FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41438

FusionGeneSummary for VGLL3_RBMS3

check button Fusion gene summary
Fusion gene informationFusion gene name: VGLL3_RBMS3
Fusion gene ID: 41438
HgeneTgene
Gene symbol

VGLL3

RBMS3

Gene ID

389136

27303

Gene namevestigial like family member 3RNA binding motif single stranded interacting protein 3
SynonymsVGL-3|VGL3-
Cytomap

3p12.1

3p24.1

Type of geneprotein-codingprotein-coding
Descriptiontranscription cofactor vestigial-like protein 3colon carcinoma related proteinRNA-binding motif, single-stranded-interacting protein 3RNA binding motif, single stranded interacting proteinRNA-binding protein
Modification date2018052320180523
UniProtAcc

A8MV65

Q6XE24

Ensembl transtripts involved in fusion geneENST00000398399, ENST00000383698, 
ENST00000434693, ENST00000396583, 
ENST00000383767, ENST00000445033, 
ENST00000273139, ENST00000383766, 
ENST00000452462, ENST00000456853, 
ENST00000473799, 
Fusion gene scores* DoF score2 X 2 X 2=81 X 1 X 1=1
# samples 21
** MAII scorelog2(2/8*10)=1.32192809488736log2(1/1*10)=3.32192809488736
Context

PubMed: VGLL3 [Title/Abstract] AND RBMS3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPRADTCGA-G9-7510-01AVGLL3chr3

87017740

-RBMS3chr3

29628605

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000398399ENST00000434693VGLL3chr3

87017740

-RBMS3chr3

29628605

+
In-frameENST00000398399ENST00000396583VGLL3chr3

87017740

-RBMS3chr3

29628605

+
In-frameENST00000398399ENST00000383767VGLL3chr3

87017740

-RBMS3chr3

29628605

+
In-frameENST00000398399ENST00000445033VGLL3chr3

87017740

-RBMS3chr3

29628605

+
In-frameENST00000398399ENST00000273139VGLL3chr3

87017740

-RBMS3chr3

29628605

+
In-frameENST00000398399ENST00000383766VGLL3chr3

87017740

-RBMS3chr3

29628605

+
In-frameENST00000398399ENST00000452462VGLL3chr3

87017740

-RBMS3chr3

29628605

+
In-frameENST00000398399ENST00000456853VGLL3chr3

87017740

-RBMS3chr3

29628605

+
5CDS-intronENST00000398399ENST00000473799VGLL3chr3

87017740

-RBMS3chr3

29628605

+
In-frameENST00000383698ENST00000434693VGLL3chr3

87017740

-RBMS3chr3

29628605

+
In-frameENST00000383698ENST00000396583VGLL3chr3

87017740

-RBMS3chr3

29628605

+
In-frameENST00000383698ENST00000383767VGLL3chr3

87017740

-RBMS3chr3

29628605

+
In-frameENST00000383698ENST00000445033VGLL3chr3

87017740

-RBMS3chr3

29628605

+
In-frameENST00000383698ENST00000273139VGLL3chr3

87017740

-RBMS3chr3

29628605

+
In-frameENST00000383698ENST00000383766VGLL3chr3

87017740

-RBMS3chr3

29628605

+
In-frameENST00000383698ENST00000452462VGLL3chr3

87017740

-RBMS3chr3

29628605

+
In-frameENST00000383698ENST00000456853VGLL3chr3

87017740

-RBMS3chr3

29628605

+
5CDS-intronENST00000383698ENST00000473799VGLL3chr3

87017740

-RBMS3chr3

29628605

+

Top

FusionProtFeatures for VGLL3_RBMS3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
VGLL3

A8MV65

RBMS3

Q6XE24

May act as a specific coactivator for the mammalianTEFs. {ECO:0000250|UniProtKB:Q8N8G2}. Binds poly(A) and poly(U) oligoribonucleotides.{ECO:0000269|PubMed:10675610}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneVGLL3chr3:87017740chr3:29628605ENST00000383698-34221_248312321Compositional biasHis-rich
HgeneVGLL3chr3:87017740chr3:29628605ENST00000398399-34221_248312327Compositional biasHis-rich
TgeneRBMS3chr3:87017740chr3:29628605ENST00000273139+213140_225102421DomainRRM 2
TgeneRBMS3chr3:87017740chr3:29628605ENST00000383766+214140_225101420DomainRRM 2
TgeneRBMS3chr3:87017740chr3:29628605ENST00000383767+215140_225102438DomainRRM 2
TgeneRBMS3chr3:87017740chr3:29628605ENST00000452462+214140_225102422DomainRRM 2
TgeneRBMS3chr3:87017740chr3:29628605ENST00000456853+214140_225102434DomainRRM 2

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRBMS3chr3:87017740chr3:29628605ENST00000273139+21361_134102421DomainRRM 1
TgeneRBMS3chr3:87017740chr3:29628605ENST00000383766+21461_134101420DomainRRM 1
TgeneRBMS3chr3:87017740chr3:29628605ENST00000383767+21561_134102438DomainRRM 1
TgeneRBMS3chr3:87017740chr3:29628605ENST00000452462+21461_134102422DomainRRM 1
TgeneRBMS3chr3:87017740chr3:29628605ENST00000456853+21461_134102434DomainRRM 1


Top

FusionGeneSequence for VGLL3_RBMS3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000434693_chr3_29628605_+_648aa
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVL
FTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFS
AADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAA
RIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYISNLPIS
MDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQSTSWMPHPPYVMQPTGAVITPTMDHPMSMQPA
NMMGPLTQQMNHLSLGTTGTIQSQDRIMILHQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAV

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000396583_chr3_29628605_+_645aa
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVL
FTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFS
AADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAA
RIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYISNLPIS
MDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEVLRGRTVPRQNREAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQSTSWMPHPPYVMQPTGAVI
TPTMDHPMSMQPANMMGPLTQQMNHLSLGTTGTYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTS

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000383767_chr3_29628605_+_648aa
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVL
FTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFS
AADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAA
RIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYISNLPIS
MDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQSTSWMPHPPYVMQPTGAVITPTMDHPMSMQPA
NMMGPLTQQMNHLSLGTTGTIQSQDRIMILHQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAV

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000445033_chr3_29628605_+_475aa
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVL
FTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFS
AADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAA
RIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYISNLPIS
MDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000273139_chr3_29628605_+_631aa
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVL
FTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFS
AADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAA
RIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYISNLPIS
MDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQSTSWMPHPPYVMQPTGAVITPTMDHPMSMQPA
NMMGPLTQQMNHLSLGTTGTYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000383766_chr3_29628605_+_631aa
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVL
FTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFS
AADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAA
RIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYISNLPIS
MDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQGAVITPTMDHPMSMQPANMMGPLTQQMNHLSLGT
TGTIQSQDRIMILHQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSKP

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000452462_chr3_29628605_+_632aa
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVL
FTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFS
AADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAA
RIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYISNLPIS
MDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQSTSWMPHPPYVMQPTGAVITPTMDHPMSMQPA
NMMGPLTQQMNHLSLGTTGTYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000456853_chr3_29628605_+_644aa
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVL
FTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFS
AADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAA
RIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYISNLPIS
MDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEVLRGRTVPRQNREAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQSTSWMPHPPYVMQPTGAVI
TPTMDHPMSMQPANMMGPLTQQMNHLSLGTTGTYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTS

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000434693_chr3_29628605_+_648aa
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVL
FTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFS
AADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAA
RIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYISNLPIS
MDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQSTSWMPHPPYVMQPTGAVITPTMDHPMSMQPA
NMMGPLTQQMNHLSLGTTGTIQSQDRIMILHQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAV

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000396583_chr3_29628605_+_645aa
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVL
FTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFS
AADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAA
RIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYISNLPIS
MDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEVLRGRTVPRQNREAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQSTSWMPHPPYVMQPTGAVI
TPTMDHPMSMQPANMMGPLTQQMNHLSLGTTGTYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTS

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000383767_chr3_29628605_+_648aa
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVL
FTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFS
AADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAA
RIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYISNLPIS
MDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQSTSWMPHPPYVMQPTGAVITPTMDHPMSMQPA
NMMGPLTQQMNHLSLGTTGTIQSQDRIMILHQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAV

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000445033_chr3_29628605_+_475aa
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVL
FTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFS
AADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAA
RIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYISNLPIS
MDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000273139_chr3_29628605_+_631aa
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVL
FTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFS
AADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAA
RIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYISNLPIS
MDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQSTSWMPHPPYVMQPTGAVITPTMDHPMSMQPA
NMMGPLTQQMNHLSLGTTGTYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000383766_chr3_29628605_+_631aa
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVL
FTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFS
AADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAA
RIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYISNLPIS
MDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQGAVITPTMDHPMSMQPANMMGPLTQQMNHLSLGT
TGTIQSQDRIMILHQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSKP

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000452462_chr3_29628605_+_632aa
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVL
FTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFS
AADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAA
RIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYISNLPIS
MDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQSTSWMPHPPYVMQPTGAVITPTMDHPMSMQPA
NMMGPLTQQMNHLSLGTTGTYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000456853_chr3_29628605_+_644aa
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVL
FTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFS
AADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAA
RIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGYGFVDFDSPAAAQKAVASLKANGVQAQMAKQQEQDPTNLYISNLPIS
MDEQELENMLKPFGHVISTRILRDANGVSRGVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEVLRGRTVPRQNREAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQSTSWMPHPPYVMQPTGAVI
TPTMDHPMSMQPANMMGPLTQQMNHLSLGTTGTYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000434693_chr3_29628605_+_1944nt
ATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCCCACA
GCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCTTCCC
AGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGTCCTT
TTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGAATCT
GCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTCCTTT
TGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTTTTCT
GCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTATCCT
TTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCGCCAC
CGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGCGGCC
AGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCATGGA
ACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGTAGCA
TCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCATTTCT
ATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAGCAGA
GGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACCAGGC
ATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAATGGG
AGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTAC
AGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAGTACT
TCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATTACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCC
AACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACAACAGGAACGATTCAATCCCAAGACAGGATTATGATACTC
CACCAGCTGTTGTGTCAGTATATGACTGCTGCTGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTT
TCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTG

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000396583_chr3_29628605_+_1935nt
ATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCCCACA
GCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCTTCCC
AGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGTCCTT
TTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGAATCT
GCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTCCTTT
TGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTTTTCT
GCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTATCCT
TTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCGCCAC
CGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGCGGCC
AGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCATGGA
ACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGTAGCA
TCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCATTTCT
ATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAGCAGA
GGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACCAGGC
ATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAATGGG
AGGCCTTGGCCCAGGGAAGGAGAGGTACTCAGAGGCAGGACTGTCCCTAGGCAAAATCGTGAAGCTGGCATGGCTTTGACCTATGACCCC
ACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTACAGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATT
GCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAGTACTTCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATT
ACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCCAACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACA
ACAGGAACGTATATGACTGCTGCTGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTATTGAA
GGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACACATCC

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000383767_chr3_29628605_+_1944nt
ATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCCCACA
GCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCTTCCC
AGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGTCCTT
TTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGAATCT
GCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTCCTTT
TGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTTTTCT
GCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTATCCT
TTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCGCCAC
CGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGCGGCC
AGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCATGGA
ACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGTAGCA
TCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCATTTCT
ATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAGCAGA
GGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACCAGGC
ATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAATGGG
AGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTAC
AGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAGTACT
TCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATTACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCC
AACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACAACAGGAACGATTCAATCCCAAGACAGGATTATGATACTC
CACCAGCTGTTGTGTCAGTATATGACTGCTGCTGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTT
TCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTG

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000445033_chr3_29628605_+_1425nt
ATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCCCACA
GCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCTTCCC
AGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGTCCTT
TTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGAATCT
GCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTCCTTT
TGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTTTTCT
GCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTATCCT
TTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCGCCAC
CGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGCGGCC
AGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCATGGA
ACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGTAGCA
TCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCATTTCT
ATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAGCAGA
GGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACCAGGC
ATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAATGGG

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000273139_chr3_29628605_+_1893nt
ATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCCCACA
GCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCTTCCC
AGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGTCCTT
TTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGAATCT
GCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTCCTTT
TGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTTTTCT
GCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTATCCT
TTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCGCCAC
CGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGCGGCC
AGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCATGGA
ACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGTAGCA
TCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCATTTCT
ATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAGCAGA
GGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACCAGGC
ATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAATGGG
AGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTAC
AGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAGTACT
TCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATTACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCC
AACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACAACAGGAACGTATATGACTGCTGCTGCTCCTATGCAAGGG
ACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCT
TCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACACATCCAACGAACATGCACCTGCATATTCTTACCAACAGTCTAAG

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000383766_chr3_29628605_+_1893nt
ATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCCCACA
GCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCTTCCC
AGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGTCCTT
TTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGAATCT
GCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTCCTTT
TGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTTTTCT
GCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTATCCT
TTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCGCCAC
CGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGCGGCC
AGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCATGGA
ACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGTAGCA
TCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCATTTCT
ATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAGCAGA
GGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACCAGGC
ATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAATGGG
AGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTAC
AGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATACCAGGGTGCTGTGATT
ACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCCAACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACA
ACAGGAACGATTCAATCCCAAGACAGGATTATGATACTCCACCAGCTGTTGTGTCAGTATATGACTGCTGCTGCTCCTATGCAAGGGACC
TACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCA
TCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACACATCCAACGAACATGCACCTGCATATTCTTACCAACAGTCTAAACCA

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000452462_chr3_29628605_+_1896nt
ATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCCCACA
GCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCTTCCC
AGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGTCCTT
TTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGAATCT
GCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTCCTTT
TGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTTTTCT
GCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTATCCT
TTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCGCCAC
CGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGCGGCC
AGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCATGGA
ACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGTAGCA
TCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCATTTCT
ATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAGCAGA
GGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACCAGGC
ATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAATGGG
AGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTAC
AGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAGTACT
TCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATTACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCC
AACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACAACAGGAACGTATATGACTGCTGCTGCTCCTATGCAAGGG
ACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCT
TCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACACATCCAACGAACATGCACCTGCATATTCTTACCAACAGTCTAAA

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000456853_chr3_29628605_+_1932nt
ATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCCCACA
GCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCTTCCC
AGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGTCCTT
TTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGAATCT
GCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTCCTTT
TGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTTTTCT
GCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTATCCT
TTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCGCCAC
CGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGCGGCC
AGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCATGGA
ACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGTAGCA
TCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCATTTCT
ATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAGCAGA
GGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACCAGGC
ATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAATGGG
AGGCCTTGGCCCAGGGAAGGAGAGGTACTCAGAGGCAGGACTGTCCCTAGGCAAAATCGTGAAGCTGGCATGGCTTTGACCTATGACCCC
ACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTACAGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATT
GCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAGTACTTCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATT
ACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCCAACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACA
ACAGGAACGTATATGACTGCTGCTGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTATTGAA
GGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACACATCC

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000434693_chr3_29628605_+_1944nt
ATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCCCACA
GCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCTTCCC
AGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGTCCTT
TTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGAATCT
GCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTCCTTT
TGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTTTTCT
GCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTATCCT
TTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCGCCAC
CGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGCGGCC
AGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCATGGA
ACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGTAGCA
TCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCATTTCT
ATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAGCAGA
GGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACCAGGC
ATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAATGGG
AGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTAC
AGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAGTACT
TCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATTACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCC
AACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACAACAGGAACGATTCAATCCCAAGACAGGATTATGATACTC
CACCAGCTGTTGTGTCAGTATATGACTGCTGCTGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTT
TCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTG

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000396583_chr3_29628605_+_1935nt
ATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCCCACA
GCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCTTCCC
AGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGTCCTT
TTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGAATCT
GCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTCCTTT
TGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTTTTCT
GCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTATCCT
TTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCGCCAC
CGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGCGGCC
AGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCATGGA
ACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGTAGCA
TCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCATTTCT
ATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAGCAGA
GGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACCAGGC
ATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAATGGG
AGGCCTTGGCCCAGGGAAGGAGAGGTACTCAGAGGCAGGACTGTCCCTAGGCAAAATCGTGAAGCTGGCATGGCTTTGACCTATGACCCC
ACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTACAGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATT
GCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAGTACTTCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATT
ACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCCAACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACA
ACAGGAACGTATATGACTGCTGCTGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTATTGAA
GGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACACATCC

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000383767_chr3_29628605_+_1944nt
ATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCCCACA
GCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCTTCCC
AGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGTCCTT
TTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGAATCT
GCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTCCTTT
TGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTTTTCT
GCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTATCCT
TTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCGCCAC
CGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGCGGCC
AGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCATGGA
ACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGTAGCA
TCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCATTTCT
ATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAGCAGA
GGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACCAGGC
ATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAATGGG
AGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTAC
AGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAGTACT
TCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATTACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCC
AACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACAACAGGAACGATTCAATCCCAAGACAGGATTATGATACTC
CACCAGCTGTTGTGTCAGTATATGACTGCTGCTGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTT
TCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTG

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000445033_chr3_29628605_+_1425nt
ATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCCCACA
GCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCTTCCC
AGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGTCCTT
TTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGAATCT
GCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTCCTTT
TGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTTTTCT
GCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTATCCT
TTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCGCCAC
CGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGCGGCC
AGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCATGGA
ACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGTAGCA
TCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCATTTCT
ATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAGCAGA
GGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACCAGGC
ATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAATGGG

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000273139_chr3_29628605_+_1893nt
ATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCCCACA
GCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCTTCCC
AGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGTCCTT
TTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGAATCT
GCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTCCTTT
TGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTTTTCT
GCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTATCCT
TTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCGCCAC
CGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGCGGCC
AGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCATGGA
ACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGTAGCA
TCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCATTTCT
ATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAGCAGA
GGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACCAGGC
ATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAATGGG
AGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTAC
AGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAGTACT
TCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATTACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCC
AACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACAACAGGAACGTATATGACTGCTGCTGCTCCTATGCAAGGG
ACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCT
TCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACACATCCAACGAACATGCACCTGCATATTCTTACCAACAGTCTAAG

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000383766_chr3_29628605_+_1893nt
ATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCCCACA
GCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCTTCCC
AGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGTCCTT
TTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGAATCT
GCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTCCTTT
TGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTTTTCT
GCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTATCCT
TTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCGCCAC
CGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGCGGCC
AGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCATGGA
ACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGTAGCA
TCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCATTTCT
ATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAGCAGA
GGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACCAGGC
ATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAATGGG
AGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTAC
AGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATACCAGGGTGCTGTGATT
ACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCCAACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACA
ACAGGAACGATTCAATCCCAAGACAGGATTATGATACTCCACCAGCTGTTGTGTCAGTATATGACTGCTGCTGCTCCTATGCAAGGGACC
TACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCA
TCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACACATCCAACGAACATGCACCTGCATATTCTTACCAACAGTCTAAACCA

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000452462_chr3_29628605_+_1896nt
ATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCCCACA
GCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCTTCCC
AGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGTCCTT
TTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGAATCT
GCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTCCTTT
TGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTTTTCT
GCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTATCCT
TTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCGCCAC
CGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGCGGCC
AGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCATGGA
ACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGTAGCA
TCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCATTTCT
ATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAGCAGA
GGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACCAGGC
ATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAATGGG
AGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTAC
AGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAGTACT
TCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATTACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCC
AACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACAACAGGAACGTATATGACTGCTGCTGCTCCTATGCAAGGG
ACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCT
TCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACACATCCAACGAACATGCACCTGCATATTCTTACCAACAGTCTAAA

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000456853_chr3_29628605_+_1932nt
ATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCCCACA
GCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCTTCCC
AGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGTCCTT
TTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGAATCT
GCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTCCTTT
TGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTTTTCT
GCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTATCCT
TTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCGCCAC
CGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGCGGCC
AGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCATGGA
ACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGTAGCA
TCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCATTTCT
ATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAGCAGA
GGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACCAGGC
ATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAATGGG
AGGCCTTGGCCCAGGGAAGGAGAGGTACTCAGAGGCAGGACTGTCCCTAGGCAAAATCGTGAAGCTGGCATGGCTTTGACCTATGACCCC
ACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTACAGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATT
GCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAGTACTTCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATT
ACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCCAACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACA
ACAGGAACGTATATGACTGCTGCTGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTATTGAA
GGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACACATCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000434693_chr3_29628605_+_8837nt
CGGGCCTGGGCTGTGGCTGTGACTGGCGCTGCCGTGGGCGCCGCAGCCCTCGCGGGAGCCGGACGCGGTAATGCCCCAGCGGCGCAGCGG
GCGGCTGCGTCCCTGAGCCGCTATATAAGCGCGGCAGGGAACATCCGGAGGGGCTGAAGATGAAGGTGCCCGCGCATGGGCCCCCGCTGA
TTGCCAGTCCCTCCCGACCCCGCGCCCCGCGCGGAGCCCGAGGCCGCCGAGGACCCGCCTTCGCCGCAGTAGCAGCTGGAGCAGCGACAG
AGGCGGCAGCTGCGGCGGCGGCGGCGCCCGCGCCCCTCGCGCCAGCGCGTAGAGCGGCGGCGGCAGCTCGGGGGCCGCCACTGCCCCGGC
TGCCATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCC
CACAGCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCT
TCCCAGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGT
CCTTTTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGA
ATCTGCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTC
CTTTTGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTT
TTCTGCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTA
TCCTTTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCG
CCACCGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGC
GGCCAGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCA
TGGAACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGT
AGCATCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCAT
TTCTATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAG
CAGAGGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACC
AGGCATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAA
TGGGAGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACC
GTACAGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAG
TACTTCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATTACACCAACCATGGACCATCCCATGTCAATGCAGCC
AGCCAACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACAACAGGAACGATTCAATCCCAAGACAGGATTATGAT
ACTCCACCAGCTGTTGTGTCAGTATATGACTGCTGCTGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGC
TGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGC
AGTGGACACATCCAACGAACATGCACCTGCATATTCTTACCAACAGTCTAAACCATAAACAGGACTGAAGAATGTCTGTCTGAATCTTTG
CCTTGAATGAAGAAACTTCATTGAACAAGAAGTTGGCTTCCAGTTTGCACAGACGTCAATGGAATGCATTTTTTTGTTGTTGTTGTTGTT
TTTTTTTTAGTGTTATACCTTACCCAATGAAAGCAAAGTTTTTATGTGCTGTGCAAATGGTCTTCATGTGGTCTGACAATTTATTTTTGC
CATCATTTTTTTAATTAAAGAAAAAATTTCCAGAAGAGGAAAAAAAAACTACAAAAAACAAAACATTGAAGGTTGATATTTTATGTGGAA
GAACATTTGAATTGAATTCAGAATTTTTCTGAAGGTGTAGATACTTTTTTTTTTTTTTTAACAGAAAACCTGATGTCAAGAGGTGGGCAA
TAGAAATGGAAACAAATTGTCTTCCTCAATAATTAAGCTACTTTCTCTTTTTCCCTTCTTGTTTTAATCTAGTGGGTTTTTTATTTTATT
TTTTCTTAGAAATATGTAGGTAAGGTTTATCTTGAATCTTAATTGCCTTAATTTTAAGGACGTCAAAGGCTCTCGAGGCAAGCTGTCAAC
GTCTTGTTGAAAACAAAAATCAAGAAAGAATTGAAATACTGTGCCGGCTTTCACTGGCACAGAAGTTTAAGACTATGAGTTTTTAGGGTG
AAGAAAAAACTGTACAGTTTAAATGAAAATGTTTTTCTTCATTTGAAGAAAATTTGTTGATAAACCATGGCAACTGCAAGAATTGGAAAA
ATGCTGGGACTTTTCATGAACTTTGTCTTAAGTGTTGACATGAATCATTCTAAAAGGCTAAAACATTTTACAGTAAAGTTATTAAGGTTG
GTTTAAAAACAACTGCATTAGAAATAATGCGTGTTTGGGGGGCAGAATGCAGATTTTTTTAATTTACAAAGCGTGATCGCTAGCAAAAGC
ATTAGTGCTTTTTATCTGCAGTCTTTTTTATGAGCTTTACAAAGTTTTTAGTCAGCTTTGCTTGTCACATTGCAAAACCTAGCTTAAGAG
CATTAAAAAAAAAAACTTAAGTAGATAGGAGCTTATGGTCAAAAAGTGCAAAAAAAAAAACAAAAAAAAAGCAATAGATAGAGAAATTGT
TGACAATTTCTGTAGTCTTTCCTAGTTGTGATCAAATTCAGCCTATGGATGGCCTATTTTATACCAAAGATGAAGTGACACCCTATTACA
GTCCAGAAGATAGAGGTTGTTTTCGTTTCTTTTCTTTTTAAAAAAAAAAAAATTTATTTGACCGACATGGCCGGACCAGTTCTTTCTTTG
TTGTTTGTTTAAACTACCTTCCACTGGTGTTTTACATAGTGCAAAAAAAAAAAGAGGGTGGGGGGAGTTGTCTCTCTTTTCTTTAAATGT
GTATTCATTGATAGCAGAAGCTTGTACCTGCTGTGTTTAGCAGTTTCAGCATGAAGAGTTCTGGATATGAACTGATTCATAGAGCCAAGT
GGCTTTAAATTCTGTGAGCTTTTCTGGTTTCTCACTAGCTGTCTTGAATAGTGAAACCTGTATTGATGGCCACTAGTAAACCAAGATGCT
TATTTAACAGGTGGAATATTCTTTATATGAAATTTCAGCTAAAGACACTTTCTGGACCTGGTCTGAAAGGTCATTTGTCAAAAAAGCTTA
GGGATATTCTGTGAAATGGTGAGTGGTCTCCTGGAAAGGTCTCATTGTATTTGAACAATAGTCTTCCCTCTAAATTACAACACCTCTGGG
TTTTGTCTTTACACCTCTGTCTTTGTCATCACCTACCATGAATAGTCACCTTGGTTTTGCAAATGGGGAGGGGGTATCATCTTTTTGCCT
GTTTTCACTGTATTTTTGTATATTGGTGTTGCCGAAAGAACTTTTTCTTTCAGTTTAATTCTTTGAGGCATGTAGGACCAATAAGATTGA
GAATTCTATTGGTGGAATTTAGGGAAGTCCTTAAAATGCTAGTTGACAATCAAGGAACAGTATGATTTATATCAATAAGAACCAAAAGAA
TTAGGTTTGATCAATCATTTAAGCCAAGGAGGAATACTTGCATTTAGAACAATGCAAAACTTTGTCTAAAATGAATTAAATTGACCCACC
TGTAAAATATATCTACATTTTTAATTCATGAGATGATATGTGTTCAACCTTTACAGTTTTACCTGAAATTAAGGACAATGGAATAGAATT
TGTTAAGTGAACCATTCACTAGATTGCTTTCTGAATGAATCCTTTGAATCAAATAGGTGAAACTCTTTTCAAAAACTAAGTCAGTCACAG
GAGCCTGTCTTAGTCCAAAAGAAGCAGGGAAATGTATTTAAGTGTACTATAAAACAGGGTAGGCTTTTTAAAAACTAAAAAGTTTTAAAG
GTAAATCATATTCCCATTAGGTCAACATGAGTAATAAGGTTGACTCATGTGAAATTGTCAATATTCTACTATTTCTGTAAACTCTGGTTC
TCTTATTTGCAACCCCATGCACTGGAAGCCCAAATCAGAGAATGACTCCATATATTTATGGTCACATTGGAGACAAAAGTGTATCCAAGA
AAATGTAGTGTGCGTTATAGAGAAATTCCAACTGGTCACACTCACCATTATGGTTTTTCATGCTTTAGAGAAAATGCTAGATTTATACTG
TCTTTTGTTCCATCCTTCAGCTTCCCATGCATTATAAAGGTGGCACTTAAGTTTTTATCTTTGAAAAGTGGGCCCCAAAGTTTTTTGGGG
TACAAAAAGACATGTATGAGAACCATATTTTCTGTTTCTCTTTTTCACTCTCTAAACTCTTTTTGTATAAATAAGGATTATCCTGGGCAT
AATTCATTTGAATATGAAACCAACATACTTTCTTTCATTTTTGTGAAAAAATAACCAAAAACATGTATTAATGTGATACAAAGAAAGTCT
CATTCACACAATCAACAATGAGGCTAAGAGGTAGCTACCATGTGGCTAATGAATGTGCCTAGGTAACTTCCTGTTTCTATTCAAAACTGC
TGCTTTATTTGTACATTCAGAAATATTTTTTTCAACTATGAAATTTCAATATCAATTTTTTAAGCCAGTTTCTGCAAAAGGAAATGACCT
GTCATTTGATGTGTTCATGTGTGTTTTGTGTTTGGATAGTTTATATCATGCCATTCTATAAAATGTATGTTTTCAAACCAAAAAGAAAAA
AAATAGAAGGAAAACAACGGCACATACTCAAATTTGCCCTGCTTTGTCTGTTGTCTTACCTAAGACTTGTTTTGAAGAGCCAAGTCTGGG
AGAGAAAAAAAAGCATCAACAGGTAAGCAGCATTACATTGTGTGGTAATAAACCAAAATAAGTTTTCAATATATACAGACAACAGAATTC
AAATTTAATCAACAAAATATATTGTAGTGATTTGTTTGTTTGTTTGTTTGAGACGGAGTCTCGCTCTGTCGCCCATCCTAACTAGGACTA
TAATCTTTTTTTTTTTCTTTAAGTTGAAGTTAATTTTCTGTGCATTCTGGTCCACCAGATTTTCAAGCATTTATTTGGATGTTTCCATTT
TTCCTTTTGACTTTAATAGCCAAGACTTAGCTTAAACATCAGGAAACAAACTAAAGCCACAATCCAAATGAGAGAAACACTGTCTCGTCT
AAACTCTAGTTTCATGGTCAGTGCAACAGTGAGTTTTCTTTTAATAATGGTATGGTATTGTCAAGGGAGGCAAAGTGTTCATGGTAACTT
GGAGCTCCCCAATACATGGCCATGTCTTCTAAAGACAACGTAATGAGCCCAAGTGAACTGAAGGTCATACTGGCAGGTGCTGATGACAGT
TTGTCCTTGAATGCTGACATGTCTTGAATATTGCAAATGTCATAATACTCTTTTAAAACAGTCCTCTACCTGACTCTAGTTTTGCGAGGA
TTAGTTTGTTTCCTTGGTAGATTTCAACATTTCAGAATGTTACCTCCAAATTTCACTTGAATTACTTCCTCCTGTGACCTTAGCAGATCT
GTCACATTTGAAAGCATATGACTCACTTCCACCCCCTTCTAATGAAAAACTGCATGGTGTTAAAAGCACTCTCATTAGAAATATAAGGCT
GAGAACTGAAGAAGGCTGTTTAAAGCAGGAATTTCACTTTATTTTACTATGCCTAAAAATACATCTTTGGACCCCTTGCAAAGTGCTTTA
AAAGTACTTTCAATTTATGCATGACTCCAAAAAAGTAATTTTTTTTTCCCAAAAAAACCTCTTTATTTAAATAATTGGGATATTTGCTAA
ATACCTATTTTTTTTTACAGTGGCCTAAAACCCCTATTAATGAAAAGTGAAATTTGATTTAATTAGGACTCTTGCAGTCATCTTCACGAC
TGAGGAGAAGTTTCAATAGGCTGTCTAGACATTATGATGTTAATAGGAGATTAAAATACATTTGGCAATTCATTTTCATTCTTAATTTGA
GTGCATGAACCACTGCAGATGAGCTGATAAGCAGAAATTCTCAAGTGGGTTTCACTAATAAATGTTTTTTTATATGATTTGAAATCAAGT
AAAGGGACAATGTTTATGTACGTGTATAACAACATTCAGCACATTTGAGGAATCACACACTATAATAAAGCTTAAACCTGTCATAGAACC
TTGATCTATATTACTTTGTCTTCAGTAAAAAGTGAAGGATGAGATTTTGTCTTTCATGTTATTGTAGCTGGCATGCTTCAAAATTTTGAG
CTTACTGGGACTGACAGCCTCTCACTTCAATCTGAGGGATTGACAGAATTTAAACAGGCTCATTGATTCTGTACACTCTACCCTTCCTGT
GGCAAGTGATAATGGGATTTCATTAATGAATCAATTTGTTTTACAAATGACATCCACTGTGGCATTGGAAGACAGTTGGGTCTGACTCAA
GTTTAACATTTCTTACCAAACATTCTTAAGTATGAAATTGGTCCTTTAATCCAAATGCTCTTGGTCATGGCTGTCCTTTGCGGATTACAT
AGCATTCAGGAAAGTACAAAAACTAAACACTAAATCCCCAACTGGCCCCAAAGACCTTTTATGATGTGAGAGACAAGAGTTCACCCCAGA
TTAATTTCTTTTATCATTGGCTTTATACTCTAACATATAGATACTCTCTATAGCAAAAAAGGGATGAATGGCTTTCAATATTCATTTCTG
TTTATTTTTGTGAGGGAAAATAATATATCAAGAAAATTTTCTTCCACTTAGAAAGCTTTAAAGCTGAAGTAGAGGTGCAGTCAAGCTTGG
ATCTGCAGGAAGAACCACTAGGCCACTGAGTCATACTTGAGCTTTTCTTACTACTGCCCCAATTTCTAAATTGTGCATAAATACAATCAC
TCTCAATTTTTGAAGGGCTAATTATCTACTTTGTGGGTGTGTTTTGTTTTTTCTTTTCAGCGTGTAGGGCTTGGGCTCTGTTTCCTTTTA
TTAGCATGTCACCTGAGGGTGGAACAAACAATTGGAAATAAAATTTGATTATTTTATTTCTTATAAAGTATTAATTTCTTAAGGGGGTTT
GAAATCATTGGTAAAATTAATATCAGTACATTATATGTCATAAATTTTGATTATCTATAATGTCTTTTCTTATCTACCACAAATAATTGA
GAGTTGGCTAAATTCTTGCAGAATATATGGGAAAAAAATCATAGCAAAGAATTCAGCTTCCCTCAAAAGAAAGCTATTTTTGTTTCCTTC
ACTCCACTAAATTTGAACCAGTAGCACGGATCAACACGACTTCTGCAATGAGAGTATAACGGTAGCTCTTGGTACAGTCATATTCATATT
TTTAAATCTTTCTTTGACCAAAACTATTGCATTGTTTTCATTACATTTTGACTGCGTTACTTATTAAGGCCGAATGACTTTGACACCCCC
GTGGATTATTTTTATGATCACATCAAATTTAAACAATGTCCAAAGTGTAACTTTAATGTTATATTTTGTTTCAAACCCTCTGGTCTAAGA
TTATTGAGAAAGATGTTTTTTCCTCCTCCCTCAAATATGTTATCTCTTCATATATAAAAAAATAAGTTATTCCATGCTTTTCAGGAACTG
TAAAAATTATTTCAAAAAGATATTTGAAAAAGTTTTCTCTATTCTGGACACAAATGCTTCCATTTATTTCAAAAGAAGAAGAAGAAAAAT
GGAATCTTAATTTAAAAAAATATATGTAGTAGTATCTGCTATGAGATATTCAGTCTCTATAAAAAAAAAAAGGGACACAGCTTCTTTTAA
AACCCTTGTTTCAGTCCATATTCAACTTCATGGAACTTCTGAAACATCATTCAATTTTGAACTTTATTTAAGAGCATTTTTGTACTGCTG
TCTCTGACTGTCATGGAAAGTTCTGTAATTCTAAGGTGTTTCTGGTTTTATTTTTAATTTCTTCATCTGTACCACAGTCAAATTAGCAAC
CATCTCCCCCATCCCTTGGGCTTTCTGTAGATCAGTGGATGTTAGGTTTAAACTTCTGTTTTCTTTGATGAAGCTTTCAATAAAAAATGA

