCTTGCTCCACGG
TCATCATATGTCAACATGCAGGAATACTTGGACCTCAGCCAACCTCTCGAACAGTATTCACCTAGTTACCCTGACACAAGAAGTTCTTGT
TCTTCAGGAGATGATTCTGTTTTTTCTCCAGACCCCATGCCTTACGAACCATGCCTTCCTCAGTATCCACACATAAACGGCAGTGTTAAA

>In-frame_BICC1_ENST00000263103_chr10_60563002_+_FGFR2_ENST00000369061_chr10_123239535_-_1224nt
ATGGAACAGCTTGATGTCTTCATCAGTATTAAACCAAAGCCCAAACAGCCAAGCAAGTCTGTGATTGTGAAAAGTGTTGAGCGAAATGCC
TTAAATATGTATGAAGCAAGGAAATGTCTCCTCGGACTTGAAAGCAGTGGGGTTACCATAGCAACCAGTCCATCCCCAGCATCCTGCCCT
GCCGGCCTGGCATGTCCCAGCCTGGATATCTTAGCTTCAGCAGGCCTTGGACTCACTGGACTAGGTCTTTTGGGACCCACCACCTTATCT
CTGAACACTTCAACAACCCCAAACTCACTCTTGAATGCTCTTAATAGCTCAGTCAGTCCTTTGCAAAGTCCAAGTTCTGGTACACCCAGC
CCCACATTATGGGCACCCCCACTTGCTAATACTTCAAGTGCCACAGGTTTTTCTGCTATACCACACCTTATGATTCCATCTACTGCCCAA
GCCACATTAACTAATATTTTGTTGTCTGGAGTGCCCACCTATGGGCACACAGCTCCATCTCCCCCTCCTGGCTTGACTCCTGTTGATGTC
CATATCAACAGTATGCAGACCGAAGGCAAAAAAATCTCTGCTGCTTTAAATGGACATGCACAGTCTCCAGATATAAAATATGGTGCAATA
TCCACTTCATCACTTGGAGAAAAAGTGCTGAGTGCAAATCACGGGGATCCGTCCATCCAGACAAGTGGGTCTGAGCAGACATCTCCCAAA
TCAAGCCCCACTGAAGGTTGTAATGATGCTTTTGTTGAAGTAGGCATGCCTCGAAGTCCTTCCCATTCTGGGAATGCTGGTGACTTGAAA
CAGATGATGTGTCCCTCCAAGGTTTCCTGTGCCAAAAGGCAGACAGTGGAACTATTGCAAGGCACGAAAAACTCACACTTACACAGCACT
GACAGGTTGCTCTCAGACCCTGAACTGAGTGCTACCGAAAGCCCTTTGGCTGACAAGAAGGCTCCAGGGAGTGAGCGCGCTGCAGAGAGG
GCAGCAGCTGCCCAGCAAAACTCCGAAAGGGCCCACCTTGCTCCACGGTCATCATATGTCAACATGCAGGAATACTTGGACCTCAGCCAA
CCTCTCGAACAGTATTCACCTAGTTACCCTGACACAAGAAGTTCTTGTTCTTCAGGAGATGATTCTGTTTTTTCTCCAGACCCCATGCCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_BICC1_ENST00000373886_chr10_60563002_+_FGFR2_ENST00000369061_chr10_123239535_-_3873nt
CACCATGGCCGCCCAGGGAGAGCCCGGCTACCTGGCGGCGCAGTCGGACCCCGGCTCCAACAGCGAGCGCAGCACCGACTCCCCAGTGCC
CGGCTCCGAGGACGACTTGGTCGCCGGGGCGACCCTGCACAGCCCGGAGTGGAGCGAGGAGCGCTTCCGCGTGGACAGGAAGAAACTTGA
GGCCATGTTACAAGCTGCTGCTGAAGGGAAAGGCAGAAGTGGGGAAGACTTTTTTCAAAAGATCATGGAGGAAACAAATACGCAGATTGC
TTGGCCATCAAAACTGAAGATCGGAGCCAAATCCAAGAAAGATCCCCATATTAAGGTTTCTGGAAAGAAAGAAGATGTTAAAGAAGCCAA
