FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41495

FusionGeneSummary for VMP1_PSMA6

check button Fusion gene summary
Fusion gene informationFusion gene name: VMP1_PSMA6
Fusion gene ID: 41495
HgeneTgene
Gene symbol

VMP1

PSMA6

Gene ID

81671

5687

Gene namevacuole membrane protein 1proteasome subunit alpha 6
SynonymsEPG3|TANGO5|TMEM49IOTA|PROS27|p27K
Cytomap

17q23.1

14q13.2

Type of geneprotein-codingprotein-coding
Descriptionvacuole membrane protein 1ectopic P-granules autophagy protein 3 homologtransmembrane protein 49transport and golgi organization 5 homologproteasome subunit alpha type-627 kDa prosomal proteinPROS-27macropain iota chainmacropain subunit iotamulticatalytic endopeptidase complex iota chainprosomal P27K proteinproteasome (prosome, macropain) subunit, alpha type, 6proteasome iota chain
Modification date2018052320180523
UniProtAcc

Q96GC9

P60900

Ensembl transtripts involved in fusion geneENST00000262291, ENST00000537567, 
ENST00000539763, ENST00000536180, 
ENST00000545362, ENST00000588617, 
ENST00000540871, ENST00000261479, 
ENST00000553809, ENST00000555764, 
ENST00000556506, 
Fusion gene scores* DoF score19 X 10 X 9=17105 X 3 X 4=60
# samples 185
** MAII scorelog2(18/1710*10)=-3.24792751344359
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/60*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: VMP1 [Title/Abstract] AND PSMA6 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A8-A09A-01AVMP1chr17

57851246

+PSMA6chr14

35786455

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000262291ENST00000540871VMP1chr17

57851246

+PSMA6chr14

35786455

+
In-frameENST00000262291ENST00000261479VMP1chr17

57851246

+PSMA6chr14

35786455

+
Frame-shitENST00000262291ENST00000553809VMP1chr17

57851246

+PSMA6chr14

35786455

+
Frame-shitENST00000262291ENST00000555764VMP1chr17

57851246

+PSMA6chr14

35786455

+
In-frameENST00000262291ENST00000556506VMP1chr17

57851246

+PSMA6chr14

35786455

+
Frame-shitENST00000537567ENST00000540871VMP1chr17

57851246

+PSMA6chr14

35786455

+
In-frameENST00000537567ENST00000261479VMP1chr17

57851246

+PSMA6chr14

35786455

+
Frame-shitENST00000537567ENST00000553809VMP1chr17

57851246

+PSMA6chr14

35786455

+
Frame-shitENST00000537567ENST00000555764VMP1chr17

57851246

+PSMA6chr14

35786455

+
In-frameENST00000537567ENST00000556506VMP1chr17

57851246

+PSMA6chr14

35786455

+
Frame-shitENST00000539763ENST00000540871VMP1chr17

57851246

+PSMA6chr14

35786455

+
In-frameENST00000539763ENST00000261479VMP1chr17

57851246

+PSMA6chr14

35786455

+
Frame-shitENST00000539763ENST00000553809VMP1chr17

57851246

+PSMA6chr14

35786455

+
Frame-shitENST00000539763ENST00000555764VMP1chr17

57851246

+PSMA6chr14

35786455

+
In-frameENST00000539763ENST00000556506VMP1chr17

57851246

+PSMA6chr14

35786455

+
Frame-shitENST00000536180ENST00000540871VMP1chr17

57851246

+PSMA6chr14

35786455

+
In-frameENST00000536180ENST00000261479VMP1chr17

57851246

+PSMA6chr14

35786455

+
Frame-shitENST00000536180ENST00000553809VMP1chr17

57851246

+PSMA6chr14

35786455

+
Frame-shitENST00000536180ENST00000555764VMP1chr17

57851246

+PSMA6chr14

35786455

+
In-frameENST00000536180ENST00000556506VMP1chr17

57851246

+PSMA6chr14

35786455

+
Frame-shitENST00000545362ENST00000540871VMP1chr17

57851246

+PSMA6chr14

35786455

+
In-frameENST00000545362ENST00000261479VMP1chr17

57851246

+PSMA6chr14

35786455

+
Frame-shitENST00000545362ENST00000553809VMP1chr17

57851246

+PSMA6chr14

35786455

+
Frame-shitENST00000545362ENST00000555764VMP1chr17

57851246

+PSMA6chr14

35786455

+
In-frameENST00000545362ENST00000556506VMP1chr17

57851246

+PSMA6chr14

35786455

+
intron-3CDSENST00000588617ENST00000540871VMP1chr17

57851246

+PSMA6chr14

35786455

+
intron-3CDSENST00000588617ENST00000261479VMP1chr17

57851246

+PSMA6chr14

35786455

+
intron-3CDSENST00000588617ENST00000553809VMP1chr17

57851246

+PSMA6chr14

35786455

+
intron-3CDSENST00000588617ENST00000555764VMP1chr17

57851246

+PSMA6chr14

35786455

+
intron-3CDSENST00000588617ENST00000556506VMP1chr17

57851246

+PSMA6chr14

35786455

+

Top

FusionProtFeatures for VMP1_PSMA6


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
VMP1

Q96GC9

PSMA6

P60900

Stress-induced protein that, when overexpressed,promotes formation of intracellular vacuoles followed by celldeath. May be involved in the cytoplasmic vacuolization of acinarcells during the early stage of acute pancreatitis. Plays a rolein the initial stages of the autophagic process through itsinteraction with BECN1 (By similarity). Involved in cell-celladhesion. Plays an essential role in formation of cell junctions.{ECO:0000250, ECO:0000269|PubMed:17724469}. Component of the 20S core proteasome complex involved inthe proteolytic degradation of most intracellular proteins. Thiscomplex plays numerous essential roles within the cell byassociating with different regulatory particles. Associated withtwo 19S regulatory particles, forms the 26S proteasome and thusparticipates in the ATP-dependent degradation of ubiquitinatedproteins. The 26S proteasome plays a key role in the maintenanceof protein homeostasis by removing misfolded or damaged proteinsthat could impair cellular functions, and by removing proteinswhose functions are no longer required. Associated with the PA200or PA28, the 20S proteasome mediates ubiquitin-independent proteindegradation. This type of proteolysis is required in severalpathways including spermatogenesis (20S-PA200 complex) orgeneration of a subset of MHC class I-presented antigenic peptides(20S-PA28 complex). {ECO:0000269|PubMed:15244466,ECO:0000269|PubMed:27176742, ECO:0000269|PubMed:8610016}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for VMP1_PSMA6


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_VMP1_ENST00000262291_chr17_57851246_+_PSMA6_ENST00000261479_chr14_35786455_+_257aa
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQTFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLI
ATTTVEGVHQQTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISL

>In-frame_VMP1_ENST00000262291_chr17_57851246_+_PSMA6_ENST00000556506_chr14_35786455_+_246aa
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQTFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLI
ATTTVEGVHQQTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISL

>In-frame_VMP1_ENST00000537567_chr17_57851246_+_PSMA6_ENST00000261479_chr14_35786455_+_123aa
MDLKGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPTFMARAARLSGAEPDDEET

>In-frame_VMP1_ENST00000537567_chr17_57851246_+_PSMA6_ENST00000556506_chr14_35786455_+_112aa
MDLKGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPTFMARAARLSGAEPDDEET

>In-frame_VMP1_ENST00000539763_chr17_57851246_+_PSMA6_ENST00000261479_chr14_35786455_+_65aa

>In-frame_VMP1_ENST00000539763_chr17_57851246_+_PSMA6_ENST00000556506_chr14_35786455_+_54aa

>In-frame_VMP1_ENST00000536180_chr17_57851246_+_PSMA6_ENST00000261479_chr14_35786455_+_160aa
MDLKTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKV

>In-frame_VMP1_ENST00000536180_chr17_57851246_+_PSMA6_ENST00000556506_chr14_35786455_+_149aa
MDLKTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGPHIASVTLAATECNSVNFPEPPTPDQIICPDEEGTEGTISLWSIISKV

>In-frame_VMP1_ENST00000545362_chr17_57851246_+_PSMA6_ENST00000261479_chr14_35786455_+_201aa
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQTFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLI
ATTTVEGVHQQTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGIGTAIGELPPTFMARAARLSGAEPDDEETQEFEEMLEHAES

>In-frame_VMP1_ENST00000545362_chr17_57851246_+_PSMA6_ENST00000556506_chr14_35786455_+_190aa
MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQTFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLI
ATTTVEGVHQQTVQRIEKQFLLTAYWIGLGILSSVGLGTGLHTFLLTLGIGTAIGELPPTFMARAARLSGAEPDDEETQEFEEMLEHAES


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_VMP1_ENST00000262291_chr17_57851246_+_PSMA6_ENST00000261479_chr14_35786455_+_772nt
ATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTG
AATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAA
ATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATA
GCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGA
ATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTAT
GAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTG
TGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGA
GCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGATTCT

>In-frame_VMP1_ENST00000262291_chr17_57851246_+_PSMA6_ENST00000556506_chr14_35786455_+_738nt
ATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTG
AATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAA
ATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATA
GCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGA
ATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTAT
GAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTG
TGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGA
GCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGATTCT

>In-frame_VMP1_ENST00000537567_chr17_57851246_+_PSMA6_ENST00000261479_chr14_35786455_+_370nt
ATGGACCTCAAAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGAT
CAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGG
GGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTAT
CAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGATTCTTACAGAAGCAGAGATTGATGCTCACCTTGTTGCTCTAGCAGA

>In-frame_VMP1_ENST00000537567_chr17_57851246_+_PSMA6_ENST00000556506_chr14_35786455_+_336nt
ATGGACCTCAAAGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGAT
CAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGG
GGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTAT

>In-frame_VMP1_ENST00000539763_chr17_57851246_+_PSMA6_ENST00000261479_chr14_35786455_+_196nt
ATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAA
GAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGATTCTTACAGAAGCAGAGATTGATGCTCACCTTGTTGCTCT

>In-frame_VMP1_ENST00000539763_chr17_57851246_+_PSMA6_ENST00000556506_chr14_35786455_+_162nt
ATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAA

>In-frame_VMP1_ENST00000536180_chr17_57851246_+_PSMA6_ENST00000261479_chr14_35786455_+_481nt
ATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTT
GGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTT
CCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTT
AGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCT
GAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGATTCTTACAGAAGCAGAGATTGATGC

>In-frame_VMP1_ENST00000536180_chr17_57851246_+_PSMA6_ENST00000556506_chr14_35786455_+_447nt
ATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTT
GGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTT
CCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTT
AGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCT

>In-frame_VMP1_ENST00000545362_chr17_57851246_+_PSMA6_ENST00000261479_chr14_35786455_+_604nt
ATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTG
AATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAA
ATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATA
GCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGA
ATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATAT
TTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCT

>In-frame_VMP1_ENST00000545362_chr17_57851246_+_PSMA6_ENST00000556506_chr14_35786455_+_570nt
ATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTG
AATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAA
ATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATA
GCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGA
ATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATAT
TTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_VMP1_ENST00000262291_chr17_57851246_+_PSMA6_ENST00000261479_chr14_35786455_+_1250nt
GACAAGTTCCGGATCAAGAATCACAAAGCGAGCAGTCATTCTTCCTCTTGCCACACCCACAGGGCCCGCACTAAGAGCCTAACTGAAATC
CCGCGAGGATCAACCGAGCTCGCCGAAAGGAGGGAGGAACGTATCCCTTCTGGAGGCTGTCTCAGGGGGCAGAGGGACCGGACCGGAAGT
GACGTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGC
CGGGGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAA
GGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTG
GAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAG
CATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGA
GAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTA
TCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTAT
TTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGG
TACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATT
TGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGATTCTTACAGAAGCAGAGATTGATGCTCACCTTGTTGCTCTAGCAGAGAGAGACT
AAACATTGTCGTTAGTTTACCAGATCCGTGATGCCACTTACCTGTGTGTTTGGTAACAACAAACCAACATCATGGAGGTCCCTGGATTGA

>In-frame_VMP1_ENST00000262291_chr17_57851246_+_PSMA6_ENST00000556506_chr14_35786455_+_1195nt
GACAAGTTCCGGATCAAGAATCACAAAGCGAGCAGTCATTCTTCCTCTTGCCACACCCACAGGGCCCGCACTAAGAGCCTAACTGAAATC
CCGCGAGGATCAACCGAGCTCGCCGAAAGGAGGGAGGAACGTATCCCTTCTGGAGGCTGTCTCAGGGGGCAGAGGGACCGGACCGGAAGT
GACGTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGC
CGGGGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAA
GGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTG
GAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTATGGCATCGTCAAAG
CATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTATGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGA
GAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTA
TCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTAT
TTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGG
TACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATT
TGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGATTCTTACAGAAGCAGAGATTGATGCTCACCTTGTTGCTCTAGCAGAGAGAGACT
AAACATTGTCGTTAGTTTACCAGATCCGTGATGCCACTTACCTGTGTGTTTGGTAACAACAAACCAACATCATGGAGGTCCCTGGATTGA

>In-frame_VMP1_ENST00000537567_chr17_57851246_+_PSMA6_ENST00000261479_chr14_35786455_+_865nt
GTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGG
GGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGA
ACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAG
ACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAGGTCCACATATAGCCTCAGTT
ACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAA
GGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCA
TATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAG
TCTGCACAAGATTCTTACAGAAGCAGAGATTGATGCTCACCTTGTTGCTCTAGCAGAGAGAGACTAAACATTGTCGTTAGTTTACCAGAT
CCGTGATGCCACTTACCTGTGTGTTTGGTAACAACAAACCAACATCATGGAGGTCCCTGGATTGAAAAAGGAGCCTCTCCCACTCCTCCT

>In-frame_VMP1_ENST00000537567_chr17_57851246_+_PSMA6_ENST00000556506_chr14_35786455_+_810nt
GTGAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGG
GGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGA
ACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAG
ACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAGGTCCACATATAGCCTCAGTT
ACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAA
GGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCA
TATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAG
TCTGCACAAGATTCTTACAGAAGCAGAGATTGATGCTCACCTTGTTGCTCTAGCAGAGAGAGACTAAACATTGTCGTTAGTTTACCAGAT
CCGTGATGCCACTTACCTGTGTGTTTGGTAACAACAAACCAACATCATGGAGGTCCCTGGATTGAAAAAGGAGCCTCTCCCACTCCTCCT

>In-frame_VMP1_ENST00000539763_chr17_57851246_+_PSMA6_ENST00000261479_chr14_35786455_+_929nt
GAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGG
TCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAAC
ATCATAATGGAAATTTCACAGATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTA
TGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTC
TGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTC
AGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCAT
CTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCT
CTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGATTCTTACAGAAGCAG
AGATTGATGCTCACCTTGTTGCTCTAGCAGAGAGAGACTAAACATTGTCGTTAGTTTACCAGATCCGTGATGCCACTTACCTGTGTGTTT
GGTAACAACAAACCAACATCATGGAGGTCCCTGGATTGAAAAAGGAGCCTCTCCCACTCCTCCTACCACCGAAGTGGTTAGGACTCTATA

>In-frame_VMP1_ENST00000539763_chr17_57851246_+_PSMA6_ENST00000556506_chr14_35786455_+_874nt
GAGCGGGTTCCGGTTGTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGG
TCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAAC
ATCATAATGGAAATTTCACAGATTATGGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTA
TGTTGAAGGAGTGCATCAACAGTATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTC
TGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTCAGTTACATTAGCTGCTTATGAATGCAATTC
AGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCACTGAAGGAACCATTTCTTTGTGGAGTATCAT
CTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCT
CTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGATTCTTACAGAAGCAG
AGATTGATGCTCACCTTGTTGCTCTAGCAGAGAGAGACTAAACATTGTCGTTAGTTTACCAGATCCGTGATGCCACTTACCTGTGTGTTT

>In-frame_VMP1_ENST00000536180_chr17_57851246_+_PSMA6_ENST00000261479_chr14_35786455_+_959nt
GTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGGTCGGAGCGGCTCCTC
AAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATT
TCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCT
TGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGC
CTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTC
AGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCAC
TGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCC
TCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGC
AGAGTCTGCACAAGATTCTTACAGAAGCAGAGATTGATGCTCACCTTGTTGCTCTAGCAGAGAGAGACTAAACATTGTCGTTAGTTTACC
AGATCCGTGATGCCACTTACCTGTGTGTTTGGTAACAACAAACCAACATCATGGAGGTCCCTGGATTGAAAAAGGAGCCTCTCCCACTCC

>In-frame_VMP1_ENST00000536180_chr17_57851246_+_PSMA6_ENST00000556506_chr14_35786455_+_904nt
GTCTGGAGCCCAGCGGCGGGTGTGAGAGTCCGTAAGGAGCAGCTTCCAGGATCCTGAGATCCGGAGCAGCCGGGGTCGGAGCGGCTCCTC
AAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTGTAGCAATGAACAAGGAACATCATAATGGAAATT
TCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGAATATTGTCCTGTGGAGACAGCCGCTCATTACCT
TGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAATATGTGCAACGTATAGAGAAACAGTTTCTTTTGTATGC
CTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACACCTTTCTGCTTTATCTGGGTCCACATATAGCCTC
AGTTACATTAGCTGCTTATGAATGCAATTCAGTTAATTTTCCCGAACCACCCTATCCTGATCAGATTATTTGTCCAGATGAAGAGGGCAC
TGAAGGAACCATTTCTTTGTGGAGTATCATCTCAAAAGTTAGGATTGAAGCCTGCATGTGGGGTATCGGTACAGCAATCGGAGAGCTGCC
TCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAACCAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGC
AGAGTCTGCACAAGATTCTTACAGAAGCAGAGATTGATGCTCACCTTGTTGCTCTAGCAGAGAGAGACTAAACATTGTCGTTAGTTTACC
AGATCCGTGATGCCACTTACCTGTGTGTTTGGTAACAACAAACCAACATCATGGAGGTCCCTGGATTGAAAAAGGAGCCTCTCCCACTCC

>In-frame_VMP1_ENST00000545362_chr17_57851246_+_PSMA6_ENST00000261479_chr14_35786455_+_825nt
GATCCGGAGCAGCCGGGGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTG
TAGCAATGAACAAGGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGA
ATATTGTCCTGTGGAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTAT
GGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTATGTTGAAGGAGTGCATCAACAGTATG
TGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACA
CCTTTCTGCTTTATCTGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAAC
CAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGATTCTTACAGAAGCAGAGATTGATGCTCAC
CTTGTTGCTCTAGCAGAGAGAGACTAAACATTGTCGTTAGTTTACCAGATCCGTGATGCCACTTACCTGTGTGTTTGGTAACAACAAACC
AACATCATGGAGGTCCCTGGATTGAAAAAGGAGCCTCTCCCACTCCTCCTACCACCGAAGTGGTTAGGACTCTATATAAATAAAAACAAG

>In-frame_VMP1_ENST00000545362_chr17_57851246_+_PSMA6_ENST00000556506_chr14_35786455_+_770nt
GATCCGGAGCAGCCGGGGTCGGAGCGGCTCCTCAAGAGTTACTGATCTATGAAATGGCAGAGAATGGAAAAAATTGTGACCAGAGACGTG
TAGCAATGAACAAGGAACATCATAATGGAAATTTCACAGACCCCTCTTCAGTGAATGAAAAGAAGAGGAGGGAGCGGGAAGAAAGGCAGA
ATATTGTCCTGTGGAGACAGCCGCTCATTACCTTGCAGTATTTTTCTCTGGAAATCCTTGTAATCTTGAAGGAATGGACCTCAAAATTAT
GGCATCGTCAAAGCATTGTGGTGTCTTTTTTACTGCTGCTTGCTGTGCTTATAGCTACGTATTATGTTGAAGGAGTGCATCAACAGTATG
TGCAACGTATAGAGAAACAGTTTCTTTTGTATGCCTACTGGATAGGCTTAGGAATTTTGTCTTCTGTTGGGCTTGGAACAGGGCTGCACA
CCTTTCTGCTTTATCTGGGTATCGGTACAGCAATCGGAGAGCTGCCTCCATATTTCATGGCCAGAGCAGCTCGCCTCTCAGGTGCTGAAC
CAGATGATGAAGAGTATCAGGAATTTGAAGAGATGCTGGAACATGCAGAGTCTGCACAAGATTCTTACAGAAGCAGAGATTGATGCTCAC
CTTGTTGCTCTAGCAGAGAGAGACTAAACATTGTCGTTAGTTTACCAGATCCGTGATGCCACTTACCTGTGTGTTTGGTAACAACAAACC


Top

FusionGenePPI for VMP1_PSMA6


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
VMP1HGS, ELAVL1, TJP1, KLK11, LPAR6, ERGIC3, FAF2, KRAS, TCTN2, TCTN3, TMEM216, DPEP1, CDH13, MAS1, LMNAPSMA6PSMD13, PSMA3, PLK1, UBQLN2, USP14, USP53, SLX1B, CUL1, RBX1, PSMA4, PSMA2, RNF185, UBC, XBP1, UBD, PSMD4, PSMD14, ADRM1, PSMD1, TXNL1, RAD23A, SHFM1, PSME1, PSMA7, PSMA1, PPP3CA, CCND1, CCNE1, CCNA2, CCNB1, CDK4, CDK1, CDK2, CCNF, GPS1, COPS5, PSMD6, PSMC1, FKBP8, NEDD8, DNAJB2, KIAA0368, COPS2, UCHL5, POMP, PSMB6, PSMB5, PSMB8, USP4, PSMA5, PSMB1, PSMB2, PSMB3, PSMB4, PSMB7, PSMC6, PSMC3, PSMC4, PSMC2, PSMD2, PSMD3, PSMD8, PSMC5, PSMD12, PSMD11, PSMD7, PSMD5, PSME2, PSME3, PSMA8, SF3A1, CCT5, SNRPA1, TPM4, CCT4, CCT3, EEF1A1, CCT8, TARDBP, BRCA1, ECT2, LIG4, PAXIP1, FN1, VCAM1, IQCB1, NOS2, ITGA4, PARK2, BAG3, CAST, HNRNPA2B1, PYCRL, RPP30, RPP38, PSMG1, PSMG3, PSMG2, AURKA, HUWE1, CADM1, ZBTB44, TRIM39, C19orf57, LIMD2, RNF170, KRTAP4-2, RTP5, RNF2, AMFR, SYVN1, BUB1B, VCP, UBQLN1, UBXN4, PSMB9, HSPB1, AMBRA1, ACTN4, CAND2, CAPZA1, ELP6, EXOSC4, EXOSC6, EXOSC9, ISY1-RAB43, ISY1, NELFE, PGK1, POLR2A, DNAJA2, EXOSC5, TPM3, WDR11, NTRK1, FBXO7, MID1, CEP85, PSMA6, DERL1, CYLD, SOD1, MAP1LC3B, SQSTM1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for VMP1_PSMA6


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for VMP1_PSMA6


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePSMA6C0019693HIV Infections1CTD_human
TgenePSMA6C0027051Myocardial Infarction1CTD_human