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000396583_chr3_29628605_+_8832nt
CGGGCCTGGGCTGTGGCTGTGACTGGCGCTGCCGTGGGCGCCGCAGCCCTCGCGGGAGCCGGACGCGGTAATGCCCCAGCGGCGCAGCGG
GCGGCTGCGTCCCTGAGCCGCTATATAAGCGCGGCAGGGAACATCCGGAGGGGCTGAAGATGAAGGTGCCCGCGCATGGGCCCCCGCTGA
TTGCCAGTCCCTCCCGACCCCGCGCCCCGCGCGGAGCCCGAGGCCGCCGAGGACCCGCCTTCGCCGCAGTAGCAGCTGGAGCAGCGACAG
AGGCGGCAGCTGCGGCGGCGGCGGCGCCCGCGCCCCTCGCGCCAGCGCGTAGAGCGGCGGCGGCAGCTCGGGGGCCGCCACTGCCCCGGC
TGCCATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCC
CACAGCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCT
TCCCAGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGT
CCTTTTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGA
ATCTGCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTC
CTTTTGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTT
TTCTGCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTA
TCCTTTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCG
CCACCGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGC
GGCCAGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCA
TGGAACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGT
AGCATCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCAT
TTCTATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAG
CAGAGGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACC
AGGCATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAA
TGGGAGGCCTTGGCCCAGGGAAGGAGAGGTACTCAGAGGCAGGACTGTCCCTAGGCAAAATCGTGAAGCTGGCATGGCTTTGACCTATGA
CCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTACAGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATT
CATTGCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAGTACTTCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGT
GATTACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCCAACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGG
CACAACAGGAACGTATATGACTGCTGCTGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTAT
TGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACAC
ATCCAACGAACATGCACCTGCATATTCTTACCAACAGTCTAAACCATAAACAGGACTGAAGAATGTCTGTCTGAATCTTTGCCTTGAATG
AAGAAACTTCATTGAACAAGAAGTTGGCTTCCAGTTTGCACAGACGTCAATGGAATGCATTTTTTTGTTGTTGTTGTTGTTTTTTTTTTA
GTGTTATACCTTACCCAATGAAAGCAAAGTTTTTATGTGCTGTGCAAATGGTCTTCATGTGGTCTGACAATTTATTTTTGCCATCATTTT
TTTAATTAAAGAAAAAATTTCCAGAAGAGGAAAAAAAAACTACAAAAAACAAAACATTGAAGGTTGATATTTTATGTGGAAGAACATTTG
AATTGAATTCAGAATTTTTCTGAAGGTGTAGATACTTTTTTTTTTTTTTTAACAGAAAACCTGATGTCAAGAGGTGGGCAATAGAAATGG
AAACAAATTGTCTTCCTCAATAATTAAGCTACTTTCTCTTTTTCCCTTCTTGTTTTAATCTAGTGGGTTTTTTATTTTATTTTTTCTTAG
AAATATGTAGGTAAGGTTTATCTTGAATCTTAATTGCCTTAATTTTAAGGACGTCAAAGGCTCTCGAGGCAAGCTGTCAACGTCTTGTTG
AAAACAAAAATCAAGAAAGAATTGAAATACTGTGCCGGCTTTCACTGGCACAGAAGTTTAAGACTATGAGTTTTTAGGGTGAAGAAAAAA
CTGTACAGTTTAAATGAAAATGTTTTTCTTCATTTGAAGAAAATTTGTTGATAAACCATGGCAACTGCAAGAATTGGAAAAATGCTGGGA
CTTTTCATGAACTTTGTCTTAAGTGTTGACATGAATCATTCTAAAAGGCTAAAACATTTTACAGTAAAGTTATTAAGGTTGGTTTAAAAA
CAACTGCATTAGAAATAATGCGTGTTTGGGGGGCAGAATGCAGATTTTTTTAATTTACAAAGCGTGATCGCTAGCAAAAGCATTAGTGCT
TTTTATCTGCAGTCTTTTTTATGAGCTTTACAAAGTTTTTAGTCAGCTTTGCTTGTCACATTGCAAAACCTAGCTTAAGAGCATTAAAAA
AAAAAACTTAAGTAGATAGGAGCTTATGGTCAAAAAGTGCAAAAAAAAAAACAAAAAAAAAGCAATAGATAGAGAAATTGTTGACAATTT
CTGTAGTCTTTCCTAGTTGTGATCAAATTCAGCCTATGGATGGCCTATTTTATACCAAAGATGAAGTGACACCCTATTACAGTCCAGAAG
ATAGAGGTTGTTTTCGTTTCTTTTCTTTTTAAAAAAAAAAAAATTTATTTGACCGACATGGCCGGACCAGTTCTTTCTTTGTTGTTTGTT
TAAACTACCTTCCACTGGTGTTTTACATAGTGCAAAAAAAAAAAGAGGGTGGGGGGAGTTGTCTCTCTTTTCTTTAAATGTGTATTCATT
GATAGCAGAAGCTTGTACCTGCTGTGTTTAGCAGTTTCAGCATGAAGAGTTCTGGATATGAACTGATTCATAGAGCCAAGTGGCTTTAAA
TTCTGTGAGCTTTTCTGGTTTCTCACTAGCTGTCTTGAATAGTGAAACCTGTATTGATGGCCACTAGTAAACCAAGATGCTTATTTAACA
GGTGGAATATTCTTTATATGAAATTTCAGCTAAAGACACTTTCTGGACCTGGTCTGAAAGGTCATTTGTCAAAAAAGCTTAGGGATATTC
TGTGAAATGGTGAGTGGTCTCCTGGAAAGGTCTCATTGTATTTGAACAATAGTCTTCCCTCTAAATTACAACACCTCTGGGTTTTGTCTT
TACACCTCTGTCTTTGTCATCACCTACCATGAATAGTCACCTTGGTTTTGCAAATGGGGAGGGGGTATCATCTTTTTGCCTGTTTTCACT
GTATTTTTGTATATTGGTGTTGCCGAAAGAACTTTTTCTTTCAGTTTAATTCTTTGAGGCATGTAGGACCAATAAGATTGAGAATTCTAT
TGGTGGAATTTAGGGAAGTCCTTAAAATGCTAGTTGACAATCAAGGAACAGTATGATTTATATCAATAAGAACCAAAAGAATTAGGTTTG
ATCAATCATTTAAGCCAAGGAGGAATACTTGCATTTAGAACAATGCAAAACTTTGTCTAAAATGAATTAAATTGACCCACCTGTAAAATA
TATCTACATTTTTAATTCATGAGATGATATGTGTTCAACCTTTACAGTTTTACCTGAAATTAAGGACAATGGAATAGAATTTGTTAAGTG
AACCATTCACTAGATTGCTTTCTGAATGAATCCTTTGAATCAAATAGGTGAAACTCTTTTCAAAAACTAAGTCAGTCACAGGAGCCTGTC
TTAGTCCAAAAGAAGCAGGGAAATGTATTTAAGTGTACTATAAAACAGGGTAGGCTTTTTAAAAACTAAAAAGTTTTAAAGGTAAATCAT
ATTCCCATTAGGTCAACATGAGTAATAAGGTTGACTCATGTGAAATTGTCAATATTCTACTATTTCTGTAAACTCTGGTTCTCTTATTTG
CAACCCCATGCACTGGAAGCCCAAATCAGAGAATGACTCCATATATTTATGGTCACATTGGAGACAAAAGTGTATCCAAGAAAATGTAGT
GTGCGTTATAGAGAAATTCCAACTGGTCACACTCACCATTATGGTTTTTCATGCTTTAGAGAAAATGCTAGATTTATACTGTCTTTTGTT
CCATCCTTCAGCTTCCCATGCATTATAAAGGTGGCACTTAAGTTTTTATCTTTGAAAAGTGGGCCCCAAAGTTTTTTGGGGTACAAAAAG
ACATGTATGAGAACCATATTTTCTGTTTCTCTTTTTCACTCTCTAAACTCTTTTTGTATAAATAAGGATTATCCTGGGCATAATTCATTT
GAATATGAAACCAACATACTTTCTTTCATTTTTGTGAAAAAATAACCAAAAACATGTATTAATGTGATACAAAGAAAGTCTCATTCACAC
AATCAACAATGAGGCTAAGAGGTAGCTACCATGTGGCTAATGAATGTGCCTAGGTAACTTCCTGTTTCTATTCAAAACTGCTGCTTTATT
TGTACATTCAGAAATATTTTTTTCAACTATGAAATTTCAATATCAATTTTTTAAGCCAGTTTCTGCAAAAGGAAATGACCTGTCATTTGA
TGTGTTCATGTGTGTTTTGTGTTTGGATAGTTTATATCATGCCATTCTATAAAATGTATGTTTTCAAACCAAAAAGAAAAAAAATAGAAG
GAAAACAACGGCACATACTCAAATTTGCCCTGCTTTGTCTGTTGTCTTACCTAAGACTTGTTTTGAAGAGCCAAGTCTGGGAGAGAAAAA
AAAGCATCAACAGGTAAGCAGCATTACATTGTGTGGTAATAAACCAAAATAAGTTTTCAATATATACAGACAACAGAATTCAAATTTAAT
CAACAAAATATATTGTAGTGATTTGTTTGTTTGTTTGTTTGAGACGGAGTCTCGCTCTGTCGCCCATCCTAACTAGGACTATAATCTTTT
TTTTTTTCTTTAAGTTGAAGTTAATTTTCTGTGCATTCTGGTCCACCAGATTTTCAAGCATTTATTTGGATGTTTCCATTTTTCCTTTTG
ACTTTAATAGCCAAGACTTAGCTTAAACATCAGGAAACAAACTAAAGCCACAATCCAAATGAGAGAAACACTGTCTCGTCTAAACTCTAG
TTTCATGGTCAGTGCAACAGTGAGTTTTCTTTTAATAATGGTATGGTATTGTCAAGGGAGGCAAAGTGTTCATGGTAACTTGGAGCTCCC
CAATACATGGCCATGTCTTCTAAAGACAACGTAATGAGCCCAAGTGAACTGAAGGTCATACTGGCAGGTGCTGATGACAGTTTGTCCTTG
AATGCTGACATGTCTTGAATATTGCAAATGTCATAATACTCTTTTAAAACAGTCCTCTACCTGACTCTAGTTTTGCGAGGATTAGTTTGT
TTCCTTGGTAGATTTCAACATTTCAGAATGTTACCTCCAAATTTCACTTGAATTACTTCCTCCTGTGACCTTAGCAGATCTGTCACATTT
GAAAGCATATGACTCACTTCCACCCCCTTCTAATGAAAAACTGCATGGTGTTAAAAGCACTCTCATTAGAAATATAAGGCTGAGAACTGA
AGAAGGCTGTTTAAAGCAGGAATTTCACTTTATTTTACTATGCCTAAAAATACATCTTTGGACCCCTTGCAAAGTGCTTTAAAAGTACTT
TCAATTTATGCATGACTCCAAAAAAGTAATTTTTTTTTCCCAAAAAAACCTCTTTATTTAAATAATTGGGATATTTGCTAAATACCTATT
TTTTTTTACAGTGGCCTAAAACCCCTATTAATGAAAAGTGAAATTTGATTTAATTAGGACTCTTGCAGTCATCTTCACGACTGAGGAGAA
GTTTCAATAGGCTGTCTAGACATTATGATGTTAATAGGAGATTAAAATACATTTGGCAATTCATTTTCATTCTTAATTTGAGTGCATGAA
CCACTGCAGATGAGCTGATAAGCAGAAATTCTCAAGTGGGTTTCACTAATAAATGTTTTTTTATATGATTTGAAATCAAGTAAAGGGACA
ATGTTTATGTACGTGTATAACAACATTCAGCACATTTGAGGAATCACACACTATAATAAAGCTTAAACCTGTCATAGAACCTTGATCTAT
ATTACTTTGTCTTCAGTAAAAAGTGAAGGATGAGATTTTGTCTTTCATGTTATTGTAGCTGGCATGCTTCAAAATTTTGAGCTTACTGGG
ACTGACAGCCTCTCACTTCAATCTGAGGGATTGACAGAATTTAAACAGGCTCATTGATTCTGTACACTCTACCCTTCCTGTGGCAAGTGA
TAATGGGATTTCATTAATGAATCAATTTGTTTTACAAATGACATCCACTGTGGCATTGGAAGACAGTTGGGTCTGACTCAAGTTTAACAT
TTCTTACCAAACATTCTTAAGTATGAAATTGGTCCTTTAATCCAAATGCTCTTGGTCATGGCTGTCCTTTGCGGATTACATAGCATTCAG
GAAAGTACAAAAACTAAACACTAAATCCCCAACTGGCCCCAAAGACCTTTTATGATGTGAGAGACAAGAGTTCACCCCAGATTAATTTCT
TTTATCATTGGCTTTATACTCTAACATATAGATACTCTCTATAGCAAAAAAGGGATGAATGGCTTTCAATATTCATTTCTGTTTATTTTT
GTGAGGGAAAATAATATATCAAGAAAATTTTCTTCCACTTAGAAAGCTTTAAAGCTGAAGTAGAGGTGCAGTCAAGCTTGGATCTGCAGG
AAGAACCACTAGGCCACTGAGTCATACTTGAGCTTTTCTTACTACTGCCCCAATTTCTAAATTGTGCATAAATACAATCACTCTCAATTT
TTGAAGGGCTAATTATCTACTTTGTGGGTGTGTTTTGTTTTTTCTTTTCAGCGTGTAGGGCTTGGGCTCTGTTTCCTTTTATTAGCATGT
CACCTGAGGGTGGAACAAACAATTGGAAATAAAATTTGATTATTTTATTTCTTATAAAGTATTAATTTCTTAAGGGGGTTTGAAATCATT
GGTAAAATTAATATCAGTACATTATATGTCATAAATTTTGATTATCTATAATGTCTTTTCTTATCTACCACAAATAATTGAGAGTTGGCT
AAATTCTTGCAGAATATATGGGAAAAAAATCATAGCAAAGAATTCAGCTTCCCTCAAAAGAAAGCTATTTTTGTTTCCTTCACTCCACTA
AATTTGAACCAGTAGCACGGATCAACACGACTTCTGCAATGAGAGTATAACGGTAGCTCTTGGTACAGTCATATTCATATTTTTAAATCT
TTCTTTGACCAAAACTATTGCATTGTTTTCATTACATTTTGACTGCGTTACTTATTAAGGCCGAATGACTTTGACACCCCCGTGGATTAT
TTTTATGATCACATCAAATTTAAACAATGTCCAAAGTGTAACTTTAATGTTATATTTTGTTTCAAACCCTCTGGTCTAAGATTATTGAGA
AAGATGTTTTTTCCTCCTCCCTCAAATATGTTATCTCTTCATATATAAAAAAATAAGTTATTCCATGCTTTTCAGGAACTGTAAAAATTA
TTTCAAAAAGATATTTGAAAAAGTTTTCTCTATTCTGGACACAAATGCTTCCATTTATTTCAAAAGAAGAAGAAGAAAAATGGAATCTTA
ATTTAAAAAAATATATGTAGTAGTATCTGCTATGAGATATTCAGTCTCTATAAAAAAAAAAAGGGACACAGCTTCTTTTAAAACCCTTGT
TTCAGTCCATATTCAACTTCATGGAACTTCTGAAACATCATTCAATTTTGAACTTTATTTAAGAGCATTTTTGTACTGCTGTCTCTGACT
GTCATGGAAAGTTCTGTAATTCTAAGGTGTTTCTGGTTTTATTTTTAATTTCTTCATCTGTACCACAGTCAAATTAGCAACCATCTCCCC
CATCCCTTGGGCTTTCTGTAGATCAGTGGATGTTAGGTTTAAACTTCTGTTTTCTTTGATGAAGCTTTCAATAAAAAATGAAAATAAAAT

