FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41404

FusionGeneSummary for VCL_ZSWIM8

check button Fusion gene summary
Fusion gene informationFusion gene name: VCL_ZSWIM8
Fusion gene ID: 41404
HgeneTgene
Gene symbol

VCL

ZSWIM8

Gene ID

7414

23053

Gene namevinculinzinc finger SWIM-type containing 8
SynonymsCMD1W|CMH15|HEL114|MV|MVCLKIAA0913
Cytomap

10q22.2

10q22.2

Type of geneprotein-codingprotein-coding
Descriptionvinculinepididymis luminal protein 114meta-vinculinmetavinculinzinc finger SWIM domain-containing protein 84832404P21Rik
Modification date2018052220180523
UniProtAcc

P18206

A7E2V4

Ensembl transtripts involved in fusion geneENST00000211998, ENST00000372755, 
ENST00000478896, ENST00000417648, 
ENST00000604729, ENST00000603114, 
ENST00000604524, ENST00000605216, 
ENST00000398706, ENST00000431225, 
Fusion gene scores* DoF score10 X 7 X 10=7001 X 1 X 1=1
# samples 121
** MAII scorelog2(12/700*10)=-2.54432051622381
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: VCL [Title/Abstract] AND ZSWIM8 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-61-1743-01AVCLchr10

75758133

+ZSWIM8chr10

75553346

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000211998ENST00000604729VCLchr10

75758133

+ZSWIM8chr10

75553346

+
In-frameENST00000211998ENST00000603114VCLchr10

75758133

+ZSWIM8chr10

75553346

+
In-frameENST00000211998ENST00000604524VCLchr10

75758133

+ZSWIM8chr10

75553346

+
In-frameENST00000211998ENST00000605216VCLchr10

75758133

+ZSWIM8chr10

75553346

+
In-frameENST00000211998ENST00000398706VCLchr10

75758133

+ZSWIM8chr10

75553346

+
5CDS-3UTRENST00000211998ENST00000431225VCLchr10

75758133

+ZSWIM8chr10

75553346

+
In-frameENST00000372755ENST00000604729VCLchr10

75758133

+ZSWIM8chr10

75553346

+
In-frameENST00000372755ENST00000603114VCLchr10

75758133

+ZSWIM8chr10

75553346

+
In-frameENST00000372755ENST00000604524VCLchr10

75758133

+ZSWIM8chr10

75553346

+
In-frameENST00000372755ENST00000605216VCLchr10

75758133

+ZSWIM8chr10

75553346

+
In-frameENST00000372755ENST00000398706VCLchr10

75758133

+ZSWIM8chr10

75553346

+
5CDS-3UTRENST00000372755ENST00000431225VCLchr10

75758133

+ZSWIM8chr10

75553346

+
3UTR-3CDSENST00000478896ENST00000604729VCLchr10

75758133

+ZSWIM8chr10

75553346

+
3UTR-3CDSENST00000478896ENST00000603114VCLchr10

75758133

+ZSWIM8chr10

75553346

+
3UTR-3CDSENST00000478896ENST00000604524VCLchr10

75758133

+ZSWIM8chr10

75553346

+
3UTR-3CDSENST00000478896ENST00000605216VCLchr10

75758133

+ZSWIM8chr10

75553346

+
3UTR-3CDSENST00000478896ENST00000398706VCLchr10

75758133

+ZSWIM8chr10

75553346

+
3UTR-3UTRENST00000478896ENST00000431225VCLchr10

75758133

+ZSWIM8chr10

75553346

+
In-frameENST00000417648ENST00000604729VCLchr10

75758133

+ZSWIM8chr10

75553346

+
In-frameENST00000417648ENST00000603114VCLchr10

75758133

+ZSWIM8chr10

75553346

+
In-frameENST00000417648ENST00000604524VCLchr10

75758133

+ZSWIM8chr10

75553346

+
In-frameENST00000417648ENST00000605216VCLchr10

75758133

+ZSWIM8chr10

75553346

+
In-frameENST00000417648ENST00000398706VCLchr10

75758133

+ZSWIM8chr10

75553346

+
5CDS-3UTRENST00000417648ENST00000431225VCLchr10

75758133

+ZSWIM8chr10

75553346

+

Top

FusionProtFeatures for VCL_ZSWIM8


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
VCL

P18206

ZSWIM8

A7E2V4

Actin filament (F-actin)-binding protein involved incell-matrix adhesion and cell-cell adhesion. Regulates cell-surface E-cadherin expression and potentiates mechanosensing bythe E-cadherin complex. May also play important roles in cellmorphology and locomotion. {ECO:0000269|PubMed:20484056}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneZSWIM8chr10:75758133chr10:75553346ENST00000398706+9261143_12047711843Compositional biasNote=Ser-rich
TgeneZSWIM8chr10:75758133chr10:75553346ENST00000398706+9261471_14747711843Compositional biasNote=Poly-Ala
TgeneZSWIM8chr10:75758133chr10:75553346ENST00000398706+9261493_16587711843Compositional biasNote=Pro-rich
TgeneZSWIM8chr10:75758133chr10:75553346ENST00000605216+9261143_12047711838Compositional biasNote=Ser-rich
TgeneZSWIM8chr10:75758133chr10:75553346ENST00000605216+9261471_14747711838Compositional biasNote=Poly-Ala
TgeneZSWIM8chr10:75758133chr10:75553346ENST00000605216+9261493_16587711838Compositional biasNote=Pro-rich

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneVCLchr10:75758133chr10:75553346ENST00000211998+122837_878561135Compositional biasPro-rich
HgeneVCLchr10:75758133chr10:75553346ENST00000372755+121837_878561067Compositional biasPro-rich
HgeneVCLchr10:75758133chr10:75553346ENST00000211998+1221003_1046561135RegionFacilitates phospholipid membrane insertion
HgeneVCLchr10:75758133chr10:75553346ENST00000211998+1221120_1134561135RegionFacilitates phospholipid membrane insertion
HgeneVCLchr10:75758133chr10:75553346ENST00000211998+1221_835561135RegionN-terminal globular head
HgeneVCLchr10:75758133chr10:75553346ENST00000211998+122259_589561135Region3 X 112 AA tandem repeats
HgeneVCLchr10:75758133chr10:75553346ENST00000211998+122836_878561135RegionLinker (Pro-rich)
HgeneVCLchr10:75758133chr10:75553346ENST00000211998+122879_1134561135RegionC-terminal tail
HgeneVCLchr10:75758133chr10:75553346ENST00000372755+1211003_1046561067RegionFacilitates phospholipid membrane insertion
HgeneVCLchr10:75758133chr10:75553346ENST00000372755+1211120_1134561067RegionFacilitates phospholipid membrane insertion
HgeneVCLchr10:75758133chr10:75553346ENST00000372755+1211_835561067RegionN-terminal globular head
HgeneVCLchr10:75758133chr10:75553346ENST00000372755+121259_589561067Region3 X 112 AA tandem repeats
HgeneVCLchr10:75758133chr10:75553346ENST00000372755+121836_878561067RegionLinker (Pro-rich)
HgeneVCLchr10:75758133chr10:75553346ENST00000372755+121879_1134561067RegionC-terminal tail
HgeneVCLchr10:75758133chr10:75553346ENST00000211998+122259_369561135Repeat1
HgeneVCLchr10:75758133chr10:75553346ENST00000211998+122370_479561135Repeat2
HgeneVCLchr10:75758133chr10:75553346ENST00000211998+122480_589561135Repeat3
HgeneVCLchr10:75758133chr10:75553346ENST00000372755+121259_369561067Repeat1
HgeneVCLchr10:75758133chr10:75553346ENST00000372755+121370_479561067Repeat2
HgeneVCLchr10:75758133chr10:75553346ENST00000372755+121480_589561067Repeat3
TgeneZSWIM8chr10:75758133chr10:75553346ENST00000398706+926546_6027711843Compositional biasNote=Gly-rich
TgeneZSWIM8chr10:75758133chr10:75553346ENST00000398706+92656_657711843Compositional biasNote=Poly-Gly
TgeneZSWIM8chr10:75758133chr10:75553346ENST00000605216+926546_6027711838Compositional biasNote=Gly-rich
TgeneZSWIM8chr10:75758133chr10:75553346ENST00000605216+92656_657711838Compositional biasNote=Poly-Gly
TgeneZSWIM8chr10:75758133chr10:75553346ENST00000398706+926172_2087711843Zinc fingerSWIM-type
TgeneZSWIM8chr10:75758133chr10:75553346ENST00000605216+926172_2087711838Zinc fingerSWIM-type


Top

FusionGeneSequence for VCL_ZSWIM8


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_VCL_ENST00000211998_chr10_75758133_+_ZSWIM8_ENST00000604729_chr10_75553346_+_1120aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVLFACAEALHAHGYSSEASRLTVELAQDLLANPP
DLKVEPPPAKGKKNKVSTSRQTWVATNTLSKAAFLLTVLSERPEHHNLAFRVGMFALELQRPPASTKALEVKLAYQESEVAALLKKIPLG
PSEMSTMRCRAEELREGTLCDYRPVLPLMLASFIFDVLCAPVVSPTGSRPPSRNWNSETPGDEELGFEAAVAALGMKTTVSEAEHPLLCE
GTRREKGDLALALMITYKDDQAKLKKILDKLLDRESQTHKPQTLSSFYSSSRPTTASQRSPSKHGGPSAPGALQPLTSGSAGPAQPGSVA
GAGPGPTEGFTEKNVPESSPHSPCEGLPSEAALTPRPEGKVPSRLALGSRGGYNGRGWGSPGRPKKKHTGMASIDSSAPETTSDSSPTLS
RRPLRGGWAPTSWGRGQDSDSISSSSSDSLGSSSSSGSRRASASGGARAKTVEVGRYKGRRPESHAPHVPNQPSEAAAHFYFELAKTVLI
KAGGNSSTSIFTHPSSSGGHQGPHRNLHLCAFEIGLYALGLHNFVSPNWLSRTYSSHVSWITGQAMEIGSAALTILVECWDGHLTPPEVA
SLADRASRARDSNMVRAAAELALSCLPHAHALNPNEIQRALVQCKEQDNLMLEKACMAVEEAAKGGGVYPEVLFEVAHQWFWLYEQTAGG
SSTAREGATSCSASGIRAGGEAGRGMPEGRGGPGTEPVTVAAAAVTAAATVVPVISVGSSLYPGPGLGHGHSPGLHPYTALQPHLPCSPQ
YLTHPAHPAHPMPHMPRPAVFPVPSSAYPQGVHPAFLGAQYPYSVTPPSLAATAVSFPVPSMAPITVHPYHTEPGLPLPTSVALSSVHPA
STFPAIQGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGRRAHNDHPNNFSRSPPYTDDVKWLLGLAA
KLGVNYVHQFCVGAAKGVLSPFVLQEIVMETLQRLSPAHAHNHLRAPAFHQLVQRCQQAYMQYIHHRLIHLTPADYDDFVNAIRSARSAF

>In-frame_VCL_ENST00000211998_chr10_75758133_+_ZSWIM8_ENST00000603114_chr10_75553346_+_1115aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVLFACAEALHAHGYSSEASRLTVELAQDLLANPP
DLKVEPPPAKGKKNKVSTSRQTWVATNTLSKAAFLLTVLSERPEHHNLAFRVGMFALELQRPPASTKALEVKLAYQESEVAALLKKIPLG
PSEMSTMRCRAEELREGTLCDYRPVLPLMLASFIFDVLCAPGSRPPSRNWNSETPGDEELGFEAAVAALGMKTTVSEAEHPLLCEGTRRE
KGDLALALMITYKDDQAKLKKILDKLLDRESQTHKPQTLSSFYSSSRPTTASQRSPSKHGGPSAPGALQPLTSGSAGPAQPGSVAGAGPG
PTEGFTEKNVPESSPHSPCEGLPSEAALTPRPEGKVPSRLALGSRGGYNGRGWGSPGRPKKKHTGMASIDSSAPETTSDSSPTLSRRPLR
GGWAPTSWGRGQDSDSISSSSSDSLGSSSSSGSRRASASGGARAKTVEVGRYKGRRPESHAPHVPNQPSEAAAHFYFELAKTVLIKAGGN
SSTSIFTHPSSSGGHQGPHRNLHLCAFEIGLYALGLHNFVSPNWLSRTYSSHVSWITGQAMEIGSAALTILVECWDGHLTPPEVASLADR
ASRARDSNMVRAAAELALSCLPHAHALNPNEIQRALVQCKEQDNLMLEKACMAVEEAAKGGGVYPEVLFEVAHQWFWLYEQTAGGSSTAR
EGATSCSASGIRAGGEAGRGMPEGRGGPGTEPVTVAAAAVTAAATVVPVISVGSSLYPGPGLGHGHSPGLHPYTALQPHLPCSPQYLTHP
AHPAHPMPHMPRPAVFPVPSSAYPQGVHPAFLGAQYPYSVTPPSLAATAVSFPVPSMAPITVHPYHTEPGLPLPTSVALSSVHPASTFPA
IQGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGRRAHNDHPNNFSRSPPYTDDVKWLLGLAAKLGVN
YVHQFCVGAAKGVLSPFVLQEIVMETLQRLSPAHAHNHLRAPAFHQLVQRCQQAYMQYIHHRLIHLTPADYDDFVNAIRSARSAFCLTPM