GGAAATGATCATGTCTGTCTTAGACACAAAAAGCAATCGAGTCACACTGAAGATGGATGTTTCACATACAGAACATTCACATGTAATCGG
CAAAGGTGGCAACAATATTAAAAAAGTGATGGAAGAAACCGGATGCCATATCCACTTTCCAGATTCCAACAGGAATAACCAAGCAGAAAA
AAGCAACCAGGTATCTATAGCGGGACAACCAGCAGGAGTAGAATCTGCCCGAGTTAGAATTCGGGAGCTGCTTCCTTTGGTGCTGATGTT
TGAGCTACCAATTGCTGGAATTCTTCAACCGGTTCCTGATCCTAATTCCCCCTCTATTCAGCATATATCACAAACGTACAATATTTCAGT
ATCATTTAAACAGCGTTCCCGAATGTATGGTGCTACTGTCATAGTACGAGGGTCTCAGAATAACACTAGTGCTGTGAAGGAAGGAACTGC
CATGCTGTTAGAACATCTTGCTGGGAGCTTAGCATCAGCTATTCCTGTGAGCACACAACTAGATATTGCAGCTCAACATCATCTCTTTAT
GATGGGTCGAAATGGGAGCAACATCAAACATATCATGCAGAGAACAGGTGCTCAGATCCACTTTCCTGATCCCAGTAATCCACAAAAGAA
ATCTACCGTCTACCTCCAGGGCACCATTGAGTCTGTCTGTCTTGCAAGGCAATATCTCATGGGTTGTCTTCCTCTTGTGTTGATGTTTGA
TATGAAGGAAGAAATTGAAGTAGATCCACAATTCATTGCGCAGTTGATGGAACAGCTTGATGTCTTCATCAGTATTAAACCAAAGCCCAA
ACAGCCAAGCAAGTCTGTGATTGTGAAAAGTGTTGAGCGAAATGCCTTAAATATGTATGAAGCAAGGAAATGTCTCCTCGGACTTGAAAG
CAGTGGGGTTACCATAGCAACCAGTCCATCCCCAGCATCCTGCCCTGCCGGCCTGGCATGTCCCAGCCTGGATATCTTAGCTTCAGCAGG
CCTTGGACTCACTGGACTAGGTCTTTTGGGACCCACCACCTTATCTCTGAACACTTCAACAACCCCAAACTCACTCTTGAATGCTCTTAA
TAGCTCAGTCAGTCCTTTGCAAAGTCCAAGTTCTGGTACACCCAGCCCCACATTATGGGCACCCCCACTTGCTAATACTTCAAGTGCCAC
AGGTTTTTCTGCTATACCACACCTTATGATTCCATCTACTGCCCAAGCCACATTAACTAATATTTTGTTGTCTGGAGTGCCCACCTATGG
GCACACAGCTCCATCTCCCCCTCCTGGCTTGACTCCTGTTGATGTCCATATCAACAGTATGCAGACCGAAGGCAAAAAAATCTCTGCTGC
TTTAAATGGACATGCACAGTCTCCAGATATAAAATATGGTGCAATATCCACTTCATCACTTGGAGAAAAAGTGCTGAGTGCAAATCACGG
GGATCCGTCCATCCAGACAAGTGGGTCTGAGCAGACATCTCCCAAATCAAGCCCCACTGAAGGTTGTAATGATGCTTTTGTTGAAGTAGG
CATGCCTCGAAGTCCTTCCCATTCTGGGAATGCTGGTGACTTGAAACAGATGATGTGTCCCTCCAAGGTTTCCTGTGCCAAAAGGCAGAC
AGTGGAACTATTGCAAGGCACGAAAAACTCACACTTACACAGCACTGACAGGTTGCTCTCAGACCCTGAACTGAGTGCTACCGAAAGCCC
TTTGGCTGACAAGAAGGCTCCAGGGAGTGAGCGCGCTGCAGAGAGGGCAGCAGCTGCCCAGCAAAACTCCGAAAGGGCCCACCTTGCTCC
ACGGTCATCATATGTCAACATGCAGGAATACTTGGACCTCAGCCAACCTCTCGAACAGTATTCACCTAGTTACCCTGACACAAGAAGTTC
TTGTTCTTCAGGAGATGATTCTGTTTTTTCTCCAGACCCCATGCCTTACGAACCATGCCTTCCTCAGTATCCACACATAAACGGCAGTGT