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000383767_chr3_29628605_+_2522nt
CGGGCCTGGGCTGTGGCTGTGACTGGCGCTGCCGTGGGCGCCGCAGCCCTCGCGGGAGCCGGACGCGGTAATGCCCCAGCGGCGCAGCGG
GCGGCTGCGTCCCTGAGCCGCTATATAAGCGCGGCAGGGAACATCCGGAGGGGCTGAAGATGAAGGTGCCCGCGCATGGGCCCCCGCTGA
TTGCCAGTCCCTCCCGACCCCGCGCCCCGCGCGGAGCCCGAGGCCGCCGAGGACCCGCCTTCGCCGCAGTAGCAGCTGGAGCAGCGACAG
AGGCGGCAGCTGCGGCGGCGGCGGCGCCCGCGCCCCTCGCGCCAGCGCGTAGAGCGGCGGCGGCAGCTCGGGGGCCGCCACTGCCCCGGC
TGCCATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCC
CACAGCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCT
TCCCAGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGT
CCTTTTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGA
ATCTGCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTC
CTTTTGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTT
TTCTGCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTA
TCCTTTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCG
CCACCGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGC
GGCCAGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCA
TGGAACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGT
AGCATCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCAT
TTCTATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAG
CAGAGGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACC
AGGCATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAA
TGGGAGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACC
GTACAGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAG
TACTTCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATTACACCAACCATGGACCATCCCATGTCAATGCAGCC
AGCCAACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACAACAGGAACGATTCAATCCCAAGACAGGATTATGAT
ACTCCACCAGCTGTTGTGTCAGTATATGACTGCTGCTGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGC
TGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGC
AGTGGACACATCCAACGAACATGCACCTGCATATTCTTACCAACAGTCTAAACCATAAACAGGACTGAAGAATGTCTGTCTGAATCTTTG
CCTTGAATGAAGAAACTTCATTGAACAAGAAGTTGGCTTCCAGTTTGCACAGACGTCAATGGAATGCATTTTTTTGTTGTTGTTGTTGTT
TTTTTTTTAGTGTTATACCTTACCCAATGAAAGCAAAGTTTTTATGTGCTGTGCAAATGGTCTTCATGTGGTCTGACAATTTATTTTTGC

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000445033_chr3_29628605_+_1803nt
CGGGCCTGGGCTGTGGCTGTGACTGGCGCTGCCGTGGGCGCCGCAGCCCTCGCGGGAGCCGGACGCGGTAATGCCCCAGCGGCGCAGCGG
GCGGCTGCGTCCCTGAGCCGCTATATAAGCGCGGCAGGGAACATCCGGAGGGGCTGAAGATGAAGGTGCCCGCGCATGGGCCCCCGCTGA
TTGCCAGTCCCTCCCGACCCCGCGCCCCGCGCGGAGCCCGAGGCCGCCGAGGACCCGCCTTCGCCGCAGTAGCAGCTGGAGCAGCGACAG
AGGCGGCAGCTGCGGCGGCGGCGGCGCCCGCGCCCCTCGCGCCAGCGCGTAGAGCGGCGGCGGCAGCTCGGGGGCCGCCACTGCCCCGGC
TGCCATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCC
CACAGCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCT
TCCCAGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGT
CCTTTTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGA
ATCTGCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTC
CTTTTGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTT
TTCTGCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTA
TCCTTTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCG
CCACCGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGC
GGCCAGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCA
TGGAACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGT
AGCATCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCAT
TTCTATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAG
CAGAGGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACC
AGGCATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAA
TGGGAGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGGTAAGTAGATCACAT

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000273139_chr3_29628605_+_2362nt
CGGGCCTGGGCTGTGGCTGTGACTGGCGCTGCCGTGGGCGCCGCAGCCCTCGCGGGAGCCGGACGCGGTAATGCCCCAGCGGCGCAGCGG
GCGGCTGCGTCCCTGAGCCGCTATATAAGCGCGGCAGGGAACATCCGGAGGGGCTGAAGATGAAGGTGCCCGCGCATGGGCCCCCGCTGA
TTGCCAGTCCCTCCCGACCCCGCGCCCCGCGCGGAGCCCGAGGCCGCCGAGGACCCGCCTTCGCCGCAGTAGCAGCTGGAGCAGCGACAG
AGGCGGCAGCTGCGGCGGCGGCGGCGCCCGCGCCCCTCGCGCCAGCGCGTAGAGCGGCGGCGGCAGCTCGGGGGCCGCCACTGCCCCGGC
TGCCATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCC
CACAGCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCT
TCCCAGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGT
CCTTTTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGA
ATCTGCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTC
CTTTTGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTT
TTCTGCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTA
TCCTTTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCG
CCACCGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGC
GGCCAGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCA
TGGAACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGT
AGCATCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCAT
TTCTATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAG
CAGAGGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACC
AGGCATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAA
TGGGAGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACC
GTACAGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAG
TACTTCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATTACACCAACCATGGACCATCCCATGTCAATGCAGCC
AGCCAACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACAACAGGAACGTATATGACTGCTGCTGCTCCTATGCA
AGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGC
ACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACACATCCAACGAACATGCACCTGCATATTCTTACCAACAGTC
TAAGTAAGTCTGGGCTGTGCTAAGCTCTTTTCCTCAAGATCAGCCATCTTGACATCACTCTCTCATGTTGTATGTGTTAGCTTTTGCTGA