>In-frame_VCL_ENST00000211998_chr10_75758133_+_ZSWIM8_ENST00000604524_chr10_75553346_+_941aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVLFACAEALHAHGYSSEASRLTVELAQDLLANPP
DLKVEPPPAKGKKNKVSTSRQTWVATNTLSKAAFLLTVLSERPEHHNLAFRVGMFALELQRPPASTKALEVKLAYQESEVAALLKKIPLG
PSEMSTMRCRAEELREGTLCDYRPVLPLMLASFIFDVLCAPGSRPPSRNWNSETPGDEELGFEAAVAALGMKTTVSEAEHPLLCEGTRRE
KGDLALALMITYKDDQAKLKKILDKLLDRESQTHKPQTLSSFYSSSRPTTASQRSPSKHGGPSAPGALQPLTSGSAGPAQPGSVAGAGPG
PTEGFTEKNVPESSPHSPCEGLPSEAALTPRPEGKVPSRLALGSRGGYNGRGWGSPGRPKKKHTGMASIDSSAPETTSDSSPTLSRRPLR
GGWAPTSWGRGQDSDSISSSSSDSLGSSSSSGSRRASASGGARAKTVEVGRYKGRRPESHAPHVPNQPSEAAAHFYFELAKTVLIKAGGN
SSTSIFTHPSSSGGHQGPHRNLHLCAFEIGLYALGLHNFVSPNWLSRTYSSHVSWITGQAMEIGSAALTILVECWDGHLTPPEVASLADR
ASRARDSNMVRAAAELALSCLPHAHALNPNEIQRALVQCKEQDNLMLEKACMAVEEAAKVHPYHTEPGLPLPTSVACELWGQGTVSSVHP
ASTFPAIQGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGRRAHNDHPNNFSRSPPYTDDVKWLLGLA
AKLGVNYVHQFCVGAAKGVLSPFVLQEIVMETLQRLSPAHAHNHLRAPAFHQLVQRCQQAYMQYIHHRLIHLTPADYDDFVNAIRSARSA

>In-frame_VCL_ENST00000211998_chr10_75758133_+_ZSWIM8_ENST00000605216_chr10_75553346_+_1123aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVLFACAEALHAHGYSSEASRLTVELAQDLLANPP
DLKVEPPPAKGKKNKVSTSRQTWVATNTLSKAAFLLTVLSERPEHHNLAFRVGMFALELQRPPASTKALEVKLAYQESEVAALLKKIPLG
PSEMSTMRCRAEELREGTLCDYRPVLPLMLASFIFDVLCAPGSRPPSRNWNSETPGDEELGFEAAVAALGMKTTVSEAEHPLLCEGTRRE
KGDLALALMITYKDDQAKLKKILDKLLDRESQTHKPQTLSSFYSSSRPTTASQRSPSKHGGPSAPGALQPLTSGSAGPAQPGSVAGAGPG
PTEGFTEKNVPESSPHSPCEGLPSEAALTPRPEGKVPSRLALGSRGGYNGRGWGSPGRPKKKHTGMASIDSSAPETTSDSSPTLSRRPLR
GGWAPTSWGRGQDSDSISSSSSDSLGSSSSSGSRRASASGGARAKTVEVGRYKGRRPESHAPHVPNQPSEAAAHFYFELAKTVLIKAGGN
SSTSIFTHPSSSGGHQGPHRNLHLCAFEIGLYALGLHNFVSPNWLSRTYSSHVSWITGQAMEIGSAALTILVECWDGHLTPPEVASLADR
ASRARDSNMVRAAAELALSCLPHAHALNPNEIQRALVQCKEQDNLMLEKACMAVEEAAKGGGVYPEVLFEVAHQWFWLYEQTAGGSSTAR
EGATSCSASGIRAGGEAGRGMPEGRGGPGTEPVTVAAAAVTAAATVVPVISVGSSLYPGPGLGHGHSPGLHPYTALQPHLPCSPQYLTHP
AHPAHPMPHMPRPAVFPVPSSAYPQGVHPAFLGAQYPYSVTPPSLAATAVSFPVPSMAPITVHPYHTEPGLPLPTSVACELWGQGTVSSV
HPASTFPAIQGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGRRAHNDHPNNFSRSPPYTDDVKWLLG
LAAKLGVNYVHQFCVGAAKGVLSPFVLQEIVMETLQRLSPAHAHNHLRAPAFHQLVQRCQQAYMQYIHHRLIHLTPADYDDFVNAIRSAR

>In-frame_VCL_ENST00000211998_chr10_75758133_+_ZSWIM8_ENST00000398706_chr10_75553346_+_1128aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVLFACAEALHAHGYSSEASRLTVELAQDLLANPP
DLKVEPPPAKGKKNKVSTSRQTWVATNTLSKAAFLLTVLSERPEHHNLAFRVGMFALELQRPPASTKALEVKLAYQESEVAALLKKIPLG
PSEMSTMRCRAEELREGTLCDYRPVLPLMLASFIFDVLCAPVVSPTGSRPPSRNWNSETPGDEELGFEAAVAALGMKTTVSEAEHPLLCE
GTRREKGDLALALMITYKDDQAKLKKILDKLLDRESQTHKPQTLSSFYSSSRPTTASQRSPSKHGGPSAPGALQPLTSGSAGPAQPGSVA
GAGPGPTEGFTEKNVPESSPHSPCEGLPSEAALTPRPEGKVPSRLALGSRGGYNGRGWGSPGRPKKKHTGMASIDSSAPETTSDSSPTLS
RRPLRGGWAPTSWGRGQDSDSISSSSSDSLGSSSSSGSRRASASGGARAKTVEVGRYKGRRPESHAPHVPNQPSEAAAHFYFELAKTVLI
KAGGNSSTSIFTHPSSSGGHQGPHRNLHLCAFEIGLYALGLHNFVSPNWLSRTYSSHVSWITGQAMEIGSAALTILVECWDGHLTPPEVA
SLADRASRARDSNMVRAAAELALSCLPHAHALNPNEIQRALVQCKEQDNLMLEKACMAVEEAAKGGGVYPEVLFEVAHQWFWLYEQTAGG
SSTAREGATSCSASGIRAGGEAGRGMPEGRGGPGTEPVTVAAAAVTAAATVVPVISVGSSLYPGPGLGHGHSPGLHPYTALQPHLPCSPQ
YLTHPAHPAHPMPHMPRPAVFPVPSSAYPQGVHPAFLGAQYPYSVTPPSLAATAVSFPVPSMAPITVHPYHTEPGLPLPTSVACELWGQG
TVSSVHPASTFPAIQGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGRRAHNDHPNNFSRSPPYTDDV
KWLLGLAAKLGVNYVHQFCVGAAKGVLSPFVLQEIVMETLQRLSPAHAHNHLRAPAFHQLVQRCQQAYMQYIHHRLIHLTPADYDDFVNA

>In-frame_VCL_ENST00000372755_chr10_75758133_+_ZSWIM8_ENST00000604729_chr10_75553346_+_1120aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVLFACAEALHAHGYSSEASRLTVELAQDLLANPP
DLKVEPPPAKGKKNKVSTSRQTWVATNTLSKAAFLLTVLSERPEHHNLAFRVGMFALELQRPPASTKALEVKLAYQESEVAALLKKIPLG
PSEMSTMRCRAEELREGTLCDYRPVLPLMLASFIFDVLCAPVVSPTGSRPPSRNWNSETPGDEELGFEAAVAALGMKTTVSEAEHPLLCE
GTRREKGDLALALMITYKDDQAKLKKILDKLLDRESQTHKPQTLSSFYSSSRPTTASQRSPSKHGGPSAPGALQPLTSGSAGPAQPGSVA
GAGPGPTEGFTEKNVPESSPHSPCEGLPSEAALTPRPEGKVPSRLALGSRGGYNGRGWGSPGRPKKKHTGMASIDSSAPETTSDSSPTLS
RRPLRGGWAPTSWGRGQDSDSISSSSSDSLGSSSSSGSRRASASGGARAKTVEVGRYKGRRPESHAPHVPNQPSEAAAHFYFELAKTVLI
KAGGNSSTSIFTHPSSSGGHQGPHRNLHLCAFEIGLYALGLHNFVSPNWLSRTYSSHVSWITGQAMEIGSAALTILVECWDGHLTPPEVA
SLADRASRARDSNMVRAAAELALSCLPHAHALNPNEIQRALVQCKEQDNLMLEKACMAVEEAAKGGGVYPEVLFEVAHQWFWLYEQTAGG
SSTAREGATSCSASGIRAGGEAGRGMPEGRGGPGTEPVTVAAAAVTAAATVVPVISVGSSLYPGPGLGHGHSPGLHPYTALQPHLPCSPQ
YLTHPAHPAHPMPHMPRPAVFPVPSSAYPQGVHPAFLGAQYPYSVTPPSLAATAVSFPVPSMAPITVHPYHTEPGLPLPTSVALSSVHPA
STFPAIQGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGRRAHNDHPNNFSRSPPYTDDVKWLLGLAA
KLGVNYVHQFCVGAAKGVLSPFVLQEIVMETLQRLSPAHAHNHLRAPAFHQLVQRCQQAYMQYIHHRLIHLTPADYDDFVNAIRSARSAF

>In-frame_VCL_ENST00000372755_chr10_75758133_+_ZSWIM8_ENST00000603114_chr10_75553346_+_1115aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVLFACAEALHAHGYSSEASRLTVELAQDLLANPP
DLKVEPPPAKGKKNKVSTSRQTWVATNTLSKAAFLLTVLSERPEHHNLAFRVGMFALELQRPPASTKALEVKLAYQESEVAALLKKIPLG
PSEMSTMRCRAEELREGTLCDYRPVLPLMLASFIFDVLCAPGSRPPSRNWNSETPGDEELGFEAAVAALGMKTTVSEAEHPLLCEGTRRE
KGDLALALMITYKDDQAKLKKILDKLLDRESQTHKPQTLSSFYSSSRPTTASQRSPSKHGGPSAPGALQPLTSGSAGPAQPGSVAGAGPG
PTEGFTEKNVPESSPHSPCEGLPSEAALTPRPEGKVPSRLALGSRGGYNGRGWGSPGRPKKKHTGMASIDSSAPETTSDSSPTLSRRPLR
GGWAPTSWGRGQDSDSISSSSSDSLGSSSSSGSRRASASGGARAKTVEVGRYKGRRPESHAPHVPNQPSEAAAHFYFELAKTVLIKAGGN
SSTSIFTHPSSSGGHQGPHRNLHLCAFEIGLYALGLHNFVSPNWLSRTYSSHVSWITGQAMEIGSAALTILVECWDGHLTPPEVASLADR
ASRARDSNMVRAAAELALSCLPHAHALNPNEIQRALVQCKEQDNLMLEKACMAVEEAAKGGGVYPEVLFEVAHQWFWLYEQTAGGSSTAR
EGATSCSASGIRAGGEAGRGMPEGRGGPGTEPVTVAAAAVTAAATVVPVISVGSSLYPGPGLGHGHSPGLHPYTALQPHLPCSPQYLTHP
AHPAHPMPHMPRPAVFPVPSSAYPQGVHPAFLGAQYPYSVTPPSLAATAVSFPVPSMAPITVHPYHTEPGLPLPTSVALSSVHPASTFPA
IQGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGRRAHNDHPNNFSRSPPYTDDVKWLLGLAAKLGVN
YVHQFCVGAAKGVLSPFVLQEIVMETLQRLSPAHAHNHLRAPAFHQLVQRCQQAYMQYIHHRLIHLTPADYDDFVNAIRSARSAFCLTPM

>In-frame_VCL_ENST00000372755_chr10_75758133_+_ZSWIM8_ENST00000604524_chr10_75553346_+_941aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVLFACAEALHAHGYSSEASRLTVELAQDLLANPP
DLKVEPPPAKGKKNKVSTSRQTWVATNTLSKAAFLLTVLSERPEHHNLAFRVGMFALELQRPPASTKALEVKLAYQESEVAALLKKIPLG
PSEMSTMRCRAEELREGTLCDYRPVLPLMLASFIFDVLCAPGSRPPSRNWNSETPGDEELGFEAAVAALGMKTTVSEAEHPLLCEGTRRE
KGDLALALMITYKDDQAKLKKILDKLLDRESQTHKPQTLSSFYSSSRPTTASQRSPSKHGGPSAPGALQPLTSGSAGPAQPGSVAGAGPG
PTEGFTEKNVPESSPHSPCEGLPSEAALTPRPEGKVPSRLALGSRGGYNGRGWGSPGRPKKKHTGMASIDSSAPETTSDSSPTLSRRPLR
GGWAPTSWGRGQDSDSISSSSSDSLGSSSSSGSRRASASGGARAKTVEVGRYKGRRPESHAPHVPNQPSEAAAHFYFELAKTVLIKAGGN
SSTSIFTHPSSSGGHQGPHRNLHLCAFEIGLYALGLHNFVSPNWLSRTYSSHVSWITGQAMEIGSAALTILVECWDGHLTPPEVASLADR
ASRARDSNMVRAAAELALSCLPHAHALNPNEIQRALVQCKEQDNLMLEKACMAVEEAAKVHPYHTEPGLPLPTSVACELWGQGTVSSVHP
ASTFPAIQGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGRRAHNDHPNNFSRSPPYTDDVKWLLGLA
AKLGVNYVHQFCVGAAKGVLSPFVLQEIVMETLQRLSPAHAHNHLRAPAFHQLVQRCQQAYMQYIHHRLIHLTPADYDDFVNAIRSARSA