TAAAACATGAATGACTGTGTCTGCCTGTCCCCAAACAGGACAGCACTGGGAACCTAGCTACACTGAGCAGGGAGACCATGCCTCCCAGAG
CTTGTTGTCTCCACTTGTATATATGGATCAGAGGAGTAAATAATTGGAAAAGTAATCAGCATATGTGTAAAGATTTATACAGTTGAAAAC
TTGTAATCTTCCCCAGGAGGAGAAGAAGGTTTCTGGAGCAGTGGACTGCCACAAGCCACCATGTAACCCCTCTCACCTGCCGTGCGTACT
GGCTGTGGACCAGTAGGACTCAAGGTGGACGTGCGTTCTGCCTTCCTTGTTAATTTTGTAATAATTGGAGAAGATTTATGTCAGCACACA
CTTACAGAGCACAAATGCAGTATATAGGTGCTGGATGTATGTAAATATATTCAAATTATGTATAAATATATATTATATATTTACAAGGAG
TTATTTTTTGTATTGATTTTAAATGGATGTCCCAATGCACCTAGAAAATTGGTCTCTCTTTTTTTAATAGCTATTTGCTAAATGCTGTTC
TTACACATAATTTCTTAATTTTCACCGAGCAGAGGTGGAAAAATACTTTTGCTTTCAGGGAAAATGGTATAACGTTAATTTATTAATAAA
TTGGTAATATACAAAACAATTAATCATTTATAGTTTTTTTTGTAATTTAAGTGGCATTTCTATGCAGGCAGCACAGCAGACTAGTTAATC
TATTGCTTGGACTTAACTAGTTATCAGATCCTTTGAAAAGAGAATATTTACAATATATGACTAATTTGGGGAAAATGAAGTTTTGATTTA
TTTGTGTTTAAATGCTGCTGTCAGACGATTGTTCTTAGACCTCCTAAATGCCCCATATTAAAAGAACTCATTCATAGGAAGGTGTTTCAT
TTTGGTGTGCAACCCTGTCATTACGTCAACGCAACGTCTAACTGGACTTCCCAAGATAAATGGTACCAGCGTCCTCTTAAAAGATGCCTT
AATCCATTCCTTGAGGACAGACCTTAGTTGAAATGATAGCAGAATGTGCTTCTCTCTGGCAGCTGGCCTTCTGCTTCTGAGTTGCACATT
AATCAGATTAGCCTGTATTCTCTTCAGTGAATTTTGATAATGGCTTCCAGACTCTTTGGCGTTGGAGACGCCTGTTAGGATCTTCAAGTC
CCATCATAGAAAATTGAAACACAGAGTTGTTCTGCTGATAGTTTTGGGGATACGTCCATCTTTTTAAGGGATTGCTTTCATCTAATTCTG
GCAGGACCTCACCAAAAGATCCAGCCTCATACCTACATCAGACAAAATATCGCCGTTGTTCCTTCTGTACTAAAGTATTGTGTTTTGCTT
TGGAAACACCCACTCACTTTGCAATAGCCGTGCAAGATGAATGCAGATTACACTGATCTTATGTGTTACAAAATTGGAGAAAGTATTTAA
TAAAACCTGTTAATTTTTATACTGACAATAAAAATGTTTCTACAGATATTAATGTTAACAAGACAAAATAAATGTCACGCAACTTATTTT

>In-frame_BICC1_ENST00000263103_chr10_60563002_+_FGFR2_ENST00000369061_chr10_123239535_-_2771nt
GATCCACAATTCATTGCGCAGTTGATGGAACAGCTTGATGTCTTCATCAGTATTAAACCAAAGCCCAAACAGCCAAGCAAGTCTGTGATT
GTGAAAAGTGTTGAGCGAAATGCCTTAAATATGTATGAAGCAAGGAAATGTCTCCTCGGACTTGAAAGCAGTGGGGTTACCATAGCAACC
AGTCCATCCCCAGCATCCTGCCCTGCCGGCCTGGCATGTCCCAGCCTGGATATCTTAGCTTCAGCAGGCCTTGGACTCACTGGACTAGGT
CTTTTGGGACCCACCACCTTATCTCTGAACACTTCAACAACCCCAAACTCACTCTTGAATGCTCTTAATAGCTCAGTCAGTCCTTTGCAA
AGTCCAAGTTCTGGTACACCCAGCCCCACATTATGGGCACCCCCACTTGCTAATACTTCAAGTGCCACAGGTTTTTCTGCTATACCACAC
CTTATGATTCCATCTACTGCCCAAGCCACATTAACTAATATTTTGTTGTCTGGAGTGCCCACCTATGGGCACACAGCTCCATCTCCCCCT
CCTGGCTTGACTCCTGTTGATGTCCATATCAACAGTATGCAGACCGAAGGCAAAAAAATCTCTGCTGCTTTAAATGGACATGCACAGTCT
CCAGATATAAAATATGGTGCAATATCCACTTCATCACTTGGAGAAAAAGTGCTGAGTGCAAATCACGGGGATCCGTCCATCCAGACAAGT
GGGTCTGAGCAGACATCTCCCAAATCAAGCCCCACTGAAGGTTGTAATGATGCTTTTGTTGAAGTAGGCATGCCTCGAAGTCCTTCCCAT
TCTGGGAATGCTGGTGACTTGAAACAGATGATGTGTCCCTCCAAGGTTTCCTGTGCCAAAAGGCAGACAGTGGAACTATTGCAAGGCACG
AAAAACTCACACTTACACAGCACTGACAGGTTGCTCTCAGACCCTGAACTGAGTGCTACCGAAAGCCCTTTGGCTGACAAGAAGGCTCCA
GGGAGTGAGCGCGCTGCAGAGAGGGCAGCAGCTGCCCAGCAAAACTCCGAAAGGGCCCACCTTGCTCCACGGTCATCATATGTCAACATG
CAGGAATACTTGGACCTCAGCCAACCTCTCGAACAGTATTCACCTAGTTACCCTGACACAAGAAGTTCTTGTTCTTCAGGAGATGATTCT
GTTTTTTCTCCAGACCCCATGCCTTACGAACCATGCCTTCCTCAGTATCCACACATAAACGGCAGTGTTAAAACATGAATGACTGTGTCT
GCCTGTCCCCAAACAGGACAGCACTGGGAACCTAGCTACACTGAGCAGGGAGACCATGCCTCCCAGAGCTTGTTGTCTCCACTTGTATAT
ATGGATCAGAGGAGTAAATAATTGGAAAAGTAATCAGCATATGTGTAAAGATTTATACAGTTGAAAACTTGTAATCTTCCCCAGGAGGAG
AAGAAGGTTTCTGGAGCAGTGGACTGCCACAAGCCACCATGTAACCCCTCTCACCTGCCGTGCGTACTGGCTGTGGACCAGTAGGACTCA
AGGTGGACGTGCGTTCTGCCTTCCTTGTTAATTTTGTAATAATTGGAGAAGATTTATGTCAGCACACACTTACAGAGCACAAATGCAGTA
TATAGGTGCTGGATGTATGTAAATATATTCAAATTATGTATAAATATATATTATATATTTACAAGGAGTTATTTTTTGTATTGATTTTAA
ATGGATGTCCCAATGCACCTAGAAAATTGGTCTCTCTTTTTTTAATAGCTATTTGCTAAATGCTGTTCTTACACATAATTTCTTAATTTT
CACCGAGCAGAGGTGGAAAAATACTTTTGCTTTCAGGGAAAATGGTATAACGTTAATTTATTAATAAATTGGTAATATACAAAACAATTA
ATCATTTATAGTTTTTTTTGTAATTTAAGTGGCATTTCTATGCAGGCAGCACAGCAGACTAGTTAATCTATTGCTTGGACTTAACTAGTT
ATCAGATCCTTTGAAAAGAGAATATTTACAATATATGACTAATTTGGGGAAAATGAAGTTTTGATTTATTTGTGTTTAAATGCTGCTGTC
AGACGATTGTTCTTAGACCTCCTAAATGCCCCATATTAAAAGAACTCATTCATAGGAAGGTGTTTCATTTTGGTGTGCAACCCTGTCATT
ACGTCAACGCAACGTCTAACTGGACTTCCCAAGATAAATGGTACCAGCGTCCTCTTAAAAGATGCCTTAATCCATTCCTTGAGGACAGAC
CTTAGTTGAAATGATAGCAGAATGTGCTTCTCTCTGGCAGCTGGCCTTCTGCTTCTGAGTTGCACATTAATCAGATTAGCCTGTATTCTC
TTCAGTGAATTTTGATAATGGCTTCCAGACTCTTTGGCGTTGGAGACGCCTGTTAGGATCTTCAAGTCCCATCATAGAAAATTGAAACAC
AGAGTTGTTCTGCTGATAGTTTTGGGGATACGTCCATCTTTTTAAGGGATTGCTTTCATCTAATTCTGGCAGGACCTCACCAAAAGATCC
AGCCTCATACCTACATCAGACAAAATATCGCCGTTGTTCCTTCTGTACTAAAGTATTGTGTTTTGCTTTGGAAACACCCACTCACTTTGC
AATAGCCGTGCAAGATGAATGCAGATTACACTGATCTTATGTGTTACAAAATTGGAGAAAGTATTTAATAAAACCTGTTAATTTTTATAC


Top

FusionGenePPI for BICC1_FGFR2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BICC1CAPZA2, TFGFGFR2FGF1, FGFR2, FGF7, FGF10, PIK3R1, ITGA5, STAT3, PGR, STAT5A, STAT5B, NEDD4, FRS2, CBL, LYN, FYN, HGS, APP, PPM1A, TSPAN3, C8orf74, BEX1, BEX2, ERRFI1, GLCE, HOXC6, MTA3, PDLIM2, RASL10B, RHOBTB2, S100A14, TFF1, FGF5, FGF23, FGF8, PLCG1, FGF2, FGF3, FGF6, FGF9, FGF17, PVRL1, BRAF, MAP3K1, PTPN6, PTPN11, PTPN12, PTPRR, FGFR3, FGFR1, SNX24, GAPVD1, SNX22, UBE4A, IP6K1, RPS6KA3, IFFO2, TMEM30B, DNAJC30, XPR1, GOLGA3, KIDINS220, BCL11A, CEP295, CD44, RPS6KA2, LRRIQ1, RPS6KA1, LITAF, MRAP2, SDC2, FCGRT, SIGLECL1, RAET1E, FAM171B, CHERP, U2SURP, SLC9A6, TIMP1, CCDC120, CD83, PKP4, UBXN4, CTDSP1, CTDSPL, DUSP14, MTMR3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BICC1_FGFR2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneFGFR2P21802DB00039PaliferminFibroblast growth factor receptor 2biotechapproved
TgeneFGFR2P21802DB08896RegorafenibFibroblast growth factor receptor 2small moleculeapproved
TgeneFGFR2P21802DB09079NintedanibFibroblast growth factor receptor 2small moleculeapproved
TgeneFGFR2P21802DB01109HeparinFibroblast growth factor receptor 2small moleculeapproved|investigational
TgeneFGFR2P21802DB08901PonatinibFibroblast growth factor receptor 2small moleculeapproved|investigational
TgeneFGFR2P21802DB09078LenvatinibFibroblast growth factor receptor 2small moleculeapproved|investigational
TgeneFGFR2P21802DB01041ThalidomideFibroblast growth factor receptor 2small moleculeapproved|investigational|withdrawn

Top

RelatedDiseases for BICC1_FGFR2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneBICC1C0011570Mental Depression2PSYGENET
HgeneBICC1C0011581Depressive disorder2PSYGENET
HgeneBICC1C3275898RENAL DYSPLASIA, CYSTIC, SUSCEPTIBILITY TO1UNIPROT
TgeneFGFR2C2931196Craniofacial dysostosis type 121ORPHANET;UNIPROT
TgeneFGFR2C0220658Pfeiffer Syndrome10UNIPROT
TgeneFGFR2C0001193Apert syndrome8ORPHANET;UNIPROT
TgeneFGFR2C1510455Acrocephalosyndactylia4CTD_human
TgeneFGFR2C0010278Craniosynostosis3CTD_human;HPO
TgeneFGFR2C0036341Schizophrenia3PSYGENET
TgeneFGFR2C0376634Craniofacial Abnormalities3CTD_human
TgeneFGFR2C1458155Mammary Neoplasms3CTD_human
TgeneFGFR2C0011570Mental Depression2PSYGENET
TgeneFGFR2C0011581Depressive disorder2PSYGENET
TgeneFGFR2C0038356Stomach Neoplasms2CTD_human
TgeneFGFR2C1865070SCAPHOCEPHALY, MAXILLARY RETRUSION, AND MENTAL RETARDATION2CTD_human;ORPHANET;UNIPROT
TgeneFGFR2C0003090Ankylosis1CTD_human
TgeneFGFR2C0005586Bipolar Disorder1PSYGENET
TgeneFGFR2C0008924Cleft Lip1CTD_human
TgeneFGFR2C0008925Cleft Palate1CTD_human;HPO
TgeneFGFR2C0010273Craniofacial Dysostosis1CTD_human;HPO
TgeneFGFR2C0014170Endometrial Neoplasms1CTD_human
TgeneFGFR2C0018553Hamartoma Syndrome, Multiple1CTD_human
TgeneFGFR2C0023890Liver Cirrhosis1CTD_human
TgeneFGFR2C0024121Lung Neoplasms1CTD_human
TgeneFGFR2C0026613Motor Skills Disorders1CTD_human
TgeneFGFR2C0033975Psychotic Disorders1PSYGENET
TgeneFGFR2C0037268Skin Abnormalities1CTD_human
TgeneFGFR2C0037274Dermatologic disorders1CTD_human
TgeneFGFR2C0040427Tooth Abnormalities1CTD_human
TgeneFGFR2C0080178Spina Bifida1CTD_human
TgeneFGFR2C0206698Cholangiocarcinoma1CTD_human
TgeneFGFR2C0206762Limb Deformities, Congenital1CTD_human
TgeneFGFR2C0265269Lacrimoauriculodentodigital syndrome1CTD_human;ORPHANET;UNIPROT
TgeneFGFR2C0349204Nonorganic psychosis1PSYGENET
TgeneFGFR2C1450010Plagiocephaly, Nonsynostotic1CTD_human;HPO
TgeneFGFR2C1852406Cutis Gyrata Syndrome of Beare And Stevenson1CTD_human;ORPHANET;UNIPROT
TgeneFGFR2C2350233Antley-Bixler Syndrome Phenotype1CTD_human
TgeneFGFR2C3281247BENT BONE DYSPLASIA SYNDROME1ORPHANET;UNIPROT
TgeneFGFR2C3714756Intellectual Disability1CTD_human;HPO