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000383766_chr3_29628605_+_3524nt
CGGGCCTGGGCTGTGGCTGTGACTGGCGCTGCCGTGGGCGCCGCAGCCCTCGCGGGAGCCGGACGCGGTAATGCCCCAGCGGCGCAGCGG
GCGGCTGCGTCCCTGAGCCGCTATATAAGCGCGGCAGGGAACATCCGGAGGGGCTGAAGATGAAGGTGCCCGCGCATGGGCCCCCGCTGA
TTGCCAGTCCCTCCCGACCCCGCGCCCCGCGCGGAGCCCGAGGCCGCCGAGGACCCGCCTTCGCCGCAGTAGCAGCTGGAGCAGCGACAG
AGGCGGCAGCTGCGGCGGCGGCGGCGCCCGCGCCCCTCGCGCCAGCGCGTAGAGCGGCGGCGGCAGCTCGGGGGCCGCCACTGCCCCGGC
TGCCATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCC
CACAGCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCT
TCCCAGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGT
CCTTTTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGA
ATCTGCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTC
CTTTTGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTT
TTCTGCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTA
TCCTTTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCG
CCACCGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGC
GGCCAGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCA
TGGAACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGT
AGCATCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCAT
TTCTATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAG
CAGAGGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACC
AGGCATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAA
TGGGAGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACC
GTACAGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATACCAGGGTGCTGT
GATTACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCCAACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGG
CACAACAGGAACGATTCAATCCCAAGACAGGATTATGATACTCCACCAGCTGTTGTGTCAGTATATGACTGCTGCTGCTCCTATGCAAGG
GACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACC
TTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACACATCCAACGAACATGCACCTGCATATTCTTACCAACAGTCTAA
ACCATAAACAGGACTGAAGAATGTCTGTCTGAATCTTTGCCTTGAATGAAGAAACTTCATTGAACAAGAAGTTGGCTTCCAGTTTGCACA
GACGTCAATGGAATGCATTTTTTTGTTGTTGTTGTTGTTTTTTTTTTAGTGTTATACCTTACCCAATGAAAGCAAAGTTTTTATGTGCTG
TGCAAATGGTCTTCATGTGGTCTGACAATTTATTTTTGCCATCATTTTTTTAATTAAAGAAAAAATTTCCAGAAGAGGAAAAAAAAACTA
CAAAAAACAAAACATTGAAGGTTGATATTTTATGTGGAAGAACATTTGAATTGAATTCAGAATTTTTCTGAAGGTGTAGATACTTTTTTT
TTTTTTTTAACAGAAAACCTGATGTCAAGAGGTGGGCAATAGAAATGGAAACAAATTGTCTTCCTCAATAATTAAGCTACTTTCTCTTTT
TCCCTTCTTGTTTTAATCTAGTGGGTTTTTTATTTTATTTTTTCTTAGAAATATGTAGGTAAGGTTTATCTTGAATCTTAATTGCCTTAA
TTTTAAGGACGTCAAAGGCTCTCGAGGCAAGCTGTCAACGTCTTGTTGAAAACAAAAATCAAGAAAGAATTGAAATACTGTGCCGGCTTT
CACTGGCACAGAAGTTTAAGACTATGAGTTTTTAGGGTGAAGAAAAAACTGTACAGTTTAAATGAAAATGTTTTTCTTCATTTGAAGAAA
ATTTGTTGATAAACCATGGCAACTGCAAGAATTGGAAAAATGCTGGGACTTTTCATGAACTTTGTCTTAAGTGTTGACATGAATCATTCT
AAAAGGCTAAAACATTTTACAGTAAAGTTATTAAGGTTGGTTTAAAAACAACTGCATTAGAAATAATGCGTGTTTGGGGGGCAGAATGCA
GATTTTTTTAATTTACAAAGCGTGATCGCTAGCAAAAGCATTAGTGCTTTTTATCTGCAGTCTTTTTTATGAGCTTTACAAAGTTTTTAG
TCAGCTTTGCTTGTCACATTGCAAAACCTAGCTTAAGAGCATTAAAAAAAAAAACTTAAGTAGATAGGAGCTTATGGTCAAAAAGTGCAA
AAAAAAAAACAAAAAAAAAGCAATAGATAGAGAAATTGTTGACAATTTCTGTAGTCTTTCCTAGTTGTGATCAAATTCAGCCTATGGATG
GCCTATTTTATACCAAAGATGAAGTGACACCCTATTACAGTCCAGAAGATAGAGGTTGTTTTCGTTTCTTTTCTTTTTAAAAAAAAAAAA

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000452462_chr3_29628605_+_2411nt
CGGGCCTGGGCTGTGGCTGTGACTGGCGCTGCCGTGGGCGCCGCAGCCCTCGCGGGAGCCGGACGCGGTAATGCCCCAGCGGCGCAGCGG
GCGGCTGCGTCCCTGAGCCGCTATATAAGCGCGGCAGGGAACATCCGGAGGGGCTGAAGATGAAGGTGCCCGCGCATGGGCCCCCGCTGA
TTGCCAGTCCCTCCCGACCCCGCGCCCCGCGCGGAGCCCGAGGCCGCCGAGGACCCGCCTTCGCCGCAGTAGCAGCTGGAGCAGCGACAG
AGGCGGCAGCTGCGGCGGCGGCGGCGCCCGCGCCCCTCGCGCCAGCGCGTAGAGCGGCGGCGGCAGCTCGGGGGCCGCCACTGCCCCGGC
TGCCATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCC
CACAGCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCT
TCCCAGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGT
CCTTTTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGA
ATCTGCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTC
CTTTTGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTT
TTCTGCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTA
TCCTTTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCG
CCACCGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGC
GGCCAGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCA
TGGAACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGT
AGCATCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCAT
TTCTATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAG
CAGAGGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACC
AGGCATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAA
TGGGAGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACC
GTACAGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAG
TACTTCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATTACACCAACCATGGACCATCCCATGTCAATGCAGCC
AGCCAACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACAACAGGAACGTATATGACTGCTGCTGCTCCTATGCA
AGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGC
ACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACACATCCAACGAACATGCACCTGCATATTCTTACCAACAGTC
TAAACCATAAACAGGACTGAAGAATGTCTGTCTGAATCTTTGCCTTGAATGAAGAAACTTCATTGAACAAGAAGTTGGCTTCCAGTTTGC

>In-frame_VGLL3_ENST00000398399_chr3_87017740_-_RBMS3_ENST00000456853_chr3_29628605_+_2322nt
CGGGCCTGGGCTGTGGCTGTGACTGGCGCTGCCGTGGGCGCCGCAGCCCTCGCGGGAGCCGGACGCGGTAATGCCCCAGCGGCGCAGCGG
GCGGCTGCGTCCCTGAGCCGCTATATAAGCGCGGCAGGGAACATCCGGAGGGGCTGAAGATGAAGGTGCCCGCGCATGGGCCCCCGCTGA
TTGCCAGTCCCTCCCGACCCCGCGCCCCGCGCGGAGCCCGAGGCCGCCGAGGACCCGCCTTCGCCGCAGTAGCAGCTGGAGCAGCGACAG
AGGCGGCAGCTGCGGCGGCGGCGGCGCCCGCGCCCCTCGCGCCAGCGCGTAGAGCGGCGGCGGCAGCTCGGGGGCCGCCACTGCCCCGGC
TGCCATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGCGACAACCTGCCC
CACAGCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCTGGAAGTCACCCT
TCCCAGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAACTCTCGCTGTGT
CCTTTTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCACCCTCCATCCAGA
ATCTGCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAGTTTCCCAACTTC
CTTTTGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACCCCCTGGCACCTT
TTCTGCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGAGTCCTGGCCTTA
TCCTTTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCACATGCACCACCG
CCACCGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCCTTCAGTGCATGC
GGCCAGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGCTGGAGCCTTTCA
TGGAACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGCACAGAAAGCGGT
AGCATCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTCAAATCTCCCCAT
TTCTATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGCTAATGGAGTCAG
CAGAGGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCTGAAAACACCACC
AGGCATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAAATATACCCAGAA
TGGGAGGCCTTGGCCCAGGGAAGGAGAGGTACTCAGAGGCAGGACTGTCCCTAGGCAAAATCGTGAAGCTGGCATGGCTTTGACCTATGA
CCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTACAGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATT
CATTGCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAGTACTTCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGT
GATTACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCCAACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGG
CACAACAGGAACGTATATGACTGCTGCTGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTAT
TGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACAC

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000434693_chr3_29628605_+_8849nt
GGCTGCCCGACCCGGGCCTGGGCTGTGGCTGTGACTGGCGCTGCCGTGGGCGCCGCAGCCCTCGCGGGAGCCGGACGCGGTAATGCCCCA
GCGGCGCAGCGGGCGGCTGCGTCCCTGAGCCGCTATATAAGCGCGGCAGGGAACATCCGGAGGGGCTGAAGATGAAGGTGCCCGCGCATG
GGCCCCCGCTGATTGCCAGTCCCTCCCGACCCCGCGCCCCGCGCGGAGCCCGAGGCCGCCGAGGACCCGCCTTCGCCGCAGTAGCAGCTG
GAGCAGCGACAGAGGCGGCAGCTGCGGCGGCGGCGGCGCCCGCGCCCCTCGCGCCAGCGCGTAGAGCGGCGGCGGCAGCTCGGGGGCCGC
CACTGCCCCGGCTGCCATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGC
GACAACCTGCCCCACAGCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCT
GGAAGTCACCCTTCCCAGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAA
CTCTCGCTGTGTCCTTTTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCAC
CCTCCATCCAGAATCTGCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAG
TTTCCCAACTTCCTTTTGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACC
CCCTGGCACCTTTTCTGCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGA
GTCCTGGCCTTATCCTTTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCA
CATGCACCACCGCCACCGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCC
TTCAGTGCATGCGGCCAGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGC
TGGAGCCTTTCATGGAACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGC
ACAGAAAGCGGTAGCATCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTC
AAATCTCCCCATTTCTATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGC
TAATGGAGTCAGCAGAGGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCT
GAAAACACCACCAGGCATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAA
ATATACCCAGAATGGGAGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATT
TTATTCTTCACCGTACAGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATA
CCAGGTCCAGAGTACTTCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATTACACCAACCATGGACCATCCCAT
GTCAATGCAGCCAGCCAACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACAACAGGAACGATTCAATCCCAAGA
CAGGATTATGATACTCCACCAGCTGTTGTGTCAGTATATGACTGCTGCTGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGT
GCCTCCGACAGCTGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCA
GCAACAGATAGCAGTGGACACATCCAACGAACATGCACCTGCATATTCTTACCAACAGTCTAAACCATAAACAGGACTGAAGAATGTCTG
TCTGAATCTTTGCCTTGAATGAAGAAACTTCATTGAACAAGAAGTTGGCTTCCAGTTTGCACAGACGTCAATGGAATGCATTTTTTTGTT
GTTGTTGTTGTTTTTTTTTTAGTGTTATACCTTACCCAATGAAAGCAAAGTTTTTATGTGCTGTGCAAATGGTCTTCATGTGGTCTGACA
ATTTATTTTTGCCATCATTTTTTTAATTAAAGAAAAAATTTCCAGAAGAGGAAAAAAAAACTACAAAAAACAAAACATTGAAGGTTGATA
TTTTATGTGGAAGAACATTTGAATTGAATTCAGAATTTTTCTGAAGGTGTAGATACTTTTTTTTTTTTTTTAACAGAAAACCTGATGTCA
AGAGGTGGGCAATAGAAATGGAAACAAATTGTCTTCCTCAATAATTAAGCTACTTTCTCTTTTTCCCTTCTTGTTTTAATCTAGTGGGTT
TTTTATTTTATTTTTTCTTAGAAATATGTAGGTAAGGTTTATCTTGAATCTTAATTGCCTTAATTTTAAGGACGTCAAAGGCTCTCGAGG
CAAGCTGTCAACGTCTTGTTGAAAACAAAAATCAAGAAAGAATTGAAATACTGTGCCGGCTTTCACTGGCACAGAAGTTTAAGACTATGA
GTTTTTAGGGTGAAGAAAAAACTGTACAGTTTAAATGAAAATGTTTTTCTTCATTTGAAGAAAATTTGTTGATAAACCATGGCAACTGCA
AGAATTGGAAAAATGCTGGGACTTTTCATGAACTTTGTCTTAAGTGTTGACATGAATCATTCTAAAAGGCTAAAACATTTTACAGTAAAG
TTATTAAGGTTGGTTTAAAAACAACTGCATTAGAAATAATGCGTGTTTGGGGGGCAGAATGCAGATTTTTTTAATTTACAAAGCGTGATC
GCTAGCAAAAGCATTAGTGCTTTTTATCTGCAGTCTTTTTTATGAGCTTTACAAAGTTTTTAGTCAGCTTTGCTTGTCACATTGCAAAAC
CTAGCTTAAGAGCATTAAAAAAAAAAACTTAAGTAGATAGGAGCTTATGGTCAAAAAGTGCAAAAAAAAAAACAAAAAAAAAGCAATAGA
TAGAGAAATTGTTGACAATTTCTGTAGTCTTTCCTAGTTGTGATCAAATTCAGCCTATGGATGGCCTATTTTATACCAAAGATGAAGTGA
CACCCTATTACAGTCCAGAAGATAGAGGTTGTTTTCGTTTCTTTTCTTTTTAAAAAAAAAAAAATTTATTTGACCGACATGGCCGGACCA
GTTCTTTCTTTGTTGTTTGTTTAAACTACCTTCCACTGGTGTTTTACATAGTGCAAAAAAAAAAAGAGGGTGGGGGGAGTTGTCTCTCTT
TTCTTTAAATGTGTATTCATTGATAGCAGAAGCTTGTACCTGCTGTGTTTAGCAGTTTCAGCATGAAGAGTTCTGGATATGAACTGATTC
ATAGAGCCAAGTGGCTTTAAATTCTGTGAGCTTTTCTGGTTTCTCACTAGCTGTCTTGAATAGTGAAACCTGTATTGATGGCCACTAGTA
AACCAAGATGCTTATTTAACAGGTGGAATATTCTTTATATGAAATTTCAGCTAAAGACACTTTCTGGACCTGGTCTGAAAGGTCATTTGT
CAAAAAAGCTTAGGGATATTCTGTGAAATGGTGAGTGGTCTCCTGGAAAGGTCTCATTGTATTTGAACAATAGTCTTCCCTCTAAATTAC
AACACCTCTGGGTTTTGTCTTTACACCTCTGTCTTTGTCATCACCTACCATGAATAGTCACCTTGGTTTTGCAAATGGGGAGGGGGTATC
ATCTTTTTGCCTGTTTTCACTGTATTTTTGTATATTGGTGTTGCCGAAAGAACTTTTTCTTTCAGTTTAATTCTTTGAGGCATGTAGGAC
CAATAAGATTGAGAATTCTATTGGTGGAATTTAGGGAAGTCCTTAAAATGCTAGTTGACAATCAAGGAACAGTATGATTTATATCAATAA
GAACCAAAAGAATTAGGTTTGATCAATCATTTAAGCCAAGGAGGAATACTTGCATTTAGAACAATGCAAAACTTTGTCTAAAATGAATTA
AATTGACCCACCTGTAAAATATATCTACATTTTTAATTCATGAGATGATATGTGTTCAACCTTTACAGTTTTACCTGAAATTAAGGACAA
TGGAATAGAATTTGTTAAGTGAACCATTCACTAGATTGCTTTCTGAATGAATCCTTTGAATCAAATAGGTGAAACTCTTTTCAAAAACTA
AGTCAGTCACAGGAGCCTGTCTTAGTCCAAAAGAAGCAGGGAAATGTATTTAAGTGTACTATAAAACAGGGTAGGCTTTTTAAAAACTAA
AAAGTTTTAAAGGTAAATCATATTCCCATTAGGTCAACATGAGTAATAAGGTTGACTCATGTGAAATTGTCAATATTCTACTATTTCTGT
AAACTCTGGTTCTCTTATTTGCAACCCCATGCACTGGAAGCCCAAATCAGAGAATGACTCCATATATTTATGGTCACATTGGAGACAAAA
GTGTATCCAAGAAAATGTAGTGTGCGTTATAGAGAAATTCCAACTGGTCACACTCACCATTATGGTTTTTCATGCTTTAGAGAAAATGCT
AGATTTATACTGTCTTTTGTTCCATCCTTCAGCTTCCCATGCATTATAAAGGTGGCACTTAAGTTTTTATCTTTGAAAAGTGGGCCCCAA
AGTTTTTTGGGGTACAAAAAGACATGTATGAGAACCATATTTTCTGTTTCTCTTTTTCACTCTCTAAACTCTTTTTGTATAAATAAGGAT
TATCCTGGGCATAATTCATTTGAATATGAAACCAACATACTTTCTTTCATTTTTGTGAAAAAATAACCAAAAACATGTATTAATGTGATA
CAAAGAAAGTCTCATTCACACAATCAACAATGAGGCTAAGAGGTAGCTACCATGTGGCTAATGAATGTGCCTAGGTAACTTCCTGTTTCT
ATTCAAAACTGCTGCTTTATTTGTACATTCAGAAATATTTTTTTCAACTATGAAATTTCAATATCAATTTTTTAAGCCAGTTTCTGCAAA
AGGAAATGACCTGTCATTTGATGTGTTCATGTGTGTTTTGTGTTTGGATAGTTTATATCATGCCATTCTATAAAATGTATGTTTTCAAAC
CAAAAAGAAAAAAAATAGAAGGAAAACAACGGCACATACTCAAATTTGCCCTGCTTTGTCTGTTGTCTTACCTAAGACTTGTTTTGAAGA
GCCAAGTCTGGGAGAGAAAAAAAAGCATCAACAGGTAAGCAGCATTACATTGTGTGGTAATAAACCAAAATAAGTTTTCAATATATACAG
ACAACAGAATTCAAATTTAATCAACAAAATATATTGTAGTGATTTGTTTGTTTGTTTGTTTGAGACGGAGTCTCGCTCTGTCGCCCATCC
TAACTAGGACTATAATCTTTTTTTTTTTCTTTAAGTTGAAGTTAATTTTCTGTGCATTCTGGTCCACCAGATTTTCAAGCATTTATTTGG
ATGTTTCCATTTTTCCTTTTGACTTTAATAGCCAAGACTTAGCTTAAACATCAGGAAACAAACTAAAGCCACAATCCAAATGAGAGAAAC
ACTGTCTCGTCTAAACTCTAGTTTCATGGTCAGTGCAACAGTGAGTTTTCTTTTAATAATGGTATGGTATTGTCAAGGGAGGCAAAGTGT
TCATGGTAACTTGGAGCTCCCCAATACATGGCCATGTCTTCTAAAGACAACGTAATGAGCCCAAGTGAACTGAAGGTCATACTGGCAGGT
GCTGATGACAGTTTGTCCTTGAATGCTGACATGTCTTGAATATTGCAAATGTCATAATACTCTTTTAAAACAGTCCTCTACCTGACTCTA
GTTTTGCGAGGATTAGTTTGTTTCCTTGGTAGATTTCAACATTTCAGAATGTTACCTCCAAATTTCACTTGAATTACTTCCTCCTGTGAC
CTTAGCAGATCTGTCACATTTGAAAGCATATGACTCACTTCCACCCCCTTCTAATGAAAAACTGCATGGTGTTAAAAGCACTCTCATTAG
AAATATAAGGCTGAGAACTGAAGAAGGCTGTTTAAAGCAGGAATTTCACTTTATTTTACTATGCCTAAAAATACATCTTTGGACCCCTTG
CAAAGTGCTTTAAAAGTACTTTCAATTTATGCATGACTCCAAAAAAGTAATTTTTTTTTCCCAAAAAAACCTCTTTATTTAAATAATTGG
GATATTTGCTAAATACCTATTTTTTTTTACAGTGGCCTAAAACCCCTATTAATGAAAAGTGAAATTTGATTTAATTAGGACTCTTGCAGT
CATCTTCACGACTGAGGAGAAGTTTCAATAGGCTGTCTAGACATTATGATGTTAATAGGAGATTAAAATACATTTGGCAATTCATTTTCA
TTCTTAATTTGAGTGCATGAACCACTGCAGATGAGCTGATAAGCAGAAATTCTCAAGTGGGTTTCACTAATAAATGTTTTTTTATATGAT
TTGAAATCAAGTAAAGGGACAATGTTTATGTACGTGTATAACAACATTCAGCACATTTGAGGAATCACACACTATAATAAAGCTTAAACC
TGTCATAGAACCTTGATCTATATTACTTTGTCTTCAGTAAAAAGTGAAGGATGAGATTTTGTCTTTCATGTTATTGTAGCTGGCATGCTT
CAAAATTTTGAGCTTACTGGGACTGACAGCCTCTCACTTCAATCTGAGGGATTGACAGAATTTAAACAGGCTCATTGATTCTGTACACTC
TACCCTTCCTGTGGCAAGTGATAATGGGATTTCATTAATGAATCAATTTGTTTTACAAATGACATCCACTGTGGCATTGGAAGACAGTTG
GGTCTGACTCAAGTTTAACATTTCTTACCAAACATTCTTAAGTATGAAATTGGTCCTTTAATCCAAATGCTCTTGGTCATGGCTGTCCTT
TGCGGATTACATAGCATTCAGGAAAGTACAAAAACTAAACACTAAATCCCCAACTGGCCCCAAAGACCTTTTATGATGTGAGAGACAAGA
GTTCACCCCAGATTAATTTCTTTTATCATTGGCTTTATACTCTAACATATAGATACTCTCTATAGCAAAAAAGGGATGAATGGCTTTCAA
TATTCATTTCTGTTTATTTTTGTGAGGGAAAATAATATATCAAGAAAATTTTCTTCCACTTAGAAAGCTTTAAAGCTGAAGTAGAGGTGC
AGTCAAGCTTGGATCTGCAGGAAGAACCACTAGGCCACTGAGTCATACTTGAGCTTTTCTTACTACTGCCCCAATTTCTAAATTGTGCAT
AAATACAATCACTCTCAATTTTTGAAGGGCTAATTATCTACTTTGTGGGTGTGTTTTGTTTTTTCTTTTCAGCGTGTAGGGCTTGGGCTC
TGTTTCCTTTTATTAGCATGTCACCTGAGGGTGGAACAAACAATTGGAAATAAAATTTGATTATTTTATTTCTTATAAAGTATTAATTTC
TTAAGGGGGTTTGAAATCATTGGTAAAATTAATATCAGTACATTATATGTCATAAATTTTGATTATCTATAATGTCTTTTCTTATCTACC
ACAAATAATTGAGAGTTGGCTAAATTCTTGCAGAATATATGGGAAAAAAATCATAGCAAAGAATTCAGCTTCCCTCAAAAGAAAGCTATT
TTTGTTTCCTTCACTCCACTAAATTTGAACCAGTAGCACGGATCAACACGACTTCTGCAATGAGAGTATAACGGTAGCTCTTGGTACAGT
CATATTCATATTTTTAAATCTTTCTTTGACCAAAACTATTGCATTGTTTTCATTACATTTTGACTGCGTTACTTATTAAGGCCGAATGAC
TTTGACACCCCCGTGGATTATTTTTATGATCACATCAAATTTAAACAATGTCCAAAGTGTAACTTTAATGTTATATTTTGTTTCAAACCC
TCTGGTCTAAGATTATTGAGAAAGATGTTTTTTCCTCCTCCCTCAAATATGTTATCTCTTCATATATAAAAAAATAAGTTATTCCATGCT
TTTCAGGAACTGTAAAAATTATTTCAAAAAGATATTTGAAAAAGTTTTCTCTATTCTGGACACAAATGCTTCCATTTATTTCAAAAGAAG
AAGAAGAAAAATGGAATCTTAATTTAAAAAAATATATGTAGTAGTATCTGCTATGAGATATTCAGTCTCTATAAAAAAAAAAAGGGACAC
AGCTTCTTTTAAAACCCTTGTTTCAGTCCATATTCAACTTCATGGAACTTCTGAAACATCATTCAATTTTGAACTTTATTTAAGAGCATT
TTTGTACTGCTGTCTCTGACTGTCATGGAAAGTTCTGTAATTCTAAGGTGTTTCTGGTTTTATTTTTAATTTCTTCATCTGTACCACAGT
CAAATTAGCAACCATCTCCCCCATCCCTTGGGCTTTCTGTAGATCAGTGGATGTTAGGTTTAAACTTCTGTTTTCTTTGATGAAGCTTTC