>In-frame_VCL_ENST00000372755_chr10_75758133_+_ZSWIM8_ENST00000605216_chr10_75553346_+_1123aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVLFACAEALHAHGYSSEASRLTVELAQDLLANPP
DLKVEPPPAKGKKNKVSTSRQTWVATNTLSKAAFLLTVLSERPEHHNLAFRVGMFALELQRPPASTKALEVKLAYQESEVAALLKKIPLG
PSEMSTMRCRAEELREGTLCDYRPVLPLMLASFIFDVLCAPGSRPPSRNWNSETPGDEELGFEAAVAALGMKTTVSEAEHPLLCEGTRRE
KGDLALALMITYKDDQAKLKKILDKLLDRESQTHKPQTLSSFYSSSRPTTASQRSPSKHGGPSAPGALQPLTSGSAGPAQPGSVAGAGPG
PTEGFTEKNVPESSPHSPCEGLPSEAALTPRPEGKVPSRLALGSRGGYNGRGWGSPGRPKKKHTGMASIDSSAPETTSDSSPTLSRRPLR
GGWAPTSWGRGQDSDSISSSSSDSLGSSSSSGSRRASASGGARAKTVEVGRYKGRRPESHAPHVPNQPSEAAAHFYFELAKTVLIKAGGN
SSTSIFTHPSSSGGHQGPHRNLHLCAFEIGLYALGLHNFVSPNWLSRTYSSHVSWITGQAMEIGSAALTILVECWDGHLTPPEVASLADR
ASRARDSNMVRAAAELALSCLPHAHALNPNEIQRALVQCKEQDNLMLEKACMAVEEAAKGGGVYPEVLFEVAHQWFWLYEQTAGGSSTAR
EGATSCSASGIRAGGEAGRGMPEGRGGPGTEPVTVAAAAVTAAATVVPVISVGSSLYPGPGLGHGHSPGLHPYTALQPHLPCSPQYLTHP
AHPAHPMPHMPRPAVFPVPSSAYPQGVHPAFLGAQYPYSVTPPSLAATAVSFPVPSMAPITVHPYHTEPGLPLPTSVACELWGQGTVSSV
HPASTFPAIQGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGRRAHNDHPNNFSRSPPYTDDVKWLLG
LAAKLGVNYVHQFCVGAAKGVLSPFVLQEIVMETLQRLSPAHAHNHLRAPAFHQLVQRCQQAYMQYIHHRLIHLTPADYDDFVNAIRSAR

>In-frame_VCL_ENST00000372755_chr10_75758133_+_ZSWIM8_ENST00000398706_chr10_75553346_+_1128aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVLFACAEALHAHGYSSEASRLTVELAQDLLANPP
DLKVEPPPAKGKKNKVSTSRQTWVATNTLSKAAFLLTVLSERPEHHNLAFRVGMFALELQRPPASTKALEVKLAYQESEVAALLKKIPLG
PSEMSTMRCRAEELREGTLCDYRPVLPLMLASFIFDVLCAPVVSPTGSRPPSRNWNSETPGDEELGFEAAVAALGMKTTVSEAEHPLLCE
GTRREKGDLALALMITYKDDQAKLKKILDKLLDRESQTHKPQTLSSFYSSSRPTTASQRSPSKHGGPSAPGALQPLTSGSAGPAQPGSVA
GAGPGPTEGFTEKNVPESSPHSPCEGLPSEAALTPRPEGKVPSRLALGSRGGYNGRGWGSPGRPKKKHTGMASIDSSAPETTSDSSPTLS
RRPLRGGWAPTSWGRGQDSDSISSSSSDSLGSSSSSGSRRASASGGARAKTVEVGRYKGRRPESHAPHVPNQPSEAAAHFYFELAKTVLI
KAGGNSSTSIFTHPSSSGGHQGPHRNLHLCAFEIGLYALGLHNFVSPNWLSRTYSSHVSWITGQAMEIGSAALTILVECWDGHLTPPEVA
SLADRASRARDSNMVRAAAELALSCLPHAHALNPNEIQRALVQCKEQDNLMLEKACMAVEEAAKGGGVYPEVLFEVAHQWFWLYEQTAGG
SSTAREGATSCSASGIRAGGEAGRGMPEGRGGPGTEPVTVAAAAVTAAATVVPVISVGSSLYPGPGLGHGHSPGLHPYTALQPHLPCSPQ
YLTHPAHPAHPMPHMPRPAVFPVPSSAYPQGVHPAFLGAQYPYSVTPPSLAATAVSFPVPSMAPITVHPYHTEPGLPLPTSVACELWGQG
TVSSVHPASTFPAIQGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGRRAHNDHPNNFSRSPPYTDDV
KWLLGLAAKLGVNYVHQFCVGAAKGVLSPFVLQEIVMETLQRLSPAHAHNHLRAPAFHQLVQRCQQAYMQYIHHRLIHLTPADYDDFVNA

>In-frame_VCL_ENST00000417648_chr10_75758133_+_ZSWIM8_ENST00000604729_chr10_75553346_+_1120aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVLFACAEALHAHGYSSEASRLTVELAQDLLANPP
DLKVEPPPAKGKKNKVSTSRQTWVATNTLSKAAFLLTVLSERPEHHNLAFRVGMFALELQRPPASTKALEVKLAYQESEVAALLKKIPLG
PSEMSTMRCRAEELREGTLCDYRPVLPLMLASFIFDVLCAPVVSPTGSRPPSRNWNSETPGDEELGFEAAVAALGMKTTVSEAEHPLLCE
GTRREKGDLALALMITYKDDQAKLKKILDKLLDRESQTHKPQTLSSFYSSSRPTTASQRSPSKHGGPSAPGALQPLTSGSAGPAQPGSVA
GAGPGPTEGFTEKNVPESSPHSPCEGLPSEAALTPRPEGKVPSRLALGSRGGYNGRGWGSPGRPKKKHTGMASIDSSAPETTSDSSPTLS
RRPLRGGWAPTSWGRGQDSDSISSSSSDSLGSSSSSGSRRASASGGARAKTVEVGRYKGRRPESHAPHVPNQPSEAAAHFYFELAKTVLI
KAGGNSSTSIFTHPSSSGGHQGPHRNLHLCAFEIGLYALGLHNFVSPNWLSRTYSSHVSWITGQAMEIGSAALTILVECWDGHLTPPEVA
SLADRASRARDSNMVRAAAELALSCLPHAHALNPNEIQRALVQCKEQDNLMLEKACMAVEEAAKGGGVYPEVLFEVAHQWFWLYEQTAGG
SSTAREGATSCSASGIRAGGEAGRGMPEGRGGPGTEPVTVAAAAVTAAATVVPVISVGSSLYPGPGLGHGHSPGLHPYTALQPHLPCSPQ
YLTHPAHPAHPMPHMPRPAVFPVPSSAYPQGVHPAFLGAQYPYSVTPPSLAATAVSFPVPSMAPITVHPYHTEPGLPLPTSVALSSVHPA
STFPAIQGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGRRAHNDHPNNFSRSPPYTDDVKWLLGLAA
KLGVNYVHQFCVGAAKGVLSPFVLQEIVMETLQRLSPAHAHNHLRAPAFHQLVQRCQQAYMQYIHHRLIHLTPADYDDFVNAIRSARSAF

>In-frame_VCL_ENST00000417648_chr10_75758133_+_ZSWIM8_ENST00000603114_chr10_75553346_+_1115aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVLFACAEALHAHGYSSEASRLTVELAQDLLANPP
DLKVEPPPAKGKKNKVSTSRQTWVATNTLSKAAFLLTVLSERPEHHNLAFRVGMFALELQRPPASTKALEVKLAYQESEVAALLKKIPLG
PSEMSTMRCRAEELREGTLCDYRPVLPLMLASFIFDVLCAPGSRPPSRNWNSETPGDEELGFEAAVAALGMKTTVSEAEHPLLCEGTRRE
KGDLALALMITYKDDQAKLKKILDKLLDRESQTHKPQTLSSFYSSSRPTTASQRSPSKHGGPSAPGALQPLTSGSAGPAQPGSVAGAGPG
PTEGFTEKNVPESSPHSPCEGLPSEAALTPRPEGKVPSRLALGSRGGYNGRGWGSPGRPKKKHTGMASIDSSAPETTSDSSPTLSRRPLR
GGWAPTSWGRGQDSDSISSSSSDSLGSSSSSGSRRASASGGARAKTVEVGRYKGRRPESHAPHVPNQPSEAAAHFYFELAKTVLIKAGGN
SSTSIFTHPSSSGGHQGPHRNLHLCAFEIGLYALGLHNFVSPNWLSRTYSSHVSWITGQAMEIGSAALTILVECWDGHLTPPEVASLADR
ASRARDSNMVRAAAELALSCLPHAHALNPNEIQRALVQCKEQDNLMLEKACMAVEEAAKGGGVYPEVLFEVAHQWFWLYEQTAGGSSTAR
EGATSCSASGIRAGGEAGRGMPEGRGGPGTEPVTVAAAAVTAAATVVPVISVGSSLYPGPGLGHGHSPGLHPYTALQPHLPCSPQYLTHP
AHPAHPMPHMPRPAVFPVPSSAYPQGVHPAFLGAQYPYSVTPPSLAATAVSFPVPSMAPITVHPYHTEPGLPLPTSVALSSVHPASTFPA
IQGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGRRAHNDHPNNFSRSPPYTDDVKWLLGLAAKLGVN
YVHQFCVGAAKGVLSPFVLQEIVMETLQRLSPAHAHNHLRAPAFHQLVQRCQQAYMQYIHHRLIHLTPADYDDFVNAIRSARSAFCLTPM

>In-frame_VCL_ENST00000417648_chr10_75758133_+_ZSWIM8_ENST00000604524_chr10_75553346_+_941aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVLFACAEALHAHGYSSEASRLTVELAQDLLANPP
DLKVEPPPAKGKKNKVSTSRQTWVATNTLSKAAFLLTVLSERPEHHNLAFRVGMFALELQRPPASTKALEVKLAYQESEVAALLKKIPLG
PSEMSTMRCRAEELREGTLCDYRPVLPLMLASFIFDVLCAPGSRPPSRNWNSETPGDEELGFEAAVAALGMKTTVSEAEHPLLCEGTRRE
KGDLALALMITYKDDQAKLKKILDKLLDRESQTHKPQTLSSFYSSSRPTTASQRSPSKHGGPSAPGALQPLTSGSAGPAQPGSVAGAGPG
PTEGFTEKNVPESSPHSPCEGLPSEAALTPRPEGKVPSRLALGSRGGYNGRGWGSPGRPKKKHTGMASIDSSAPETTSDSSPTLSRRPLR
GGWAPTSWGRGQDSDSISSSSSDSLGSSSSSGSRRASASGGARAKTVEVGRYKGRRPESHAPHVPNQPSEAAAHFYFELAKTVLIKAGGN
SSTSIFTHPSSSGGHQGPHRNLHLCAFEIGLYALGLHNFVSPNWLSRTYSSHVSWITGQAMEIGSAALTILVECWDGHLTPPEVASLADR
ASRARDSNMVRAAAELALSCLPHAHALNPNEIQRALVQCKEQDNLMLEKACMAVEEAAKVHPYHTEPGLPLPTSVACELWGQGTVSSVHP
ASTFPAIQGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGRRAHNDHPNNFSRSPPYTDDVKWLLGLA
AKLGVNYVHQFCVGAAKGVLSPFVLQEIVMETLQRLSPAHAHNHLRAPAFHQLVQRCQQAYMQYIHHRLIHLTPADYDDFVNAIRSARSA

>In-frame_VCL_ENST00000417648_chr10_75758133_+_ZSWIM8_ENST00000605216_chr10_75553346_+_1123aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVLFACAEALHAHGYSSEASRLTVELAQDLLANPP
DLKVEPPPAKGKKNKVSTSRQTWVATNTLSKAAFLLTVLSERPEHHNLAFRVGMFALELQRPPASTKALEVKLAYQESEVAALLKKIPLG
PSEMSTMRCRAEELREGTLCDYRPVLPLMLASFIFDVLCAPGSRPPSRNWNSETPGDEELGFEAAVAALGMKTTVSEAEHPLLCEGTRRE
KGDLALALMITYKDDQAKLKKILDKLLDRESQTHKPQTLSSFYSSSRPTTASQRSPSKHGGPSAPGALQPLTSGSAGPAQPGSVAGAGPG
PTEGFTEKNVPESSPHSPCEGLPSEAALTPRPEGKVPSRLALGSRGGYNGRGWGSPGRPKKKHTGMASIDSSAPETTSDSSPTLSRRPLR
GGWAPTSWGRGQDSDSISSSSSDSLGSSSSSGSRRASASGGARAKTVEVGRYKGRRPESHAPHVPNQPSEAAAHFYFELAKTVLIKAGGN
SSTSIFTHPSSSGGHQGPHRNLHLCAFEIGLYALGLHNFVSPNWLSRTYSSHVSWITGQAMEIGSAALTILVECWDGHLTPPEVASLADR
ASRARDSNMVRAAAELALSCLPHAHALNPNEIQRALVQCKEQDNLMLEKACMAVEEAAKGGGVYPEVLFEVAHQWFWLYEQTAGGSSTAR
EGATSCSASGIRAGGEAGRGMPEGRGGPGTEPVTVAAAAVTAAATVVPVISVGSSLYPGPGLGHGHSPGLHPYTALQPHLPCSPQYLTHP
AHPAHPMPHMPRPAVFPVPSSAYPQGVHPAFLGAQYPYSVTPPSLAATAVSFPVPSMAPITVHPYHTEPGLPLPTSVACELWGQGTVSSV
HPASTFPAIQGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGRRAHNDHPNNFSRSPPYTDDVKWLLG
LAAKLGVNYVHQFCVGAAKGVLSPFVLQEIVMETLQRLSPAHAHNHLRAPAFHQLVQRCQQAYMQYIHHRLIHLTPADYDDFVNAIRSAR

>In-frame_VCL_ENST00000417648_chr10_75758133_+_ZSWIM8_ENST00000398706_chr10_75553346_+_1128aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVLFACAEALHAHGYSSEASRLTVELAQDLLANPP
DLKVEPPPAKGKKNKVSTSRQTWVATNTLSKAAFLLTVLSERPEHHNLAFRVGMFALELQRPPASTKALEVKLAYQESEVAALLKKIPLG
PSEMSTMRCRAEELREGTLCDYRPVLPLMLASFIFDVLCAPVVSPTGSRPPSRNWNSETPGDEELGFEAAVAALGMKTTVSEAEHPLLCE
GTRREKGDLALALMITYKDDQAKLKKILDKLLDRESQTHKPQTLSSFYSSSRPTTASQRSPSKHGGPSAPGALQPLTSGSAGPAQPGSVA
GAGPGPTEGFTEKNVPESSPHSPCEGLPSEAALTPRPEGKVPSRLALGSRGGYNGRGWGSPGRPKKKHTGMASIDSSAPETTSDSSPTLS
RRPLRGGWAPTSWGRGQDSDSISSSSSDSLGSSSSSGSRRASASGGARAKTVEVGRYKGRRPESHAPHVPNQPSEAAAHFYFELAKTVLI
KAGGNSSTSIFTHPSSSGGHQGPHRNLHLCAFEIGLYALGLHNFVSPNWLSRTYSSHVSWITGQAMEIGSAALTILVECWDGHLTPPEVA
SLADRASRARDSNMVRAAAELALSCLPHAHALNPNEIQRALVQCKEQDNLMLEKACMAVEEAAKGGGVYPEVLFEVAHQWFWLYEQTAGG
SSTAREGATSCSASGIRAGGEAGRGMPEGRGGPGTEPVTVAAAAVTAAATVVPVISVGSSLYPGPGLGHGHSPGLHPYTALQPHLPCSPQ
YLTHPAHPAHPMPHMPRPAVFPVPSSAYPQGVHPAFLGAQYPYSVTPPSLAATAVSFPVPSMAPITVHPYHTEPGLPLPTSVACELWGQG
TVSSVHPASTFPAIQGASLPALTTQPSPLVSGGFPPPEEETHSQPVNPHSLHHLHAAYRVGMLALEMLGRRAHNDHPNNFSRSPPYTDDV
KWLLGLAAKLGVNYVHQFCVGAAKGVLSPFVLQEIVMETLQRLSPAHAHNHLRAPAFHQLVQRCQQAYMQYIHHRLIHLTPADYDDFVNA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_VCL_ENST00000211998_chr10_75758133_+_ZSWIM8_ENST00000604729_chr10_75553346_+_3360nt
ATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGGGC
GAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTGCC
TGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCACCC
GACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGAGC
AAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTACAG
AGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGGGT
CCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGCTG
GCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGTGGTTTCTCCCACAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCT
GGGGATGAGGAGCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAA
GGCACACGTCGGGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAA
CTCTTGGACCGAGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCT
CCTTCAAAGCACGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCA
GGGGCTGGGCCAGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAG
GCAGCTTTGACCCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCC
CCAGGACGGCCTAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGC
CGGAGACCACTTCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTG
GGCTCCTCATCCTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGC
CGCCCCGAGAGTCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATC
AAGGCAGGGGGCAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGC
GCCTTCGAGATTGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGG
ATTACAGGCCAGGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCA
TCCCTGGCTGACAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCAT
GCATTGAACCCTAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAA
GAGGCAGCTAAGGGTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGC
TCATCCACAGCCCGTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGA
GGGGGCCCAGGGACTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGT
TTATACCCGGGTCCAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAG
TATCTCACTCACCCAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAG
GGTGTGCATCCTGCATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCT
TCCATGGCACCCATCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTTGAGCAGTGTCCATCCAGCA
TCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACCGCCCGAG
GAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGAGATGCTG
GGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCTGGCAGCA
AAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGTCATGGAG
ACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCAGGCATAC
ATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAGCGCCTTC
TGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCAGCGGGTC

>In-frame_VCL_ENST00000211998_chr10_75758133_+_ZSWIM8_ENST00000603114_chr10_75553346_+_3345nt
ATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGGGC
GAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTGCC
TGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCACCC
GACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGAGC
AAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTACAG
AGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGGGT
CCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGCTG
GCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGAGCTT
GGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCGGGAG
AAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCGAGAG
AGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCACGGG
GGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCCAGGC
CCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGACCCCA
AGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCCTAAG
AAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACTTCGA
GGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATCCTCC
AGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAGTCAT
GCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGGCAAC
AGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGATTGGG
CTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCAGGCC
ATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGACAGG
GCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCCTAAT
GAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAAGGGT
GGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGCTCATCCACAGCCCGT
GAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGAGGGGGCCCAGGGACT
GAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGTTTATACCCGGGTCCA
GGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAGTATCTCACTCACCCA
GCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAGGGTGTGCATCCTGCA
TTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCTTCCATGGCACCCATC
ACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTTGAGCAGTGTCCATCCAGCATCCACGTTTCCAGCC
ATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACCGCCCGAGGAGGAGACACACAGT
CAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGAGATGCTGGGTCGCCGGGCACAC
AACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCTGGCAGCAAAGCTGGGAGTGAAC
TACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGTCATGGAGACGCTGCAGCGGCTG
AGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCAGGCATACATGCAGTACATCCAC
CACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAGCGCCTTCTGCCTGACGCCCATG
GGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCAGCGGGTCTCACTCGAGATGGCC

>In-frame_VCL_ENST00000211998_chr10_75758133_+_ZSWIM8_ENST00000604524_chr10_75553346_+_2823nt
ATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGGGC
GAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTGCC
TGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCACCC
GACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGAGC
AAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTACAG
AGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGGGT
CCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGCTG
GCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGAGCTT
GGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCGGGAG
AAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCGAGAG
AGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCACGGG
GGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCCAGGC
CCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGACCCCA
AGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCCTAAG
AAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACTTCGA
GGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATCCTCC
AGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAGTCAT
GCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGGCAAC
AGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGATTGGG
CTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCAGGCC
ATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGACAGG
GCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCCTAAT
GAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAAGGTA
CATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCAGGGAACAGTGAGCAGTGTCCATCCA
GCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACCGCCC
GAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGAGATG
CTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCTGGCA
GCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGTCATG
GAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCAGGCA
TACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAGCGCC
TTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCAGCGG

>In-frame_VCL_ENST00000211998_chr10_75758133_+_ZSWIM8_ENST00000605216_chr10_75553346_+_3369nt
ATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGGGC
GAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTGCC
TGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCACCC
GACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGAGC
AAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTACAG
AGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGGGT
CCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGCTG
GCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGAGCTT
GGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCGGGAG
AAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCGAGAG
AGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCACGGG
GGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCCAGGC
CCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGACCCCA
AGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCCTAAG
AAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACTTCGA
GGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATCCTCC
AGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAGTCAT
GCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGGCAAC
AGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGATTGGG
CTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCAGGCC
ATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGACAGG
GCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCCTAAT
GAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAAGGGT
GGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGCTCATCCACAGCCCGT
GAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGAGGGGGCCCAGGGACT
GAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGTTTATACCCGGGTCCA
GGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAGTATCTCACTCACCCA
GCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAGGGTGTGCATCCTGCA
TTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCTTCCATGGCACCCATC
ACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCAGGGAACAGTGAGCAGTGTC
CATCCAGCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCA
CCGCCCGAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTG
GAGATGCTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGG
CTGGCAGCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATC
GTCATGGAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAG
CAGGCATACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGC
AGCGCCTTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGG

>In-frame_VCL_ENST00000211998_chr10_75758133_+_ZSWIM8_ENST00000398706_chr10_75553346_+_3384nt
ATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGGGC
GAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTGCC
TGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCACCC
GACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGAGC
AAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTACAG
AGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGGGT
CCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGCTG
GCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGTGGTTTCTCCCACAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCT
GGGGATGAGGAGCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAA
GGCACACGTCGGGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAA
CTCTTGGACCGAGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCT
CCTTCAAAGCACGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCA
GGGGCTGGGCCAGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAG
GCAGCTTTGACCCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCC
CCAGGACGGCCTAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGC
CGGAGACCACTTCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTG
GGCTCCTCATCCTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGC
CGCCCCGAGAGTCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATC
AAGGCAGGGGGCAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGC
GCCTTCGAGATTGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGG
ATTACAGGCCAGGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCA
TCCCTGGCTGACAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCAT
GCATTGAACCCTAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAA
GAGGCAGCTAAGGGTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGC
TCATCCACAGCCCGTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGA
GGGGGCCCAGGGACTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGT
TTATACCCGGGTCCAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAG
TATCTCACTCACCCAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAG
GGTGTGCATCCTGCATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCT
TCCATGGCACCCATCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCAGGGA
ACAGTGAGCAGTGTCCATCCAGCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTG
AGCGGAGGTTTTCCACCGCCCGAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTC
GGAATGCTGGCACTGGAGATGCTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTC
AAATGGTTGCTGGGGCTGGCAGCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTT
GTGCTGCAGGAGATCGTCATGGAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTG
GTGCAGCGCTGCCAGCAGGCATACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCG
ATCCGGAGTGCCCGCAGCGCCTTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAG

>In-frame_VCL_ENST00000372755_chr10_75758133_+_ZSWIM8_ENST00000604729_chr10_75553346_+_3360nt
ATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGGGC
GAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTGCC
TGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCACCC
GACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGAGC
AAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTACAG
AGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGGGT
CCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGCTG
GCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGTGGTTTCTCCCACAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCT
GGGGATGAGGAGCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAA
GGCACACGTCGGGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAA
CTCTTGGACCGAGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCT
CCTTCAAAGCACGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCA
GGGGCTGGGCCAGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAG
GCAGCTTTGACCCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCC
CCAGGACGGCCTAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGC
CGGAGACCACTTCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTG
GGCTCCTCATCCTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGC
CGCCCCGAGAGTCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATC
AAGGCAGGGGGCAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGC
GCCTTCGAGATTGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGG
ATTACAGGCCAGGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCA
TCCCTGGCTGACAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCAT
GCATTGAACCCTAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAA
GAGGCAGCTAAGGGTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGC
TCATCCACAGCCCGTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGA
GGGGGCCCAGGGACTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGT
TTATACCCGGGTCCAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAG
TATCTCACTCACCCAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAG
GGTGTGCATCCTGCATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCT
TCCATGGCACCCATCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTTGAGCAGTGTCCATCCAGCA
TCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACCGCCCGAG
GAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGAGATGCTG
GGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCTGGCAGCA
AAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGTCATGGAG
ACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCAGGCATAC
ATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAGCGCCTTC
TGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCAGCGGGTC

>In-frame_VCL_ENST00000372755_chr10_75758133_+_ZSWIM8_ENST00000603114_chr10_75553346_+_3345nt
ATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGGGC
GAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTGCC
TGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCACCC
GACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGAGC
AAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTACAG
AGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGGGT
CCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGCTG
GCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGAGCTT
GGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCGGGAG
AAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCGAGAG
AGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCACGGG
GGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCCAGGC
CCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGACCCCA
AGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCCTAAG
AAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACTTCGA
GGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATCCTCC
AGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAGTCAT
GCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGGCAAC
AGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGATTGGG
CTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCAGGCC
ATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGACAGG
GCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCCTAAT
GAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAAGGGT
GGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGCTCATCCACAGCCCGT
GAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGAGGGGGCCCAGGGACT
GAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGTTTATACCCGGGTCCA
GGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAGTATCTCACTCACCCA
GCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAGGGTGTGCATCCTGCA
TTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCTTCCATGGCACCCATC
ACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTTGAGCAGTGTCCATCCAGCATCCACGTTTCCAGCC
ATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACCGCCCGAGGAGGAGACACACAGT
CAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGAGATGCTGGGTCGCCGGGCACAC
AACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCTGGCAGCAAAGCTGGGAGTGAAC
TACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGTCATGGAGACGCTGCAGCGGCTG
AGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCAGGCATACATGCAGTACATCCAC
CACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAGCGCCTTCTGCCTGACGCCCATG
GGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCAGCGGGTCTCACTCGAGATGGCC

>In-frame_VCL_ENST00000372755_chr10_75758133_+_ZSWIM8_ENST00000604524_chr10_75553346_+_2823nt
ATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGGGC
GAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTGCC
TGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCACCC
GACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGAGC
AAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTACAG
AGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGGGT
CCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGCTG
GCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGAGCTT
GGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCGGGAG
AAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCGAGAG
AGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCACGGG
GGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCCAGGC
CCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGACCCCA
AGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCCTAAG
AAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACTTCGA
GGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATCCTCC
AGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAGTCAT
GCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGGCAAC
AGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGATTGGG
CTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCAGGCC
ATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGACAGG
GCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCCTAAT
GAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAAGGTA
CATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCAGGGAACAGTGAGCAGTGTCCATCCA
GCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACCGCCC
GAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGAGATG
CTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCTGGCA
GCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGTCATG
GAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCAGGCA
TACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAGCGCC
TTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCAGCGG

>In-frame_VCL_ENST00000372755_chr10_75758133_+_ZSWIM8_ENST00000605216_chr10_75553346_+_3369nt
ATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGGGC
GAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTGCC
TGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCACCC
GACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGAGC
AAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTACAG
AGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGGGT
CCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGCTG
GCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGAGCTT
GGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCGGGAG
AAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCGAGAG
AGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCACGGG
GGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCCAGGC
CCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGACCCCA
AGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCCTAAG
AAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACTTCGA
GGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATCCTCC
AGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAGTCAT
GCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGGCAAC
AGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGATTGGG
CTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCAGGCC
ATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGACAGG
GCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCCTAAT
GAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAAGGGT
GGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGCTCATCCACAGCCCGT
GAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGAGGGGGCCCAGGGACT
GAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGTTTATACCCGGGTCCA
GGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAGTATCTCACTCACCCA
GCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAGGGTGTGCATCCTGCA
TTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCTTCCATGGCACCCATC
ACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCAGGGAACAGTGAGCAGTGTC
CATCCAGCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCA
CCGCCCGAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTG
GAGATGCTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGG
CTGGCAGCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATC
GTCATGGAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAG
CAGGCATACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGC
AGCGCCTTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGG

>In-frame_VCL_ENST00000372755_chr10_75758133_+_ZSWIM8_ENST00000398706_chr10_75553346_+_3384nt
ATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGGGC
GAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTGCC
TGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCACCC
GACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGAGC
AAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTACAG
AGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGGGT
CCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGCTG
GCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGTGGTTTCTCCCACAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCT
GGGGATGAGGAGCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAA
GGCACACGTCGGGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAA
CTCTTGGACCGAGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCT
CCTTCAAAGCACGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCA
GGGGCTGGGCCAGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAG
GCAGCTTTGACCCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCC
CCAGGACGGCCTAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGC
CGGAGACCACTTCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTG
GGCTCCTCATCCTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGC
CGCCCCGAGAGTCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATC
AAGGCAGGGGGCAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGC
GCCTTCGAGATTGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGG
ATTACAGGCCAGGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCA
TCCCTGGCTGACAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCAT
GCATTGAACCCTAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAA
GAGGCAGCTAAGGGTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGC
TCATCCACAGCCCGTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGA
GGGGGCCCAGGGACTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGT
TTATACCCGGGTCCAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAG
TATCTCACTCACCCAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAG
GGTGTGCATCCTGCATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCT
TCCATGGCACCCATCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCAGGGA
ACAGTGAGCAGTGTCCATCCAGCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTG
AGCGGAGGTTTTCCACCGCCCGAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTC
GGAATGCTGGCACTGGAGATGCTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTC
AAATGGTTGCTGGGGCTGGCAGCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTT
GTGCTGCAGGAGATCGTCATGGAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTG
GTGCAGCGCTGCCAGCAGGCATACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCG
ATCCGGAGTGCCCGCAGCGCCTTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAG

>In-frame_VCL_ENST00000417648_chr10_75758133_+_ZSWIM8_ENST00000604729_chr10_75553346_+_3360nt
ATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGGGC
GAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTGCC
TGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCACCC
GACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGAGC
AAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTACAG
AGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGGGT
CCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGCTG
GCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGTGGTTTCTCCCACAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCT
GGGGATGAGGAGCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAA
GGCACACGTCGGGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAA
CTCTTGGACCGAGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCT
CCTTCAAAGCACGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCA
GGGGCTGGGCCAGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAG
GCAGCTTTGACCCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCC
CCAGGACGGCCTAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGC
CGGAGACCACTTCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTG
GGCTCCTCATCCTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGC
CGCCCCGAGAGTCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATC
AAGGCAGGGGGCAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGC
GCCTTCGAGATTGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGG
ATTACAGGCCAGGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCA
TCCCTGGCTGACAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCAT
GCATTGAACCCTAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAA
GAGGCAGCTAAGGGTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGC
TCATCCACAGCCCGTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGA
GGGGGCCCAGGGACTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGT
TTATACCCGGGTCCAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAG
TATCTCACTCACCCAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAG
GGTGTGCATCCTGCATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCT
TCCATGGCACCCATCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTTGAGCAGTGTCCATCCAGCA
TCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACCGCCCGAG
GAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGAGATGCTG
GGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCTGGCAGCA
AAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGTCATGGAG
ACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCAGGCATAC
ATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAGCGCCTTC
TGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCAGCGGGTC

>In-frame_VCL_ENST00000417648_chr10_75758133_+_ZSWIM8_ENST00000603114_chr10_75553346_+_3345nt
ATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGGGC
GAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTGCC
TGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCACCC
GACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGAGC
AAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTACAG
AGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGGGT
CCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGCTG
GCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGAGCTT
GGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCGGGAG
AAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCGAGAG
AGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCACGGG
GGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCCAGGC
CCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGACCCCA
AGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCCTAAG
AAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACTTCGA
GGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATCCTCC
AGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAGTCAT
GCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGGCAAC
AGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGATTGGG
CTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCAGGCC
ATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGACAGG
GCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCCTAAT
GAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAAGGGT
GGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGCTCATCCACAGCCCGT
GAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGAGGGGGCCCAGGGACT
GAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGTTTATACCCGGGTCCA
GGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAGTATCTCACTCACCCA
GCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAGGGTGTGCATCCTGCA
TTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCTTCCATGGCACCCATC
ACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTTGAGCAGTGTCCATCCAGCATCCACGTTTCCAGCC
ATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACCGCCCGAGGAGGAGACACACAGT
CAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGAGATGCTGGGTCGCCGGGCACAC
AACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCTGGCAGCAAAGCTGGGAGTGAAC
TACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGTCATGGAGACGCTGCAGCGGCTG
AGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCAGGCATACATGCAGTACATCCAC
CACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAGCGCCTTCTGCCTGACGCCCATG
GGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCAGCGGGTCTCACTCGAGATGGCC

>In-frame_VCL_ENST00000417648_chr10_75758133_+_ZSWIM8_ENST00000604524_chr10_75553346_+_2823nt
ATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGGGC
GAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTGCC
TGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCACCC
GACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGAGC
AAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTACAG
AGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGGGT
CCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGCTG
GCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGAGCTT
GGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCGGGAG
AAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCGAGAG
AGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCACGGG
GGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCCAGGC
CCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGACCCCA
AGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCCTAAG
AAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACTTCGA
GGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATCCTCC
AGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAGTCAT
GCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGGCAAC
AGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGATTGGG
CTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCAGGCC
ATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGACAGG
GCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCCTAAT
GAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAAGGTA
CATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCAGGGAACAGTGAGCAGTGTCCATCCA
GCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACCGCCC
GAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGAGATG
CTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCTGGCA
GCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGTCATG
GAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCAGGCA
TACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAGCGCC
TTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCAGCGG

>In-frame_VCL_ENST00000417648_chr10_75758133_+_ZSWIM8_ENST00000605216_chr10_75553346_+_3369nt
ATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGGGC
GAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTGCC
TGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCACCC
GACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGAGC
AAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTACAG
AGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGGGT
CCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGCTG
GCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGAGCTT
GGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCGGGAG
AAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCGAGAG
AGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCACGGG
GGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCCAGGC
CCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGACCCCA
AGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCCTAAG
AAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACTTCGA
GGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATCCTCC
AGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAGTCAT
GCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGGCAAC
AGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGATTGGG
CTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCAGGCC
ATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGACAGG
GCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCCTAAT
GAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAAGGGT
GGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGCTCATCCACAGCCCGT
GAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGAGGGGGCCCAGGGACT
GAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGTTTATACCCGGGTCCA
GGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAGTATCTCACTCACCCA
GCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAGGGTGTGCATCCTGCA
TTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCTTCCATGGCACCCATC
ACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCAGGGAACAGTGAGCAGTGTC
CATCCAGCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCA
CCGCCCGAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTG
GAGATGCTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGG
CTGGCAGCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATC
GTCATGGAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAG
CAGGCATACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGC
AGCGCCTTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGG

>In-frame_VCL_ENST00000417648_chr10_75758133_+_ZSWIM8_ENST00000398706_chr10_75553346_+_3384nt
ATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGGGC
GAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTGCC
TGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCACCC
GACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGAGC
AAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTACAG
AGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGGGT
CCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGCTG
GCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGTGGTTTCTCCCACAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCT
GGGGATGAGGAGCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAA
GGCACACGTCGGGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAA
CTCTTGGACCGAGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCT
CCTTCAAAGCACGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCA
GGGGCTGGGCCAGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAG
GCAGCTTTGACCCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCC
CCAGGACGGCCTAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGC
CGGAGACCACTTCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTG
GGCTCCTCATCCTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGC
CGCCCCGAGAGTCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATC
AAGGCAGGGGGCAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGC
GCCTTCGAGATTGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGG
ATTACAGGCCAGGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCA
TCCCTGGCTGACAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCAT
GCATTGAACCCTAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAA
GAGGCAGCTAAGGGTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGC
TCATCCACAGCCCGTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGA
GGGGGCCCAGGGACTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGT
TTATACCCGGGTCCAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAG
TATCTCACTCACCCAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAG
GGTGTGCATCCTGCATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCT
TCCATGGCACCCATCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCAGGGA
ACAGTGAGCAGTGTCCATCCAGCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTG
AGCGGAGGTTTTCCACCGCCCGAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTC
GGAATGCTGGCACTGGAGATGCTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTC
AAATGGTTGCTGGGGCTGGCAGCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTT
GTGCTGCAGGAGATCGTCATGGAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTG
GTGCAGCGCTGCCAGCAGGCATACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCG
ATCCGGAGTGCCCGCAGCGCCTTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_VCL_ENST00000211998_chr10_75758133_+_ZSWIM8_ENST00000604729_chr10_75553346_+_3727nt
GTAGTCGCTGCACAGTCTGTCTCTTCGCCGGTTCCCGGCCCCGTGGATCCTACTTCTCTGTCGCCCGCGGTTCGCCGCCCCGCTCGCCGC
CGCGATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGA
GGGCGAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTT
TGCCTGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCC
ACCCGACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCT
GAGCAAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCT
ACAGAGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCT
GGGTCCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCAT
GCTGGCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGTGGTTTCTCCCACAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGAC
ACCTGGGGATGAGGAGCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATG
TGAAGGCACACGTCGGGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGA
CAAACTCTTGGACCGAGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAG
GTCTCCTTCAAAGCACGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGT
GGCAGGGGCTGGGCCAGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATC
TGAGGCAGCTTTGACCCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGG
GTCCCCAGGACGGCCTAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTT
AAGCCGGAGACCACTTCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTC
CCTGGGCTCCTCATCCTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGG
CCGCCGCCCCGAGAGTCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCT
GATCAAGGCAGGGGGCAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCT
TTGCGCCTTCGAGATTGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTC
CTGGATTACAGGCCAGGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGT
TGCATCCCTGGCTGACAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGC
CCATGCATTGAACCCTAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGT
GGAAGAGGCAGCTAAGGGTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGG
TGGCTCATCCACAGCCCGTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGG
TAGAGGGGGCCCAGGGACTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTC
TAGTTTATACCCGGGTCCAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCC
TCAGTATCTCACTCACCCAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCC
ACAGGGTGTGCATCCTGCATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGT
TCCTTCCATGGCACCCATCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTTGAGCAGTGTCCATCC
AGCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACCGCC
CGAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGAGAT
GCTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCTGGC
AGCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGTCAT
GGAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCAGGC
ATACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAGCGC
CTTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCAGCG
GGTCTCACTCGAGATGGCCACCTTCTCCCCCTGAGTCTTTCACCCTTAGGGTCCTATACAGGGACCCAGGCCTGTGGCTATGGGGGCCCC
TCACACAGGGGGAGTGAAACTTGGCTGGACAGATCATCCTCACTCAGTTCCCTGGTAGCACAGACTGACAGCTGCTCTTGGGCTATAGCT
TGGGGCCAAGATGTCTCACACCCTAGAAGCCTAGGGCTGGGGGAGACAGCCCTGTCTGGGAGGGGGCGTTGGGTGGCCTCTGGTATTTAT

>In-frame_VCL_ENST00000211998_chr10_75758133_+_ZSWIM8_ENST00000603114_chr10_75553346_+_3712nt
GTAGTCGCTGCACAGTCTGTCTCTTCGCCGGTTCCCGGCCCCGTGGATCCTACTTCTCTGTCGCCCGCGGTTCGCCGCCCCGCTCGCCGC
CGCGATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGA
GGGCGAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTT
TGCCTGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCC
ACCCGACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCT
GAGCAAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCT
ACAGAGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCT
GGGTCCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCAT
GCTGGCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGA
GCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCG
GGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCG
AGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCA
CGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCC
AGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGAC
CCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCC
TAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACT
TCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATC
CTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAG
TCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGG
CAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGAT
TGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCA
GGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGA
CAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCC
TAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAA
GGGTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGCTCATCCACAGC
CCGTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGAGGGGGCCCAGG
GACTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGTTTATACCCGGG
TCCAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAGTATCTCACTCA
CCCAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAGGGTGTGCATCC
TGCATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCTTCCATGGCACC
CATCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTTGAGCAGTGTCCATCCAGCATCCACGTTTCC
AGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACCGCCCGAGGAGGAGACACA
CAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGAGATGCTGGGTCGCCGGGC
ACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCTGGCAGCAAAGCTGGGAGT
GAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGTCATGGAGACGCTGCAGCG
GCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCAGGCATACATGCAGTACAT
CCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAGCGCCTTCTGCCTGACGCC
CATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCAGCGGGTCTCACTCGAGAT
GGCCACCTTCTCCCCCTGAGTCTTTCACCCTTAGGGTCCTATACAGGGACCCAGGCCTGTGGCTATGGGGGCCCCTCACACAGGGGGAGT
GAAACTTGGCTGGACAGATCATCCTCACTCAGTTCCCTGGTAGCACAGACTGACAGCTGCTCTTGGGCTATAGCTTGGGGCCAAGATGTC
TCACACCCTAGAAGCCTAGGGCTGGGGGAGACAGCCCTGTCTGGGAGGGGGCGTTGGGTGGCCTCTGGTATTTATTTGGCATTTATAAAT

>In-frame_VCL_ENST00000211998_chr10_75758133_+_ZSWIM8_ENST00000604524_chr10_75553346_+_3191nt
GTAGTCGCTGCACAGTCTGTCTCTTCGCCGGTTCCCGGCCCCGTGGATCCTACTTCTCTGTCGCCCGCGGTTCGCCGCCCCGCTCGCCGC
CGCGATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGA
GGGCGAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTT
TGCCTGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCC
ACCCGACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCT
GAGCAAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCT
ACAGAGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCT
GGGTCCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCAT
GCTGGCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGA
GCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCG
GGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCG
AGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCA
CGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCC
AGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGAC
CCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCC
TAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACT
TCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATC
CTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAG
TCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGG
CAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGAT
TGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCA
GGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGA
CAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCC
TAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAA
GGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCAGGGAACAGTGAGCAGTGTCCA
TCCAGCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACC
GCCCGAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGA
GATGCTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCT
GGCAGCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGT
CATGGAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCA
GGCATACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAG
CGCCTTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCA
GCGGGTCTCACTCGAGATGGCCACCTTCTCCCCCTGAGTCTTTCACCCTTAGGGTCCTATACAGGGACCCAGGCCTGTGGCTATGGGGGC
CCCTCACACAGGGGGAGTGAAACTTGGCTGGACAGATCATCCTCACTCAGTTCCCTGGTAGCACAGACTGACAGCTGCTCTTGGGCTATA
GCTTGGGGCCAAGATGTCTCACACCCTAGAAGCCTAGGGCTGGGGGAGACAGCCCTGTCTGGGAGGGGGCGTTGGGTGGCCTCTGGTATT

>In-frame_VCL_ENST00000211998_chr10_75758133_+_ZSWIM8_ENST00000605216_chr10_75553346_+_3736nt
GTAGTCGCTGCACAGTCTGTCTCTTCGCCGGTTCCCGGCCCCGTGGATCCTACTTCTCTGTCGCCCGCGGTTCGCCGCCCCGCTCGCCGC
CGCGATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGA
GGGCGAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTT
TGCCTGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCC
ACCCGACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCT
GAGCAAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCT
ACAGAGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCT
GGGTCCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCAT
GCTGGCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGA
GCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCG
GGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCG
AGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCA
CGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCC
AGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGAC
CCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCC
TAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACT
TCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATC
CTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAG
TCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGG
CAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGAT
TGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCA
GGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGA
CAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCC
TAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAA
GGGTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGCTCATCCACAGC
CCGTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGAGGGGGCCCAGG
GACTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGTTTATACCCGGG
TCCAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAGTATCTCACTCA
CCCAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAGGGTGTGCATCC
TGCATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCTTCCATGGCACC
CATCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCAGGGAACAGTGAGCAG
TGTCCATCCAGCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTT
TCCACCGCCCGAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGC
ACTGGAGATGCTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCT
GGGGCTGGCAGCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGA
GATCGTCATGGAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTG
CCAGCAGGCATACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGC
CCGCAGCGCCTTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCT
GTGGCAGCGGGTCTCACTCGAGATGGCCACCTTCTCCCCCTGAGTCTTTCACCCTTAGGGTCCTATACAGGGACCCAGGCCTGTGGCTAT
GGGGGCCCCTCACACAGGGGGAGTGAAACTTGGCTGGACAGATCATCCTCACTCAGTTCCCTGGTAGCACAGACTGACAGCTGCTCTTGG
GCTATAGCTTGGGGCCAAGATGTCTCACACCCTAGAAGCCTAGGGCTGGGGGAGACAGCCCTGTCTGGGAGGGGGCGTTGGGTGGCCTCT

>In-frame_VCL_ENST00000211998_chr10_75758133_+_ZSWIM8_ENST00000398706_chr10_75553346_+_3751nt
GTAGTCGCTGCACAGTCTGTCTCTTCGCCGGTTCCCGGCCCCGTGGATCCTACTTCTCTGTCGCCCGCGGTTCGCCGCCCCGCTCGCCGC
CGCGATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGA
GGGCGAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTT
TGCCTGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCC
ACCCGACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCT
GAGCAAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCT
ACAGAGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCT
GGGTCCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCAT
GCTGGCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGTGGTTTCTCCCACAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGAC
ACCTGGGGATGAGGAGCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATG
TGAAGGCACACGTCGGGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGA
CAAACTCTTGGACCGAGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAG
GTCTCCTTCAAAGCACGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGT
GGCAGGGGCTGGGCCAGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATC
TGAGGCAGCTTTGACCCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGG
GTCCCCAGGACGGCCTAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTT
AAGCCGGAGACCACTTCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTC
CCTGGGCTCCTCATCCTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGG
CCGCCGCCCCGAGAGTCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCT
GATCAAGGCAGGGGGCAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCT
TTGCGCCTTCGAGATTGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTC
CTGGATTACAGGCCAGGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGT
TGCATCCCTGGCTGACAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGC
CCATGCATTGAACCCTAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGT
GGAAGAGGCAGCTAAGGGTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGG
TGGCTCATCCACAGCCCGTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGG
TAGAGGGGGCCCAGGGACTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTC
TAGTTTATACCCGGGTCCAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCC
TCAGTATCTCACTCACCCAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCC
ACAGGGTGTGCATCCTGCATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGT
TCCTTCCATGGCACCCATCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCA
GGGAACAGTGAGCAGTGTCCATCCAGCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCT
GGTGAGCGGAGGTTTTCCACCGCCCGAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCG
TGTCGGAATGCTGGCACTGGAGATGCTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGA
TGTCAAATGGTTGCTGGGGCTGGCAGCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCC
GTTTGTGCTGCAGGAGATCGTCATGGAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCA
ACTGGTGCAGCGCTGCCAGCAGGCATACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAA
TGCGATCCGGAGTGCCCGCAGCGCCTTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAA
ACAGACCAAGGAGCTGTGGCAGCGGGTCTCACTCGAGATGGCCACCTTCTCCCCCTGAGTCTTTCACCCTTAGGGTCCTATACAGGGACC
CAGGCCTGTGGCTATGGGGGCCCCTCACACAGGGGGAGTGAAACTTGGCTGGACAGATCATCCTCACTCAGTTCCCTGGTAGCACAGACT
GACAGCTGCTCTTGGGCTATAGCTTGGGGCCAAGATGTCTCACACCCTAGAAGCCTAGGGCTGGGGGAGACAGCCCTGTCTGGGAGGGGG

>In-frame_VCL_ENST00000372755_chr10_75758133_+_ZSWIM8_ENST00000604729_chr10_75553346_+_3727nt
GTAGTCGCTGCACAGTCTGTCTCTTCGCCGGTTCCCGGCCCCGTGGATCCTACTTCTCTGTCGCCCGCGGTTCGCCGCCCCGCTCGCCGC
CGCGATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGA
GGGCGAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTT
TGCCTGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCC
ACCCGACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCT
GAGCAAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCT
ACAGAGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCT
GGGTCCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCAT
GCTGGCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGTGGTTTCTCCCACAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGAC
ACCTGGGGATGAGGAGCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATG
TGAAGGCACACGTCGGGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGA
CAAACTCTTGGACCGAGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAG
GTCTCCTTCAAAGCACGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGT
GGCAGGGGCTGGGCCAGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATC
TGAGGCAGCTTTGACCCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGG
GTCCCCAGGACGGCCTAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTT
AAGCCGGAGACCACTTCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTC
CCTGGGCTCCTCATCCTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGG
CCGCCGCCCCGAGAGTCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCT
GATCAAGGCAGGGGGCAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCT
TTGCGCCTTCGAGATTGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTC
CTGGATTACAGGCCAGGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGT
TGCATCCCTGGCTGACAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGC
CCATGCATTGAACCCTAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGT
GGAAGAGGCAGCTAAGGGTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGG
TGGCTCATCCACAGCCCGTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGG
TAGAGGGGGCCCAGGGACTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTC
TAGTTTATACCCGGGTCCAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCC
TCAGTATCTCACTCACCCAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCC
ACAGGGTGTGCATCCTGCATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGT
TCCTTCCATGGCACCCATCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTTGAGCAGTGTCCATCC
AGCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACCGCC
CGAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGAGAT
GCTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCTGGC
AGCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGTCAT
GGAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCAGGC
ATACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAGCGC
CTTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCAGCG
GGTCTCACTCGAGATGGCCACCTTCTCCCCCTGAGTCTTTCACCCTTAGGGTCCTATACAGGGACCCAGGCCTGTGGCTATGGGGGCCCC
TCACACAGGGGGAGTGAAACTTGGCTGGACAGATCATCCTCACTCAGTTCCCTGGTAGCACAGACTGACAGCTGCTCTTGGGCTATAGCT
TGGGGCCAAGATGTCTCACACCCTAGAAGCCTAGGGCTGGGGGAGACAGCCCTGTCTGGGAGGGGGCGTTGGGTGGCCTCTGGTATTTAT

>In-frame_VCL_ENST00000372755_chr10_75758133_+_ZSWIM8_ENST00000603114_chr10_75553346_+_3712nt
GTAGTCGCTGCACAGTCTGTCTCTTCGCCGGTTCCCGGCCCCGTGGATCCTACTTCTCTGTCGCCCGCGGTTCGCCGCCCCGCTCGCCGC
CGCGATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGA
GGGCGAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTT
TGCCTGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCC
ACCCGACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCT
GAGCAAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCT
ACAGAGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCT
GGGTCCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCAT
GCTGGCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGA
GCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCG
GGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCG
AGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCA
CGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCC
AGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGAC
CCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCC
TAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACT
TCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATC
CTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAG
TCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGG
CAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGAT
TGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCA
GGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGA
CAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCC
TAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAA
GGGTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGCTCATCCACAGC
CCGTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGAGGGGGCCCAGG
GACTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGTTTATACCCGGG
TCCAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAGTATCTCACTCA
CCCAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAGGGTGTGCATCC
TGCATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCTTCCATGGCACC
CATCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTTGAGCAGTGTCCATCCAGCATCCACGTTTCC
AGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACCGCCCGAGGAGGAGACACA
CAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGAGATGCTGGGTCGCCGGGC
ACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCTGGCAGCAAAGCTGGGAGT
GAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGTCATGGAGACGCTGCAGCG
GCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCAGGCATACATGCAGTACAT
CCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAGCGCCTTCTGCCTGACGCC
CATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCAGCGGGTCTCACTCGAGAT
GGCCACCTTCTCCCCCTGAGTCTTTCACCCTTAGGGTCCTATACAGGGACCCAGGCCTGTGGCTATGGGGGCCCCTCACACAGGGGGAGT
GAAACTTGGCTGGACAGATCATCCTCACTCAGTTCCCTGGTAGCACAGACTGACAGCTGCTCTTGGGCTATAGCTTGGGGCCAAGATGTC
TCACACCCTAGAAGCCTAGGGCTGGGGGAGACAGCCCTGTCTGGGAGGGGGCGTTGGGTGGCCTCTGGTATTTATTTGGCATTTATAAAT

>In-frame_VCL_ENST00000372755_chr10_75758133_+_ZSWIM8_ENST00000604524_chr10_75553346_+_3191nt
GTAGTCGCTGCACAGTCTGTCTCTTCGCCGGTTCCCGGCCCCGTGGATCCTACTTCTCTGTCGCCCGCGGTTCGCCGCCCCGCTCGCCGC
CGCGATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGA
GGGCGAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTT
TGCCTGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCC
ACCCGACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCT
GAGCAAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCT
ACAGAGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCT
GGGTCCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCAT
GCTGGCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGA
GCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCG
GGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCG
AGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCA
CGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCC
AGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGAC
CCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCC
TAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACT
TCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATC
CTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAG
TCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGG
CAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGAT
TGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCA
GGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGA
CAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCC
TAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAA
GGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCAGGGAACAGTGAGCAGTGTCCA
TCCAGCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACC
GCCCGAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGA
GATGCTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCT
GGCAGCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGT
CATGGAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCA
GGCATACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAG
CGCCTTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCA
GCGGGTCTCACTCGAGATGGCCACCTTCTCCCCCTGAGTCTTTCACCCTTAGGGTCCTATACAGGGACCCAGGCCTGTGGCTATGGGGGC
CCCTCACACAGGGGGAGTGAAACTTGGCTGGACAGATCATCCTCACTCAGTTCCCTGGTAGCACAGACTGACAGCTGCTCTTGGGCTATA
GCTTGGGGCCAAGATGTCTCACACCCTAGAAGCCTAGGGCTGGGGGAGACAGCCCTGTCTGGGAGGGGGCGTTGGGTGGCCTCTGGTATT

>In-frame_VCL_ENST00000372755_chr10_75758133_+_ZSWIM8_ENST00000605216_chr10_75553346_+_3736nt
GTAGTCGCTGCACAGTCTGTCTCTTCGCCGGTTCCCGGCCCCGTGGATCCTACTTCTCTGTCGCCCGCGGTTCGCCGCCCCGCTCGCCGC
CGCGATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGA
GGGCGAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTT
TGCCTGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCC
ACCCGACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCT
GAGCAAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCT
ACAGAGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCT
GGGTCCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCAT
GCTGGCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGA
GCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCG
GGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCG
AGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCA
CGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCC
AGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGAC
CCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCC
TAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACT
TCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATC
CTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAG
TCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGG
CAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGAT
TGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCA
GGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGA
CAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCC
TAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAA
GGGTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGCTCATCCACAGC
CCGTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGAGGGGGCCCAGG
GACTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGTTTATACCCGGG
TCCAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAGTATCTCACTCA
CCCAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAGGGTGTGCATCC
TGCATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCTTCCATGGCACC
CATCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCAGGGAACAGTGAGCAG
TGTCCATCCAGCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTT
TCCACCGCCCGAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGC
ACTGGAGATGCTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCT
GGGGCTGGCAGCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGA
GATCGTCATGGAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTG
CCAGCAGGCATACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGC
CCGCAGCGCCTTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCT
GTGGCAGCGGGTCTCACTCGAGATGGCCACCTTCTCCCCCTGAGTCTTTCACCCTTAGGGTCCTATACAGGGACCCAGGCCTGTGGCTAT
GGGGGCCCCTCACACAGGGGGAGTGAAACTTGGCTGGACAGATCATCCTCACTCAGTTCCCTGGTAGCACAGACTGACAGCTGCTCTTGG
GCTATAGCTTGGGGCCAAGATGTCTCACACCCTAGAAGCCTAGGGCTGGGGGAGACAGCCCTGTCTGGGAGGGGGCGTTGGGTGGCCTCT

>In-frame_VCL_ENST00000372755_chr10_75758133_+_ZSWIM8_ENST00000398706_chr10_75553346_+_3751nt
GTAGTCGCTGCACAGTCTGTCTCTTCGCCGGTTCCCGGCCCCGTGGATCCTACTTCTCTGTCGCCCGCGGTTCGCCGCCCCGCTCGCCGC
CGCGATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGA
GGGCGAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTT
TGCCTGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCC
ACCCGACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCT
GAGCAAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCT
ACAGAGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCT
GGGTCCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCAT
GCTGGCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGTGGTTTCTCCCACAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGAC
ACCTGGGGATGAGGAGCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATG
TGAAGGCACACGTCGGGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGA
CAAACTCTTGGACCGAGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAG
GTCTCCTTCAAAGCACGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGT
GGCAGGGGCTGGGCCAGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATC
TGAGGCAGCTTTGACCCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGG
GTCCCCAGGACGGCCTAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTT
AAGCCGGAGACCACTTCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTC
CCTGGGCTCCTCATCCTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGG
CCGCCGCCCCGAGAGTCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCT
GATCAAGGCAGGGGGCAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCT
TTGCGCCTTCGAGATTGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTC
CTGGATTACAGGCCAGGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGT
TGCATCCCTGGCTGACAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGC
CCATGCATTGAACCCTAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGT
GGAAGAGGCAGCTAAGGGTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGG
TGGCTCATCCACAGCCCGTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGG
TAGAGGGGGCCCAGGGACTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTC
TAGTTTATACCCGGGTCCAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCC
TCAGTATCTCACTCACCCAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCC
ACAGGGTGTGCATCCTGCATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGT
TCCTTCCATGGCACCCATCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCA
GGGAACAGTGAGCAGTGTCCATCCAGCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCT
GGTGAGCGGAGGTTTTCCACCGCCCGAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCG
TGTCGGAATGCTGGCACTGGAGATGCTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGA
TGTCAAATGGTTGCTGGGGCTGGCAGCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCC
GTTTGTGCTGCAGGAGATCGTCATGGAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCA
ACTGGTGCAGCGCTGCCAGCAGGCATACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAA
TGCGATCCGGAGTGCCCGCAGCGCCTTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAA
ACAGACCAAGGAGCTGTGGCAGCGGGTCTCACTCGAGATGGCCACCTTCTCCCCCTGAGTCTTTCACCCTTAGGGTCCTATACAGGGACC
CAGGCCTGTGGCTATGGGGGCCCCTCACACAGGGGGAGTGAAACTTGGCTGGACAGATCATCCTCACTCAGTTCCCTGGTAGCACAGACT
GACAGCTGCTCTTGGGCTATAGCTTGGGGCCAAGATGTCTCACACCCTAGAAGCCTAGGGCTGGGGGAGACAGCCCTGTCTGGGAGGGGG

>In-frame_VCL_ENST00000417648_chr10_75758133_+_ZSWIM8_ENST00000604729_chr10_75553346_+_3725nt
AGTCGCTGCACAGTCTGTCTCTTCGCCGGTTCCCGGCCCCGTGGATCCTACTTCTCTGTCGCCCGCGGTTCGCCGCCCCGCTCGCCGCCG
CGATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGG
GCGAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTG
CCTGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCAC
CCGACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGA
GCAAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTAC
AGAGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGG
GTCCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGC
TGGCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGTGGTTTCTCCCACAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACAC
CTGGGGATGAGGAGCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTG
AAGGCACACGTCGGGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACA
AACTCTTGGACCGAGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGT
CTCCTTCAAAGCACGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGG
CAGGGGCTGGGCCAGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTG
AGGCAGCTTTGACCCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGT
CCCCAGGACGGCCTAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAA
GCCGGAGACCACTTCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCC
TGGGCTCCTCATCCTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCC
GCCGCCCCGAGAGTCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGA
TCAAGGCAGGGGGCAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTT
GCGCCTTCGAGATTGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCT
GGATTACAGGCCAGGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTG
CATCCCTGGCTGACAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCC
ATGCATTGAACCCTAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGG
AAGAGGCAGCTAAGGGTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTG
GCTCATCCACAGCCCGTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTA
GAGGGGGCCCAGGGACTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTA
GTTTATACCCGGGTCCAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTC
AGTATCTCACTCACCCAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCAC
AGGGTGTGCATCCTGCATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTC
CTTCCATGGCACCCATCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTTGAGCAGTGTCCATCCAG
CATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACCGCCCG
AGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGAGATGC
TGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCTGGCAG
CAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGTCATGG
AGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCAGGCAT
ACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAGCGCCT
TCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCAGCGGG
TCTCACTCGAGATGGCCACCTTCTCCCCCTGAGTCTTTCACCCTTAGGGTCCTATACAGGGACCCAGGCCTGTGGCTATGGGGGCCCCTC
ACACAGGGGGAGTGAAACTTGGCTGGACAGATCATCCTCACTCAGTTCCCTGGTAGCACAGACTGACAGCTGCTCTTGGGCTATAGCTTG
GGGCCAAGATGTCTCACACCCTAGAAGCCTAGGGCTGGGGGAGACAGCCCTGTCTGGGAGGGGGCGTTGGGTGGCCTCTGGTATTTATTT

>In-frame_VCL_ENST00000417648_chr10_75758133_+_ZSWIM8_ENST00000603114_chr10_75553346_+_3710nt
AGTCGCTGCACAGTCTGTCTCTTCGCCGGTTCCCGGCCCCGTGGATCCTACTTCTCTGTCGCCCGCGGTTCGCCGCCCCGCTCGCCGCCG
CGATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGG
GCGAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTG
CCTGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCAC
CCGACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGA
GCAAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTAC
AGAGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGG
GTCCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGC
TGGCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGAGC
TTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCGGG
AGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCGAG
AGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCACG
GGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCCAG
GCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGACCC
CAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCCTA
AGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACTTC
GAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATCCT
CCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAGTC
ATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGGCA
ACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGATTG
GGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCAGG
CCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGACA
GGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCCTA
ATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAAGG
GTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGCTCATCCACAGCCC
GTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGAGGGGGCCCAGGGA
CTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGTTTATACCCGGGTC
CAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAGTATCTCACTCACC
CAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAGGGTGTGCATCCTG
CATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCTTCCATGGCACCCA
TCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTTGAGCAGTGTCCATCCAGCATCCACGTTTCCAG
CCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACCGCCCGAGGAGGAGACACACA
GTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGAGATGCTGGGTCGCCGGGCAC
ACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCTGGCAGCAAAGCTGGGAGTGA
ACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGTCATGGAGACGCTGCAGCGGC
TGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCAGGCATACATGCAGTACATCC
ACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAGCGCCTTCTGCCTGACGCCCA
TGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCAGCGGGTCTCACTCGAGATGG
CCACCTTCTCCCCCTGAGTCTTTCACCCTTAGGGTCCTATACAGGGACCCAGGCCTGTGGCTATGGGGGCCCCTCACACAGGGGGAGTGA
AACTTGGCTGGACAGATCATCCTCACTCAGTTCCCTGGTAGCACAGACTGACAGCTGCTCTTGGGCTATAGCTTGGGGCCAAGATGTCTC
ACACCCTAGAAGCCTAGGGCTGGGGGAGACAGCCCTGTCTGGGAGGGGGCGTTGGGTGGCCTCTGGTATTTATTTGGCATTTATAAATAT

>In-frame_VCL_ENST00000417648_chr10_75758133_+_ZSWIM8_ENST00000604524_chr10_75553346_+_3189nt
AGTCGCTGCACAGTCTGTCTCTTCGCCGGTTCCCGGCCCCGTGGATCCTACTTCTCTGTCGCCCGCGGTTCGCCGCCCCGCTCGCCGCCG
CGATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGG
GCGAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTG
CCTGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCAC
CCGACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGA
GCAAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTAC
AGAGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGG
GTCCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGC
TGGCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGAGC
TTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCGGG
AGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCGAG
AGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCACG
GGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCCAG
GCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGACCC
CAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCCTA
AGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACTTC
GAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATCCT
CCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAGTC
ATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGGCA
ACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGATTG
GGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCAGG
CCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGACA
GGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCCTA
ATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAAGG
TACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCAGGGAACAGTGAGCAGTGTCCATC
CAGCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTCCACCGC
CCGAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCACTGGAGA
TGCTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGGGGCTGG
CAGCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGATCGTCA
TGGAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCCAGCAGG
CATACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCCGCAGCG
CCTTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGTGGCAGC
GGGTCTCACTCGAGATGGCCACCTTCTCCCCCTGAGTCTTTCACCCTTAGGGTCCTATACAGGGACCCAGGCCTGTGGCTATGGGGGCCC
CTCACACAGGGGGAGTGAAACTTGGCTGGACAGATCATCCTCACTCAGTTCCCTGGTAGCACAGACTGACAGCTGCTCTTGGGCTATAGC
TTGGGGCCAAGATGTCTCACACCCTAGAAGCCTAGGGCTGGGGGAGACAGCCCTGTCTGGGAGGGGGCGTTGGGTGGCCTCTGGTATTTA

>In-frame_VCL_ENST00000417648_chr10_75758133_+_ZSWIM8_ENST00000605216_chr10_75553346_+_3734nt
AGTCGCTGCACAGTCTGTCTCTTCGCCGGTTCCCGGCCCCGTGGATCCTACTTCTCTGTCGCCCGCGGTTCGCCGCCCCGCTCGCCGCCG
CGATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGG
GCGAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTG
CCTGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCAC
CCGACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGA
GCAAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTAC
AGAGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGG
GTCCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGC
TGGCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACACCTGGGGATGAGGAGC
TTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTGAAGGCACACGTCGGG
AGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACAAACTCTTGGACCGAG
AGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGTCTCCTTCAAAGCACG
GGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGGCAGGGGCTGGGCCAG
GCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTGAGGCAGCTTTGACCC
CAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGTCCCCAGGACGGCCTA
AGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAAGCCGGAGACCACTTC
GAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCCTGGGCTCCTCATCCT
CCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCCGCCGCCCCGAGAGTC
ATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGATCAAGGCAGGGGGCA
ACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTTGCGCCTTCGAGATTG
GGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCTGGATTACAGGCCAGG
CCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTGCATCCCTGGCTGACA
GGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCCATGCATTGAACCCTA
ATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGGAAGAGGCAGCTAAGG
GTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTGGCTCATCCACAGCCC
GTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTAGAGGGGGCCCAGGGA
CTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTAGTTTATACCCGGGTC
CAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTCAGTATCTCACTCACC
CAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCACAGGGTGTGCATCCTG
CATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTCCTTCCATGGCACCCA
TCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCAGGGAACAGTGAGCAGTG
TCCATCCAGCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGGTGAGCGGAGGTTTTC
CACCGCCCGAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTGTCGGAATGCTGGCAC
TGGAGATGCTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATGTCAAATGGTTGCTGG
GGCTGGCAGCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGTTTGTGCTGCAGGAGA
TCGTCATGGAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAACTGGTGCAGCGCTGCC
AGCAGGCATACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATGCGATCCGGAGTGCCC
GCAGCGCCTTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAACAGACCAAGGAGCTGT
GGCAGCGGGTCTCACTCGAGATGGCCACCTTCTCCCCCTGAGTCTTTCACCCTTAGGGTCCTATACAGGGACCCAGGCCTGTGGCTATGG
GGGCCCCTCACACAGGGGGAGTGAAACTTGGCTGGACAGATCATCCTCACTCAGTTCCCTGGTAGCACAGACTGACAGCTGCTCTTGGGC
TATAGCTTGGGGCCAAGATGTCTCACACCCTAGAAGCCTAGGGCTGGGGGAGACAGCCCTGTCTGGGAGGGGGCGTTGGGTGGCCTCTGG

>In-frame_VCL_ENST00000417648_chr10_75758133_+_ZSWIM8_ENST00000398706_chr10_75553346_+_3749nt
AGTCGCTGCACAGTCTGTCTCTTCGCCGGTTCCCGGCCCCGTGGATCCTACTTCTCTGTCGCCCGCGGTTCGCCGCCCCGCTCGCCGCCG
CGATGCCAGTGTTTCATACGCGCACGATCGAGAGCATCCTGGAGCCGGTGGCACAGCAGATCTCCCACCTGGTGATAATGCACGAGGAGG
GCGAGGTGGACGGCAAAGCCATTCCTGACCTCACCGCGCCCGTGGCCGCCGTGCAGGCGGCCGTCAGCAACCTCGTCCGGGTACTGTTTG
CCTGTGCTGAGGCCCTGCATGCGCATGGCTATAGCAGTGAGGCCTCCCGTCTCACTGTGGAGCTTGCCCAGGATCTGCTAGCCAACCCAC
CCGACCTCAAGGTAGAGCCGCCCCCTGCCAAGGGCAAGAAGAACAAGGTATCCACGAGCCGTCAGACCTGGGTGGCTACCAACACCCTGA
GCAAGGCGGCCTTCCTGTTGACAGTGCTAAGTGAGCGTCCAGAGCACCACAACCTGGCCTTCCGAGTTGGCATGTTTGCCTTGGAGCTAC
AGAGGCCTCCAGCTTCTACCAAGGCCTTGGAGGTGAAGCTGGCATACCAGGAGTCTGAGGTGGCTGCCCTGCTCAAGAAGATCCCTCTGG
GTCCAAGTGAGATGAGTACCATGCGGTGCCGGGCAGAGGAACTTCGGGAGGGGACACTCTGTGACTATCGGCCTGTGTTGCCTCTCATGC
TGGCCAGTTTCATCTTTGACGTTCTCTGTGCTCCAGTGGTTTCTCCCACAGGTTCCCGGCCCCCAAGTCGCAACTGGAACAGCGAGACAC
CTGGGGATGAGGAGCTTGGATTTGAAGCAGCAGTTGCTGCCTTGGGCATGAAGACAACAGTGAGCGAGGCAGAACATCCCCTCTTATGTG
AAGGCACACGTCGGGAGAAGGGTGACCTGGCATTAGCACTAATGATCACTTACAAGGACGACCAGGCCAAGCTTAAGAAGATCTTAGACA
AACTCTTGGACCGAGAGAGCCAGACACATAAGCCACAGACGCTGAGTTCTTTCTACTCATCTAGCCGCCCAACCACAGCCAGCCAGAGGT
CTCCTTCAAAGCACGGGGGCCCATCTGCCCCAGGGGCCCTGCAACCACTGACCTCAGGCTCTGCAGGGCCTGCTCAACCAGGGAGTGTGG
CAGGGGCTGGGCCAGGCCCCACTGAGGGCTTCACAGAGAAGAATGTGCCTGAGAGTTCCCCACATTCCCCCTGTGAGGGTCTTCCATCTG
AGGCAGCTTTGACCCCAAGGCCAGAAGGGAAGGTTCCTAGCCGCTTGGCACTTGGCAGTCGTGGAGGCTATAATGGACGGGGATGGGGGT
CCCCAGGACGGCCTAAGAAGAAGCACACAGGCATGGCCAGCATTGACAGCAGTGCCCCTGAAACAACATCGGATAGTTCCCCCACCTTAA
GCCGGAGACCACTTCGAGGGGGCTGGGCCCCCACCTCCTGGGGTCGAGGTCAGGACAGTGACAGCATTAGCAGCTCTTCTTCGGACTCCC
TGGGCTCCTCATCCTCCAGTGGAAGTCGCCGGGCCAGTGCCAGTGGAGGAGCCCGGGCGAAGACTGTTGAAGTTGGCAGGTACAAGGGCC
GCCGCCCCGAGAGTCATGCCCCTCATGTACCCAATCAGCCATCAGAGGCAGCTGCACACTTCTACTTCGAGCTGGCGAAGACAGTGCTGA
TCAAGGCAGGGGGCAACAGCAGCACTTCCATTTTCACACATCCATCTTCCTCAGGGGGCCACCAGGGTCCTCACCGCAACCTGCACCTTT
GCGCCTTCGAGATTGGGCTTTATGCCCTTGGCCTGCACAACTTTGTTTCTCCCAACTGGCTCTCACGTACTTATTCTTCCCACGTTTCCT
GGATTACAGGCCAGGCCATGGAGATAGGCAGCGCAGCCCTGACTATACTGGTAGAATGCTGGGATGGGCACCTGACACCCCCTGAGGTTG
CATCCCTGGCTGACAGGGCATCACGGGCAAGAGACTCCAATATGGTGAGGGCGGCAGCAGAGCTGGCCCTGAGCTGCCTGCCTCACGCCC
ATGCATTGAACCCTAATGAGATCCAGCGGGCCCTGGTGCAGTGCAAGGAACAGGACAACCTGATGTTGGAGAAGGCCTGCATGGCAGTGG
AAGAGGCAGCTAAGGGTGGGGGCGTGTACCCTGAAGTGTTGTTTGAGGTTGCTCACCAGTGGTTCTGGCTGTATGAGCAAACTGCAGGTG
GCTCATCCACAGCCCGTGAAGGGGCTACAAGCTGTAGTGCCAGTGGGATCAGGGCAGGTGGGGAAGCTGGGCGGGGTATGCCTGAGGGTA
GAGGGGGCCCAGGGACTGAGCCGGTTACAGTGGCAGCGGCAGCAGTGACAGCAGCAGCCACAGTGGTGCCCGTCATATCGGTGGGGTCTA
GTTTATACCCGGGTCCAGGACTGGGGCATGGCCACTCCCCTGGCCTGCACCCCTACACTGCTCTACAGCCCCACCTGCCCTGTAGCCCTC
AGTATCTCACTCACCCAGCTCACCCTGCCCACCCCATGCCTCACATGCCCCGGCCTGCCGTCTTCCCTGTGCCCAGCTCTGCATACCCAC
AGGGTGTGCATCCTGCATTCCTAGGGGCTCAGTACCCTTATTCAGTGACTCCTCCCTCACTTGCTGCCACTGCTGTGTCTTTCCCCGTTC
CTTCCATGGCACCCATCACAGTACATCCCTACCACACAGAGCCAGGGCTTCCACTGCCCACCAGTGTGGCCTGTGAGTTGTGGGGCCAGG
GAACAGTGAGCAGTGTCCATCCAGCATCCACGTTTCCAGCCATCCAAGGTGCCTCACTGCCTGCCCTGACCACACAGCCCAGCCCTCTGG
TGAGCGGAGGTTTTCCACCGCCCGAGGAGGAGACACACAGTCAGCCAGTCAATCCCCACAGCCTGCACCACCTGCATGCTGCCTACCGTG
TCGGAATGCTGGCACTGGAGATGCTGGGTCGCCGGGCACACAACGATCACCCCAACAACTTCTCCCGCTCCCCCCCCTACACTGATGATG
TCAAATGGTTGCTGGGGCTGGCAGCAAAGCTGGGAGTGAACTACGTGCACCAGTTCTGTGTGGGGGCAGCCAAGGGGGTGCTGAGCCCGT
TTGTGCTGCAGGAGATCGTCATGGAGACGCTGCAGCGGCTGAGTCCCGCTCATGCCCACAACCACCTGCGTGCCCCGGCCTTCCACCAAC
TGGTGCAGCGCTGCCAGCAGGCATACATGCAGTACATCCACCACCGCTTGATTCACCTGACTCCTGCGGACTACGACGACTTTGTGAATG
CGATCCGGAGTGCCCGCAGCGCCTTCTGCCTGACGCCCATGGGCATGATGCAGTTCAACGACATCCTACAGAACCTCAAGCGCAGCAAAC
AGACCAAGGAGCTGTGGCAGCGGGTCTCACTCGAGATGGCCACCTTCTCCCCCTGAGTCTTTCACCCTTAGGGTCCTATACAGGGACCCA
GGCCTGTGGCTATGGGGGCCCCTCACACAGGGGGAGTGAAACTTGGCTGGACAGATCATCCTCACTCAGTTCCCTGGTAGCACAGACTGA
CAGCTGCTCTTGGGCTATAGCTTGGGGCCAAGATGTCTCACACCCTAGAAGCCTAGGGCTGGGGGAGACAGCCCTGTCTGGGAGGGGGCG


Top

FusionGenePPI for VCL_ZSWIM8


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
VCLABI2, C19orf57, TRIP6, CDH1, CTNNB1, PSME1, CORO2B, TGFB1I1, NRAP, PXN, GSN, BCAR1, VASP, SORBS1, SORBS2, CTNNA1, CLTC, DAG1, TUBA1A, SIRT7, CDK2, ITGB1, DNAJC5, TXNL1, SCAF4, URM1, ZC3HAV1L, SVIL, SSU72, SDHAF2, UBR1, VAPB, PGM5, USO1, ATP6V1A, UBA3, TPI1, UFC1, VCP, VCAM1, FN1, PRPF40A, ITGA4, ASNS, CTPS1, ECHS1, EIF5, FERMT2, GINS3, GSS, HSPA5, HSPA9, MSN, PDCD10, PDHA1, PDIA4, PPP1R2, PPP5C, RAP1GDS1, SFN, SNRPF, STK24, TUBB3, UBFD1, DCPS, ERP44, G6PD, GNAI3, ISOC1, PFAS, TBCB, XPO1, YWHAE, YWHAG, YWHAQ, YWHAZ, YWHAH, ASB7, VCL, TEKT1, UNK, PICALM, NTRK1, SELE, EWSR1, FBF1, LPXN, ACTG1, CAPZB, MYO1C, RPS27A, SPTAN1, TLN1, MKNK2, SEC16A, CDCA5, MPDZ, AP3M1, LIMA1, PPHLN1, RBM26, GKAP1, ASCC2, TRIM15, PAK4, FOCAD, TTC21B, UBE2N, HSD17B10, TRIM25, BRCA1ZSWIM8SIRT7, CUL3, ATN1, ATXN1, ATXN1L, NOS2, CSNK1E, AURKA, MRPL4, DCLRE1C, PRG2, NTRK1, CEP128, XPO1, JPH4, ASB3, TULP2, OLFM2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneVCLchr10:75758133chr10:75553346ENST00000211998+122741_764561135ACTN4
HgeneVCLchr10:75758133chr10:75553346ENST00000372755+121741_764561067ACTN4


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for VCL_ZSWIM8


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for VCL_ZSWIM8


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneVCLC1969639Cardiomyopathy, Dilated, 1w2CTD_human;UNIPROT
HgeneVCLC0029456Osteoporosis1CTD_human
HgeneVCLC0948089Acute Coronary Syndrome1CTD_human
HgeneVCLC2750459CARDIOMYOPATHY, FAMILIAL HYPERTROPHIC, 151CTD_human;UNIPROT