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000396583_chr3_29628605_+_8844nt
GGCTGCCCGACCCGGGCCTGGGCTGTGGCTGTGACTGGCGCTGCCGTGGGCGCCGCAGCCCTCGCGGGAGCCGGACGCGGTAATGCCCCA
GCGGCGCAGCGGGCGGCTGCGTCCCTGAGCCGCTATATAAGCGCGGCAGGGAACATCCGGAGGGGCTGAAGATGAAGGTGCCCGCGCATG
GGCCCCCGCTGATTGCCAGTCCCTCCCGACCCCGCGCCCCGCGCGGAGCCCGAGGCCGCCGAGGACCCGCCTTCGCCGCAGTAGCAGCTG
GAGCAGCGACAGAGGCGGCAGCTGCGGCGGCGGCGGCGCCCGCGCCCCTCGCGCCAGCGCGTAGAGCGGCGGCGGCAGCTCGGGGGCCGC
CACTGCCCCGGCTGCCATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGC
GACAACCTGCCCCACAGCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCT
GGAAGTCACCCTTCCCAGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAA
CTCTCGCTGTGTCCTTTTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCAC
CCTCCATCCAGAATCTGCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAG
TTTCCCAACTTCCTTTTGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACC
CCCTGGCACCTTTTCTGCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGA
GTCCTGGCCTTATCCTTTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCA
CATGCACCACCGCCACCGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCC
TTCAGTGCATGCGGCCAGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGC
TGGAGCCTTTCATGGAACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGC
ACAGAAAGCGGTAGCATCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTC
AAATCTCCCCATTTCTATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGC
TAATGGAGTCAGCAGAGGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCT
GAAAACACCACCAGGCATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAA
ATATACCCAGAATGGGAGGCCTTGGCCCAGGGAAGGAGAGGTACTCAGAGGCAGGACTGTCCCTAGGCAAAATCGTGAAGCTGGCATGGC
TTTGACCTATGACCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTACAGTATTGCAACCAACCGCATGATTCCACAGACATC
TATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAGTACTTCATGGATGCCTCATCCGCCATACGTTATGCAACC
AACAGGTGCTGTGATTACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCCAACATGATGGGCCCACTGACACAGCAGATGAATCA
CCTTTCGTTGGGCACAACAGGAACGTATATGACTGCTGCTGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGAC
AGCTGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGAT
AGCAGTGGACACATCCAACGAACATGCACCTGCATATTCTTACCAACAGTCTAAACCATAAACAGGACTGAAGAATGTCTGTCTGAATCT
TTGCCTTGAATGAAGAAACTTCATTGAACAAGAAGTTGGCTTCCAGTTTGCACAGACGTCAATGGAATGCATTTTTTTGTTGTTGTTGTT
GTTTTTTTTTTAGTGTTATACCTTACCCAATGAAAGCAAAGTTTTTATGTGCTGTGCAAATGGTCTTCATGTGGTCTGACAATTTATTTT
TGCCATCATTTTTTTAATTAAAGAAAAAATTTCCAGAAGAGGAAAAAAAAACTACAAAAAACAAAACATTGAAGGTTGATATTTTATGTG
GAAGAACATTTGAATTGAATTCAGAATTTTTCTGAAGGTGTAGATACTTTTTTTTTTTTTTTAACAGAAAACCTGATGTCAAGAGGTGGG
CAATAGAAATGGAAACAAATTGTCTTCCTCAATAATTAAGCTACTTTCTCTTTTTCCCTTCTTGTTTTAATCTAGTGGGTTTTTTATTTT
ATTTTTTCTTAGAAATATGTAGGTAAGGTTTATCTTGAATCTTAATTGCCTTAATTTTAAGGACGTCAAAGGCTCTCGAGGCAAGCTGTC
AACGTCTTGTTGAAAACAAAAATCAAGAAAGAATTGAAATACTGTGCCGGCTTTCACTGGCACAGAAGTTTAAGACTATGAGTTTTTAGG
GTGAAGAAAAAACTGTACAGTTTAAATGAAAATGTTTTTCTTCATTTGAAGAAAATTTGTTGATAAACCATGGCAACTGCAAGAATTGGA
AAAATGCTGGGACTTTTCATGAACTTTGTCTTAAGTGTTGACATGAATCATTCTAAAAGGCTAAAACATTTTACAGTAAAGTTATTAAGG
TTGGTTTAAAAACAACTGCATTAGAAATAATGCGTGTTTGGGGGGCAGAATGCAGATTTTTTTAATTTACAAAGCGTGATCGCTAGCAAA
AGCATTAGTGCTTTTTATCTGCAGTCTTTTTTATGAGCTTTACAAAGTTTTTAGTCAGCTTTGCTTGTCACATTGCAAAACCTAGCTTAA
GAGCATTAAAAAAAAAAACTTAAGTAGATAGGAGCTTATGGTCAAAAAGTGCAAAAAAAAAAACAAAAAAAAAGCAATAGATAGAGAAAT
TGTTGACAATTTCTGTAGTCTTTCCTAGTTGTGATCAAATTCAGCCTATGGATGGCCTATTTTATACCAAAGATGAAGTGACACCCTATT
ACAGTCCAGAAGATAGAGGTTGTTTTCGTTTCTTTTCTTTTTAAAAAAAAAAAAATTTATTTGACCGACATGGCCGGACCAGTTCTTTCT
TTGTTGTTTGTTTAAACTACCTTCCACTGGTGTTTTACATAGTGCAAAAAAAAAAAGAGGGTGGGGGGAGTTGTCTCTCTTTTCTTTAAA
TGTGTATTCATTGATAGCAGAAGCTTGTACCTGCTGTGTTTAGCAGTTTCAGCATGAAGAGTTCTGGATATGAACTGATTCATAGAGCCA
AGTGGCTTTAAATTCTGTGAGCTTTTCTGGTTTCTCACTAGCTGTCTTGAATAGTGAAACCTGTATTGATGGCCACTAGTAAACCAAGAT
GCTTATTTAACAGGTGGAATATTCTTTATATGAAATTTCAGCTAAAGACACTTTCTGGACCTGGTCTGAAAGGTCATTTGTCAAAAAAGC
TTAGGGATATTCTGTGAAATGGTGAGTGGTCTCCTGGAAAGGTCTCATTGTATTTGAACAATAGTCTTCCCTCTAAATTACAACACCTCT
GGGTTTTGTCTTTACACCTCTGTCTTTGTCATCACCTACCATGAATAGTCACCTTGGTTTTGCAAATGGGGAGGGGGTATCATCTTTTTG
CCTGTTTTCACTGTATTTTTGTATATTGGTGTTGCCGAAAGAACTTTTTCTTTCAGTTTAATTCTTTGAGGCATGTAGGACCAATAAGAT
TGAGAATTCTATTGGTGGAATTTAGGGAAGTCCTTAAAATGCTAGTTGACAATCAAGGAACAGTATGATTTATATCAATAAGAACCAAAA
GAATTAGGTTTGATCAATCATTTAAGCCAAGGAGGAATACTTGCATTTAGAACAATGCAAAACTTTGTCTAAAATGAATTAAATTGACCC
ACCTGTAAAATATATCTACATTTTTAATTCATGAGATGATATGTGTTCAACCTTTACAGTTTTACCTGAAATTAAGGACAATGGAATAGA
ATTTGTTAAGTGAACCATTCACTAGATTGCTTTCTGAATGAATCCTTTGAATCAAATAGGTGAAACTCTTTTCAAAAACTAAGTCAGTCA
CAGGAGCCTGTCTTAGTCCAAAAGAAGCAGGGAAATGTATTTAAGTGTACTATAAAACAGGGTAGGCTTTTTAAAAACTAAAAAGTTTTA
AAGGTAAATCATATTCCCATTAGGTCAACATGAGTAATAAGGTTGACTCATGTGAAATTGTCAATATTCTACTATTTCTGTAAACTCTGG
TTCTCTTATTTGCAACCCCATGCACTGGAAGCCCAAATCAGAGAATGACTCCATATATTTATGGTCACATTGGAGACAAAAGTGTATCCA
AGAAAATGTAGTGTGCGTTATAGAGAAATTCCAACTGGTCACACTCACCATTATGGTTTTTCATGCTTTAGAGAAAATGCTAGATTTATA
CTGTCTTTTGTTCCATCCTTCAGCTTCCCATGCATTATAAAGGTGGCACTTAAGTTTTTATCTTTGAAAAGTGGGCCCCAAAGTTTTTTG
GGGTACAAAAAGACATGTATGAGAACCATATTTTCTGTTTCTCTTTTTCACTCTCTAAACTCTTTTTGTATAAATAAGGATTATCCTGGG
CATAATTCATTTGAATATGAAACCAACATACTTTCTTTCATTTTTGTGAAAAAATAACCAAAAACATGTATTAATGTGATACAAAGAAAG
TCTCATTCACACAATCAACAATGAGGCTAAGAGGTAGCTACCATGTGGCTAATGAATGTGCCTAGGTAACTTCCTGTTTCTATTCAAAAC
TGCTGCTTTATTTGTACATTCAGAAATATTTTTTTCAACTATGAAATTTCAATATCAATTTTTTAAGCCAGTTTCTGCAAAAGGAAATGA
CCTGTCATTTGATGTGTTCATGTGTGTTTTGTGTTTGGATAGTTTATATCATGCCATTCTATAAAATGTATGTTTTCAAACCAAAAAGAA
AAAAAATAGAAGGAAAACAACGGCACATACTCAAATTTGCCCTGCTTTGTCTGTTGTCTTACCTAAGACTTGTTTTGAAGAGCCAAGTCT
GGGAGAGAAAAAAAAGCATCAACAGGTAAGCAGCATTACATTGTGTGGTAATAAACCAAAATAAGTTTTCAATATATACAGACAACAGAA
TTCAAATTTAATCAACAAAATATATTGTAGTGATTTGTTTGTTTGTTTGTTTGAGACGGAGTCTCGCTCTGTCGCCCATCCTAACTAGGA
CTATAATCTTTTTTTTTTTCTTTAAGTTGAAGTTAATTTTCTGTGCATTCTGGTCCACCAGATTTTCAAGCATTTATTTGGATGTTTCCA
TTTTTCCTTTTGACTTTAATAGCCAAGACTTAGCTTAAACATCAGGAAACAAACTAAAGCCACAATCCAAATGAGAGAAACACTGTCTCG
TCTAAACTCTAGTTTCATGGTCAGTGCAACAGTGAGTTTTCTTTTAATAATGGTATGGTATTGTCAAGGGAGGCAAAGTGTTCATGGTAA
CTTGGAGCTCCCCAATACATGGCCATGTCTTCTAAAGACAACGTAATGAGCCCAAGTGAACTGAAGGTCATACTGGCAGGTGCTGATGAC
AGTTTGTCCTTGAATGCTGACATGTCTTGAATATTGCAAATGTCATAATACTCTTTTAAAACAGTCCTCTACCTGACTCTAGTTTTGCGA
GGATTAGTTTGTTTCCTTGGTAGATTTCAACATTTCAGAATGTTACCTCCAAATTTCACTTGAATTACTTCCTCCTGTGACCTTAGCAGA
TCTGTCACATTTGAAAGCATATGACTCACTTCCACCCCCTTCTAATGAAAAACTGCATGGTGTTAAAAGCACTCTCATTAGAAATATAAG
GCTGAGAACTGAAGAAGGCTGTTTAAAGCAGGAATTTCACTTTATTTTACTATGCCTAAAAATACATCTTTGGACCCCTTGCAAAGTGCT
TTAAAAGTACTTTCAATTTATGCATGACTCCAAAAAAGTAATTTTTTTTTCCCAAAAAAACCTCTTTATTTAAATAATTGGGATATTTGC
TAAATACCTATTTTTTTTTACAGTGGCCTAAAACCCCTATTAATGAAAAGTGAAATTTGATTTAATTAGGACTCTTGCAGTCATCTTCAC
GACTGAGGAGAAGTTTCAATAGGCTGTCTAGACATTATGATGTTAATAGGAGATTAAAATACATTTGGCAATTCATTTTCATTCTTAATT
TGAGTGCATGAACCACTGCAGATGAGCTGATAAGCAGAAATTCTCAAGTGGGTTTCACTAATAAATGTTTTTTTATATGATTTGAAATCA
AGTAAAGGGACAATGTTTATGTACGTGTATAACAACATTCAGCACATTTGAGGAATCACACACTATAATAAAGCTTAAACCTGTCATAGA
ACCTTGATCTATATTACTTTGTCTTCAGTAAAAAGTGAAGGATGAGATTTTGTCTTTCATGTTATTGTAGCTGGCATGCTTCAAAATTTT
GAGCTTACTGGGACTGACAGCCTCTCACTTCAATCTGAGGGATTGACAGAATTTAAACAGGCTCATTGATTCTGTACACTCTACCCTTCC
TGTGGCAAGTGATAATGGGATTTCATTAATGAATCAATTTGTTTTACAAATGACATCCACTGTGGCATTGGAAGACAGTTGGGTCTGACT
CAAGTTTAACATTTCTTACCAAACATTCTTAAGTATGAAATTGGTCCTTTAATCCAAATGCTCTTGGTCATGGCTGTCCTTTGCGGATTA
CATAGCATTCAGGAAAGTACAAAAACTAAACACTAAATCCCCAACTGGCCCCAAAGACCTTTTATGATGTGAGAGACAAGAGTTCACCCC
AGATTAATTTCTTTTATCATTGGCTTTATACTCTAACATATAGATACTCTCTATAGCAAAAAAGGGATGAATGGCTTTCAATATTCATTT
CTGTTTATTTTTGTGAGGGAAAATAATATATCAAGAAAATTTTCTTCCACTTAGAAAGCTTTAAAGCTGAAGTAGAGGTGCAGTCAAGCT
TGGATCTGCAGGAAGAACCACTAGGCCACTGAGTCATACTTGAGCTTTTCTTACTACTGCCCCAATTTCTAAATTGTGCATAAATACAAT
CACTCTCAATTTTTGAAGGGCTAATTATCTACTTTGTGGGTGTGTTTTGTTTTTTCTTTTCAGCGTGTAGGGCTTGGGCTCTGTTTCCTT
TTATTAGCATGTCACCTGAGGGTGGAACAAACAATTGGAAATAAAATTTGATTATTTTATTTCTTATAAAGTATTAATTTCTTAAGGGGG
TTTGAAATCATTGGTAAAATTAATATCAGTACATTATATGTCATAAATTTTGATTATCTATAATGTCTTTTCTTATCTACCACAAATAAT
TGAGAGTTGGCTAAATTCTTGCAGAATATATGGGAAAAAAATCATAGCAAAGAATTCAGCTTCCCTCAAAAGAAAGCTATTTTTGTTTCC
TTCACTCCACTAAATTTGAACCAGTAGCACGGATCAACACGACTTCTGCAATGAGAGTATAACGGTAGCTCTTGGTACAGTCATATTCAT
ATTTTTAAATCTTTCTTTGACCAAAACTATTGCATTGTTTTCATTACATTTTGACTGCGTTACTTATTAAGGCCGAATGACTTTGACACC
CCCGTGGATTATTTTTATGATCACATCAAATTTAAACAATGTCCAAAGTGTAACTTTAATGTTATATTTTGTTTCAAACCCTCTGGTCTA
AGATTATTGAGAAAGATGTTTTTTCCTCCTCCCTCAAATATGTTATCTCTTCATATATAAAAAAATAAGTTATTCCATGCTTTTCAGGAA
CTGTAAAAATTATTTCAAAAAGATATTTGAAAAAGTTTTCTCTATTCTGGACACAAATGCTTCCATTTATTTCAAAAGAAGAAGAAGAAA
AATGGAATCTTAATTTAAAAAAATATATGTAGTAGTATCTGCTATGAGATATTCAGTCTCTATAAAAAAAAAAAGGGACACAGCTTCTTT
TAAAACCCTTGTTTCAGTCCATATTCAACTTCATGGAACTTCTGAAACATCATTCAATTTTGAACTTTATTTAAGAGCATTTTTGTACTG
CTGTCTCTGACTGTCATGGAAAGTTCTGTAATTCTAAGGTGTTTCTGGTTTTATTTTTAATTTCTTCATCTGTACCACAGTCAAATTAGC
AACCATCTCCCCCATCCCTTGGGCTTTCTGTAGATCAGTGGATGTTAGGTTTAAACTTCTGTTTTCTTTGATGAAGCTTTCAATAAAAAA

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000383767_chr3_29628605_+_2534nt
GGCTGCCCGACCCGGGCCTGGGCTGTGGCTGTGACTGGCGCTGCCGTGGGCGCCGCAGCCCTCGCGGGAGCCGGACGCGGTAATGCCCCA
GCGGCGCAGCGGGCGGCTGCGTCCCTGAGCCGCTATATAAGCGCGGCAGGGAACATCCGGAGGGGCTGAAGATGAAGGTGCCCGCGCATG
GGCCCCCGCTGATTGCCAGTCCCTCCCGACCCCGCGCCCCGCGCGGAGCCCGAGGCCGCCGAGGACCCGCCTTCGCCGCAGTAGCAGCTG
GAGCAGCGACAGAGGCGGCAGCTGCGGCGGCGGCGGCGCCCGCGCCCCTCGCGCCAGCGCGTAGAGCGGCGGCGGCAGCTCGGGGGCCGC
CACTGCCCCGGCTGCCATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGC
GACAACCTGCCCCACAGCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCT
GGAAGTCACCCTTCCCAGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAA
CTCTCGCTGTGTCCTTTTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCAC
CCTCCATCCAGAATCTGCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAG
TTTCCCAACTTCCTTTTGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACC
CCCTGGCACCTTTTCTGCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGA
GTCCTGGCCTTATCCTTTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCA
CATGCACCACCGCCACCGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCC
TTCAGTGCATGCGGCCAGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGC
TGGAGCCTTTCATGGAACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGC
ACAGAAAGCGGTAGCATCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTC
AAATCTCCCCATTTCTATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGC
TAATGGAGTCAGCAGAGGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCT
GAAAACACCACCAGGCATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAA
ATATACCCAGAATGGGAGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATT
TTATTCTTCACCGTACAGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATA
CCAGGTCCAGAGTACTTCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATTACACCAACCATGGACCATCCCAT
GTCAATGCAGCCAGCCAACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACAACAGGAACGATTCAATCCCAAGA
CAGGATTATGATACTCCACCAGCTGTTGTGTCAGTATATGACTGCTGCTGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGT
GCCTCCGACAGCTGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCA
GCAACAGATAGCAGTGGACACATCCAACGAACATGCACCTGCATATTCTTACCAACAGTCTAAACCATAAACAGGACTGAAGAATGTCTG
TCTGAATCTTTGCCTTGAATGAAGAAACTTCATTGAACAAGAAGTTGGCTTCCAGTTTGCACAGACGTCAATGGAATGCATTTTTTTGTT
GTTGTTGTTGTTTTTTTTTTAGTGTTATACCTTACCCAATGAAAGCAAAGTTTTTATGTGCTGTGCAAATGGTCTTCATGTGGTCTGACA

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000445033_chr3_29628605_+_1815nt
GGCTGCCCGACCCGGGCCTGGGCTGTGGCTGTGACTGGCGCTGCCGTGGGCGCCGCAGCCCTCGCGGGAGCCGGACGCGGTAATGCCCCA
GCGGCGCAGCGGGCGGCTGCGTCCCTGAGCCGCTATATAAGCGCGGCAGGGAACATCCGGAGGGGCTGAAGATGAAGGTGCCCGCGCATG
GGCCCCCGCTGATTGCCAGTCCCTCCCGACCCCGCGCCCCGCGCGGAGCCCGAGGCCGCCGAGGACCCGCCTTCGCCGCAGTAGCAGCTG
GAGCAGCGACAGAGGCGGCAGCTGCGGCGGCGGCGGCGCCCGCGCCCCTCGCGCCAGCGCGTAGAGCGGCGGCGGCAGCTCGGGGGCCGC
CACTGCCCCGGCTGCCATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGC
GACAACCTGCCCCACAGCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCT
GGAAGTCACCCTTCCCAGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAA
CTCTCGCTGTGTCCTTTTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCAC
CCTCCATCCAGAATCTGCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAG
TTTCCCAACTTCCTTTTGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACC
CCCTGGCACCTTTTCTGCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGA
GTCCTGGCCTTATCCTTTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCA
CATGCACCACCGCCACCGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCC
TTCAGTGCATGCGGCCAGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGC
TGGAGCCTTTCATGGAACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGC
ACAGAAAGCGGTAGCATCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTC
AAATCTCCCCATTTCTATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGC
TAATGGAGTCAGCAGAGGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCT
GAAAACACCACCAGGCATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAA
ATATACCCAGAATGGGAGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGGTA

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000273139_chr3_29628605_+_2374nt
GGCTGCCCGACCCGGGCCTGGGCTGTGGCTGTGACTGGCGCTGCCGTGGGCGCCGCAGCCCTCGCGGGAGCCGGACGCGGTAATGCCCCA
GCGGCGCAGCGGGCGGCTGCGTCCCTGAGCCGCTATATAAGCGCGGCAGGGAACATCCGGAGGGGCTGAAGATGAAGGTGCCCGCGCATG
GGCCCCCGCTGATTGCCAGTCCCTCCCGACCCCGCGCCCCGCGCGGAGCCCGAGGCCGCCGAGGACCCGCCTTCGCCGCAGTAGCAGCTG
GAGCAGCGACAGAGGCGGCAGCTGCGGCGGCGGCGGCGCCCGCGCCCCTCGCGCCAGCGCGTAGAGCGGCGGCGGCAGCTCGGGGGCCGC
CACTGCCCCGGCTGCCATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGC
GACAACCTGCCCCACAGCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCT
GGAAGTCACCCTTCCCAGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAA
CTCTCGCTGTGTCCTTTTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCAC
CCTCCATCCAGAATCTGCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAG
TTTCCCAACTTCCTTTTGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACC
CCCTGGCACCTTTTCTGCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGA
GTCCTGGCCTTATCCTTTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCA
CATGCACCACCGCCACCGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCC
TTCAGTGCATGCGGCCAGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGC
TGGAGCCTTTCATGGAACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGC
ACAGAAAGCGGTAGCATCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTC
AAATCTCCCCATTTCTATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGC
TAATGGAGTCAGCAGAGGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCT
GAAAACACCACCAGGCATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAA
ATATACCCAGAATGGGAGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATT
TTATTCTTCACCGTACAGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATA
CCAGGTCCAGAGTACTTCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATTACACCAACCATGGACCATCCCAT
GTCAATGCAGCCAGCCAACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACAACAGGAACGTATATGACTGCTGC
TGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCC
CCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACACATCCAACGAACATGCACCTGCATATTC
TTACCAACAGTCTAAGTAAGTCTGGGCTGTGCTAAGCTCTTTTCCTCAAGATCAGCCATCTTGACATCACTCTCTCATGTTGTATGTGTT

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000383766_chr3_29628605_+_3536nt
GGCTGCCCGACCCGGGCCTGGGCTGTGGCTGTGACTGGCGCTGCCGTGGGCGCCGCAGCCCTCGCGGGAGCCGGACGCGGTAATGCCCCA
GCGGCGCAGCGGGCGGCTGCGTCCCTGAGCCGCTATATAAGCGCGGCAGGGAACATCCGGAGGGGCTGAAGATGAAGGTGCCCGCGCATG
GGCCCCCGCTGATTGCCAGTCCCTCCCGACCCCGCGCCCCGCGCGGAGCCCGAGGCCGCCGAGGACCCGCCTTCGCCGCAGTAGCAGCTG
GAGCAGCGACAGAGGCGGCAGCTGCGGCGGCGGCGGCGCCCGCGCCCCTCGCGCCAGCGCGTAGAGCGGCGGCGGCAGCTCGGGGGCCGC
CACTGCCCCGGCTGCCATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGC
GACAACCTGCCCCACAGCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCT
GGAAGTCACCCTTCCCAGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAA
CTCTCGCTGTGTCCTTTTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCAC
CCTCCATCCAGAATCTGCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAG
TTTCCCAACTTCCTTTTGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACC
CCCTGGCACCTTTTCTGCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGA
GTCCTGGCCTTATCCTTTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCA
CATGCACCACCGCCACCGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCC
TTCAGTGCATGCGGCCAGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGC
TGGAGCCTTTCATGGAACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGC
ACAGAAAGCGGTAGCATCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTC
AAATCTCCCCATTTCTATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGC
TAATGGAGTCAGCAGAGGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCT
GAAAACACCACCAGGCATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAA
ATATACCCAGAATGGGAGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATT
TTATTCTTCACCGTACAGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATA
CCAGGGTGCTGTGATTACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCCAACATGATGGGCCCACTGACACAGCAGATGAATCA
CCTTTCGTTGGGCACAACAGGAACGATTCAATCCCAAGACAGGATTATGATACTCCACCAGCTGTTGTGTCAGTATATGACTGCTGCTGC
TCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCA
GACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACACATCCAACGAACATGCACCTGCATATTCTTA
CCAACAGTCTAAACCATAAACAGGACTGAAGAATGTCTGTCTGAATCTTTGCCTTGAATGAAGAAACTTCATTGAACAAGAAGTTGGCTT
CCAGTTTGCACAGACGTCAATGGAATGCATTTTTTTGTTGTTGTTGTTGTTTTTTTTTTAGTGTTATACCTTACCCAATGAAAGCAAAGT
TTTTATGTGCTGTGCAAATGGTCTTCATGTGGTCTGACAATTTATTTTTGCCATCATTTTTTTAATTAAAGAAAAAATTTCCAGAAGAGG
AAAAAAAAACTACAAAAAACAAAACATTGAAGGTTGATATTTTATGTGGAAGAACATTTGAATTGAATTCAGAATTTTTCTGAAGGTGTA
GATACTTTTTTTTTTTTTTTAACAGAAAACCTGATGTCAAGAGGTGGGCAATAGAAATGGAAACAAATTGTCTTCCTCAATAATTAAGCT
ACTTTCTCTTTTTCCCTTCTTGTTTTAATCTAGTGGGTTTTTTATTTTATTTTTTCTTAGAAATATGTAGGTAAGGTTTATCTTGAATCT
TAATTGCCTTAATTTTAAGGACGTCAAAGGCTCTCGAGGCAAGCTGTCAACGTCTTGTTGAAAACAAAAATCAAGAAAGAATTGAAATAC
TGTGCCGGCTTTCACTGGCACAGAAGTTTAAGACTATGAGTTTTTAGGGTGAAGAAAAAACTGTACAGTTTAAATGAAAATGTTTTTCTT
CATTTGAAGAAAATTTGTTGATAAACCATGGCAACTGCAAGAATTGGAAAAATGCTGGGACTTTTCATGAACTTTGTCTTAAGTGTTGAC
ATGAATCATTCTAAAAGGCTAAAACATTTTACAGTAAAGTTATTAAGGTTGGTTTAAAAACAACTGCATTAGAAATAATGCGTGTTTGGG
GGGCAGAATGCAGATTTTTTTAATTTACAAAGCGTGATCGCTAGCAAAAGCATTAGTGCTTTTTATCTGCAGTCTTTTTTATGAGCTTTA
CAAAGTTTTTAGTCAGCTTTGCTTGTCACATTGCAAAACCTAGCTTAAGAGCATTAAAAAAAAAAACTTAAGTAGATAGGAGCTTATGGT
CAAAAAGTGCAAAAAAAAAAACAAAAAAAAAGCAATAGATAGAGAAATTGTTGACAATTTCTGTAGTCTTTCCTAGTTGTGATCAAATTC
AGCCTATGGATGGCCTATTTTATACCAAAGATGAAGTGACACCCTATTACAGTCCAGAAGATAGAGGTTGTTTTCGTTTCTTTTCTTTTT

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000452462_chr3_29628605_+_2423nt
GGCTGCCCGACCCGGGCCTGGGCTGTGGCTGTGACTGGCGCTGCCGTGGGCGCCGCAGCCCTCGCGGGAGCCGGACGCGGTAATGCCCCA
GCGGCGCAGCGGGCGGCTGCGTCCCTGAGCCGCTATATAAGCGCGGCAGGGAACATCCGGAGGGGCTGAAGATGAAGGTGCCCGCGCATG
GGCCCCCGCTGATTGCCAGTCCCTCCCGACCCCGCGCCCCGCGCGGAGCCCGAGGCCGCCGAGGACCCGCCTTCGCCGCAGTAGCAGCTG
GAGCAGCGACAGAGGCGGCAGCTGCGGCGGCGGCGGCGCCCGCGCCCCTCGCGCCAGCGCGTAGAGCGGCGGCGGCAGCTCGGGGGCCGC
CACTGCCCCGGCTGCCATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGC
GACAACCTGCCCCACAGCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCT
GGAAGTCACCCTTCCCAGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAA
CTCTCGCTGTGTCCTTTTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCAC
CCTCCATCCAGAATCTGCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAG
TTTCCCAACTTCCTTTTGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACC
CCCTGGCACCTTTTCTGCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGA
GTCCTGGCCTTATCCTTTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCA
CATGCACCACCGCCACCGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCC
TTCAGTGCATGCGGCCAGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGC
TGGAGCCTTTCATGGAACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGC
ACAGAAAGCGGTAGCATCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTC
AAATCTCCCCATTTCTATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGC
TAATGGAGTCAGCAGAGGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCT
GAAAACACCACCAGGCATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAA
ATATACCCAGAATGGGAGGCCTTGGCCCAGGGAAGGAGAGGCTGGCATGGCTTTGACCTATGACCCCACAGCTGCCATACAGAATGGATT
TTATTCTTCACCGTACAGTATTGCAACCAACCGCATGATTCCACAGACATCTATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATA
CCAGGTCCAGAGTACTTCATGGATGCCTCATCCGCCATACGTTATGCAACCAACAGGTGCTGTGATTACACCAACCATGGACCATCCCAT
GTCAATGCAGCCAGCCAACATGATGGGCCCACTGACACAGCAGATGAATCACCTTTCGTTGGGCACAACAGGAACGTATATGACTGCTGC
TGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGACAGCTGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCC
CCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGATAGCAGTGGACACATCCAACGAACATGCACCTGCATATTC
TTACCAACAGTCTAAACCATAAACAGGACTGAAGAATGTCTGTCTGAATCTTTGCCTTGAATGAAGAAACTTCATTGAACAAGAAGTTGG

>In-frame_VGLL3_ENST00000383698_chr3_87017740_-_RBMS3_ENST00000456853_chr3_29628605_+_2334nt
GGCTGCCCGACCCGGGCCTGGGCTGTGGCTGTGACTGGCGCTGCCGTGGGCGCCGCAGCCCTCGCGGGAGCCGGACGCGGTAATGCCCCA
GCGGCGCAGCGGGCGGCTGCGTCCCTGAGCCGCTATATAAGCGCGGCAGGGAACATCCGGAGGGGCTGAAGATGAAGGTGCCCGCGCATG
GGCCCCCGCTGATTGCCAGTCCCTCCCGACCCCGCGCCCCGCGCGGAGCCCGAGGCCGCCGAGGACCCGCCTTCGCCGCAGTAGCAGCTG
GAGCAGCGACAGAGGCGGCAGCTGCGGCGGCGGCGGCGCCCGCGCCCCTCGCGCCAGCGCGTAGAGCGGCGGCGGCAGCTCGGGGGCCGC
CACTGCCCCGGCTGCCATGAGTTGTGCGGAGGTGATGTATCACCCCCAGCCTTATGGAGCGTCCCAGTATCTGCCCAACCCCATGGCAGC
GACAACCTGCCCCACAGCCTACTATCAGCCGGCGCCCCAACCTGGCCAGCAGAAGAAGTTAGCGGTATTCAGCAAGATGCAGGACTCTCT
GGAAGTCACCCTTCCCAGCAAACAAGAGGAGGAGGATGAGGAGGAGGAGGAGGAGGAGAAAGACCAGCCTGCCGAGATGGAGTACCTTAA
CTCTCGCTGTGTCCTTTTCACTTATTTCCAGGGAGACATTGGGTCAGTAGTGGATGAACACTTCTCAAGAGCTTTGGGCCAAGCCATCAC
CCTCCATCCAGAATCTGCCATTTCAAAAAGCAAGATGGGGCTAACCCCCCTATGGCGAGACAGCTCAGCTCTCTCAAGCCAGCGGAATAG
TTTCCCAACTTCCTTTTGGACCAGCTCTTACCAGCCCCCACCTGCACCTTGTTTGGGGGGAGTTCATCCTGACTTCCAGGTCACTGGACC
CCCTGGCACCTTTTCTGCAGCTGATCCCAGTCCTTGGCCGGGACACAACCTGCATCAGACTGGCCCAGCCCCTCCCCCTGCTGTGTCTGA
GTCCTGGCCTTATCCTTTGACATCTCAGGTGAGCCCATCCTACAGCCATATGCATGACGTGTACATGCGGCACCACCACCCTCATGCCCA
CATGCACCACCGCCACCGCCACCATCATCACCATCACCACCCTCCTGCTGGCTCTGCCCTGGATCCATCCTATGGGCCTCTGCTGATGCC
TTCAGTGCATGCGGCCAGGATTCCTGCTCCCCAGTGTGACATCACAAAGACAGAACCAACTACAGTCACCTCTGCTACCTCAGCATGGGC
TGGAGCCTTTCATGGAACAGTAGACATAGTGCCCAGCGTGGGATTCGATACAGGTTATGGTTTTGTAGATTTTGACAGTCCTGCAGCCGC
ACAGAAAGCGGTAGCATCTCTCAAGGCAAATGGCGTGCAGGCACAGATGGCTAAGCAACAAGAGCAAGACCCAACAAACCTATACATCTC
AAATCTCCCCATTTCTATGGATGAGCAGGAGCTTGAGAATATGCTGAAACCCTTTGGACATGTCATTTCCACAAGAATACTAAGAGACGC
TAATGGAGTCAGCAGAGGTGTTGGCTTTGCCAGAATGGAGTCTACTGAAAAATGTGAAGTGGTAATTCAACATTTTAATGGAAAATATCT
GAAAACACCACCAGGCATCCCAGCCCCCAGTGAGCCTTTGCTGTGCAAATTCGCTGATGGAGGACAAAAGAAGCGACAGAATCAAAGCAA
ATATACCCAGAATGGGAGGCCTTGGCCCAGGGAAGGAGAGGTACTCAGAGGCAGGACTGTCCCTAGGCAAAATCGTGAAGCTGGCATGGC
TTTGACCTATGACCCCACAGCTGCCATACAGAATGGATTTTATTCTTCACCGTACAGTATTGCAACCAACCGCATGATTCCACAGACATC
TATCACGCCATTCATTGCTGCTTCCCCTGTCTCCACATACCAGGTCCAGAGTACTTCATGGATGCCTCATCCGCCATACGTTATGCAACC
AACAGGTGCTGTGATTACACCAACCATGGACCATCCCATGTCAATGCAGCCAGCCAACATGATGGGCCCACTGACACAGCAGATGAATCA
CCTTTCGTTGGGCACAACAGGAACGTATATGACTGCTGCTGCTCCTATGCAAGGGACCTACATTCCTCAGTACACGCCTGTGCCTCCGAC
AGCTGTTTCTATTGAAGGTGTTGTTGCTGATACCTCTCCCCAGACAGTGGCACCTTCATCCCAGGACACCAGTGGTCAGCAGCAACAGAT


Top

FusionGenePPI for VGLL3_RBMS3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
VGLL3KDM5BRBMS3MRPL9, SART3, MRPL40, MRPL55, MRPL19, ICT1, NGRN, MRPL30, MRPS18A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for VGLL3_RBMS3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for VGLL3_RBMS3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource