FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41375

FusionGeneSummary for VAV2_FNBP1

check button Fusion gene summary
Fusion gene informationFusion gene name: VAV2_FNBP1
Fusion gene ID: 41375
HgeneTgene
Gene symbol

VAV2

FNBP1

Gene ID

7410

23048

Gene namevav guanine nucleotide exchange factor 2formin binding protein 1
SynonymsVAV-2FBP17
Cytomap

9q34.2

9q34.11

Type of geneprotein-codingprotein-coding
Descriptionguanine nucleotide exchange factor VAV2vav 2 guanine nucleotide exchange factorvav 2 oncogeneformin-binding protein 1formin-binding protein 17
Modification date2018051920180529
UniProtAcc

P52735

Q96RU3

Ensembl transtripts involved in fusion geneENST00000406606, ENST00000371850, 
ENST00000371851, ENST00000486113, 
ENST00000446176, ENST00000420781, 
ENST00000355681, ENST00000443566, 
ENST00000478129, 
Fusion gene scores* DoF score11 X 9 X 9=8918 X 10 X 3=240
# samples 1414
** MAII scorelog2(14/891*10)=-2.66999860457696
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(14/240*10)=-0.777607578663552
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: VAV2 [Title/Abstract] AND FNBP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVDLBCTCGA-GS-A9TW-01AVAV2chr9

136857197

-FNBP1chr9

132757237

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000406606ENST00000446176VAV2chr9

136857197

-FNBP1chr9

132757237

-
In-frameENST00000406606ENST00000420781VAV2chr9

136857197

-FNBP1chr9

132757237

-
In-frameENST00000406606ENST00000355681VAV2chr9

136857197

-FNBP1chr9

132757237

-
5CDS-intronENST00000406606ENST00000443566VAV2chr9

136857197

-FNBP1chr9

132757237

-
5CDS-intronENST00000406606ENST00000478129VAV2chr9

136857197

-FNBP1chr9

132757237

-
In-frameENST00000371850ENST00000446176VAV2chr9

136857197

-FNBP1chr9

132757237

-
In-frameENST00000371850ENST00000420781VAV2chr9

136857197

-FNBP1chr9

132757237

-
In-frameENST00000371850ENST00000355681VAV2chr9

136857197

-FNBP1chr9

132757237

-
5CDS-intronENST00000371850ENST00000443566VAV2chr9

136857197

-FNBP1chr9

132757237

-
5CDS-intronENST00000371850ENST00000478129VAV2chr9

136857197

-FNBP1chr9

132757237

-
In-frameENST00000371851ENST00000446176VAV2chr9

136857197

-FNBP1chr9

132757237

-
In-frameENST00000371851ENST00000420781VAV2chr9

136857197

-FNBP1chr9

132757237

-
In-frameENST00000371851ENST00000355681VAV2chr9

136857197

-FNBP1chr9

132757237

-
5CDS-intronENST00000371851ENST00000443566VAV2chr9

136857197

-FNBP1chr9

132757237

-
5CDS-intronENST00000371851ENST00000478129VAV2chr9

136857197

-FNBP1chr9

132757237

-
5UTR-3CDSENST00000486113ENST00000446176VAV2chr9

136857197

-FNBP1chr9

132757237

-
5UTR-3CDSENST00000486113ENST00000420781VAV2chr9

136857197

-FNBP1chr9

132757237

-
5UTR-3CDSENST00000486113ENST00000355681VAV2chr9

136857197

-FNBP1chr9

132757237

-
5UTR-intronENST00000486113ENST00000443566VAV2chr9

136857197

-FNBP1chr9

132757237

-
5UTR-intronENST00000486113ENST00000478129VAV2chr9

136857197

-FNBP1chr9

132757237

-

Top

FusionProtFeatures for VAV2_FNBP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
VAV2

P52735

FNBP1

Q96RU3


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneFNBP1chr9:136857197chr9:132757237ENST00000355681-016398_4908593Coiled coilOntology_term=ECO:0000250
TgeneFNBP1chr9:136857197chr9:132757237ENST00000355681-01667_2598593Coiled coilOntology_term=ECO:0000269
TgeneFNBP1chr9:136857197chr9:132757237ENST00000446176-017398_4908618Coiled coilOntology_term=ECO:0000250
TgeneFNBP1chr9:136857197chr9:132757237ENST00000446176-01767_2598618Coiled coilOntology_term=ECO:0000269
TgeneFNBP1chr9:136857197chr9:132757237ENST00000355681-016340_3458593Compositional biasNote=Poly-Pro
TgeneFNBP1chr9:136857197chr9:132757237ENST00000446176-017340_3458618Compositional biasNote=Poly-Pro
TgeneFNBP1chr9:136857197chr9:132757237ENST00000355681-016404_4818593DomainREM-1
TgeneFNBP1chr9:136857197chr9:132757237ENST00000355681-016550_6118593DomainSH3
TgeneFNBP1chr9:136857197chr9:132757237ENST00000446176-017404_4818618DomainREM-1
TgeneFNBP1chr9:136857197chr9:132757237ENST00000446176-017550_6118618DomainSH3
TgeneFNBP1chr9:136857197chr9:132757237ENST00000355681-016251_6178593RegionNote=Required for self-association and induction of membrane tubulation
TgeneFNBP1chr9:136857197chr9:132757237ENST00000446176-017251_6178618RegionNote=Required for self-association and induction of membrane tubulation

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneVAV2chr9:136857197chr9:132757237ENST00000371850-130198_37668879DomainDH
HgeneVAV2chr9:136857197chr9:132757237ENST00000371850-1301_12068879DomainCalponin-homology (CH)
HgeneVAV2chr9:136857197chr9:132757237ENST00000371850-130405_51268879DomainPH
HgeneVAV2chr9:136857197chr9:132757237ENST00000371850-130586_65268879DomainSH3 1
HgeneVAV2chr9:136857197chr9:132757237ENST00000371850-130673_76768879DomainSH2
HgeneVAV2chr9:136857197chr9:132757237ENST00000371850-130816_87768879DomainSH3 2
HgeneVAV2chr9:136857197chr9:132757237ENST00000371851-128198_37668869DomainDH
HgeneVAV2chr9:136857197chr9:132757237ENST00000371851-1281_12068869DomainCalponin-homology (CH)
HgeneVAV2chr9:136857197chr9:132757237ENST00000371851-128405_51268869DomainPH
HgeneVAV2chr9:136857197chr9:132757237ENST00000371851-128586_65268869DomainSH3 1
HgeneVAV2chr9:136857197chr9:132757237ENST00000371851-128673_76768869DomainSH2
HgeneVAV2chr9:136857197chr9:132757237ENST00000371851-128816_87768869DomainSH3 2
HgeneVAV2chr9:136857197chr9:132757237ENST00000406606-127198_37668840DomainDH
HgeneVAV2chr9:136857197chr9:132757237ENST00000406606-1271_12068840DomainCalponin-homology (CH)
HgeneVAV2chr9:136857197chr9:132757237ENST00000406606-127405_51268840DomainPH
HgeneVAV2chr9:136857197chr9:132757237ENST00000406606-127586_65268840DomainSH3 1
HgeneVAV2chr9:136857197chr9:132757237ENST00000406606-127673_76768840DomainSH2
HgeneVAV2chr9:136857197chr9:132757237ENST00000406606-127816_87768840DomainSH3 2
HgeneVAV2chr9:136857197chr9:132757237ENST00000371850-130523_57268879Zinc fingerPhorbol-ester/DAG-type
HgeneVAV2chr9:136857197chr9:132757237ENST00000371851-128523_57268869Zinc fingerPhorbol-ester/DAG-type
HgeneVAV2chr9:136857197chr9:132757237ENST00000406606-127523_57268840Zinc fingerPhorbol-ester/DAG-type
TgeneFNBP1chr9:136857197chr9:132757237ENST00000355681-0161_2648593DomainF-BAR
TgeneFNBP1chr9:136857197chr9:132757237ENST00000446176-0171_2648618DomainF-BAR
TgeneFNBP1chr9:136857197chr9:132757237ENST00000355681-0161_798593RegionNote=Required for self-association and induction of membrane tubulation
TgeneFNBP1chr9:136857197chr9:132757237ENST00000446176-0171_798618RegionNote=Required for self-association and induction of membrane tubulation


Top

FusionGeneSequence for VAV2_FNBP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_VAV2_ENST00000406606_chr9_136857197_-_FNBP1_ENST00000446176_chr9_132757237_-_678aa
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQDQFDNLEKHTQWGIDILEKTIK
FVKERTEIELSTAKQLRNLSKKYQPKKNSKEEEEYKTTSCKAFISNLNEMNDYAGQHEVISENMASQIIVDLARTVQELKQERKSNFHDG
RKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDSKADYSSILQKFNHEQHETYHTHIP
NIFQKIQEMEERRIVRMGESMKTTAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIEATKSGFEPPGDIEFEDYTQPMKRTVSDNSL
SNSRGEGKPDLKFGGKSKGKLWPFIKKNKLMSLLTSPHQPPPPPPASASPSAVPNGPQSPKQQKEPLSHRFNEFMTSKPKIHCFRSLKRG
LSLKLGATPEDFSNLPPEQRRKKLQQKVDELNKEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVSQNIEKLRVETQKFEAWLA
EVEGRLPARSEQARRQSGLYDSQNPPTVNNCAQDRESPDGSYTEEQSQESEMKVLATDFDDEFDDEEPLPAIGTCKALYTFEGQNEGTIS

>In-frame_VAV2_ENST00000406606_chr9_136857197_-_FNBP1_ENST00000420781_chr9_132757237_-_669aa
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQDQFDNLEKHTQWGIDILEKTIK
FVKERTEIELSTAKQLRNLSKKYQPKKNSKEEEEYKTTSCKAFISNLNEMNDYAGQHEVISENMASQIIVDLARTVQELKQERKSNFHDG
RKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDSKADYSSILQKFNHEQHETYHTHIP
NIFQKIQEMEERRIVRMGESMKTTAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIEATKSGFEPPGDIEFEDYTQPMKRTVSDNSL
SNSRGEGKPDLKFGGKSKGKLWPFIKKNKPPPPPPASASPSAVPNGPQSPKQQKEPLSHRFNEFMTSKPKIHCFRSLKRGHSLTLQGATP
EDFSNLPPEQRRKKLQQKVDELNKEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVSQNIEKLRVETQKFEAWLAEVEGRLPAR
SEQARRQSGLYDSQNPPTVNNCAQDRESPDGSYTEEQSQESEMKVLATDFDDEFDDEEPLPAIGTCKALYTFEGQNEGTISVVEGETLTV

>In-frame_VAV2_ENST00000406606_chr9_136857197_-_FNBP1_ENST00000355681_chr9_132757237_-_653aa
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQDQFDNLEKHTQWGIDILEKTIK
FVKERTEIELSTAKQLRNLSKKYQPKKNSKEEEEYKTTSCKAFISNLNEMNDYAGQHEVISENMASQIIVDLARTVQELKQERKSNFHDG
RKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDSKADYSSILQKFNHEQHETYHTHIP
NIFQKIQEMEERRIVRMGESMKTTAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIEATKSGFEPPGDIEFEDYTQPMKRTVSDNSL
SNSRGEGKPDLKFGGKSKGKLWPFIKKNKSPKQQKEPLSHRFNEFMTSKPKIHCFRSLKRGLSLKLGATPEDFSNLPPEQRRKKLQQKVD
ELNKEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVSQNIEKLRVETQKFEAWLAEVEGRLPARSEQARRQSGLYDSQNPPTVN
NCAQDRESPDGSYTEEQSQESEMKVLATDFDDEFDDEEPLPAIGTCKALYTFEGQNEGTISVVEGETLTVIEEDKGDGWTRIRRNEDEEG

>In-frame_VAV2_ENST00000371850_chr9_136857197_-_FNBP1_ENST00000446176_chr9_132757237_-_678aa
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQDQFDNLEKHTQWGIDILEKTIK
FVKERTEIELSTAKQLRNLSKKYQPKKNSKEEEEYKTTSCKAFISNLNEMNDYAGQHEVISENMASQIIVDLARTVQELKQERKSNFHDG
RKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDSKADYSSILQKFNHEQHETYHTHIP
NIFQKIQEMEERRIVRMGESMKTTAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIEATKSGFEPPGDIEFEDYTQPMKRTVSDNSL
SNSRGEGKPDLKFGGKSKGKLWPFIKKNKLMSLLTSPHQPPPPPPASASPSAVPNGPQSPKQQKEPLSHRFNEFMTSKPKIHCFRSLKRG
LSLKLGATPEDFSNLPPEQRRKKLQQKVDELNKEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVSQNIEKLRVETQKFEAWLA
EVEGRLPARSEQARRQSGLYDSQNPPTVNNCAQDRESPDGSYTEEQSQESEMKVLATDFDDEFDDEEPLPAIGTCKALYTFEGQNEGTIS

>In-frame_VAV2_ENST00000371850_chr9_136857197_-_FNBP1_ENST00000420781_chr9_132757237_-_669aa
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQDQFDNLEKHTQWGIDILEKTIK
FVKERTEIELSTAKQLRNLSKKYQPKKNSKEEEEYKTTSCKAFISNLNEMNDYAGQHEVISENMASQIIVDLARTVQELKQERKSNFHDG
RKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDSKADYSSILQKFNHEQHETYHTHIP
NIFQKIQEMEERRIVRMGESMKTTAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIEATKSGFEPPGDIEFEDYTQPMKRTVSDNSL
SNSRGEGKPDLKFGGKSKGKLWPFIKKNKPPPPPPASASPSAVPNGPQSPKQQKEPLSHRFNEFMTSKPKIHCFRSLKRGHSLTLQGATP
EDFSNLPPEQRRKKLQQKVDELNKEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVSQNIEKLRVETQKFEAWLAEVEGRLPAR
SEQARRQSGLYDSQNPPTVNNCAQDRESPDGSYTEEQSQESEMKVLATDFDDEFDDEEPLPAIGTCKALYTFEGQNEGTISVVEGETLTV

>In-frame_VAV2_ENST00000371850_chr9_136857197_-_FNBP1_ENST00000355681_chr9_132757237_-_653aa
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQDQFDNLEKHTQWGIDILEKTIK
FVKERTEIELSTAKQLRNLSKKYQPKKNSKEEEEYKTTSCKAFISNLNEMNDYAGQHEVISENMASQIIVDLARTVQELKQERKSNFHDG
RKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDSKADYSSILQKFNHEQHETYHTHIP
NIFQKIQEMEERRIVRMGESMKTTAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIEATKSGFEPPGDIEFEDYTQPMKRTVSDNSL
SNSRGEGKPDLKFGGKSKGKLWPFIKKNKSPKQQKEPLSHRFNEFMTSKPKIHCFRSLKRGLSLKLGATPEDFSNLPPEQRRKKLQQKVD
ELNKEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVSQNIEKLRVETQKFEAWLAEVEGRLPARSEQARRQSGLYDSQNPPTVN
NCAQDRESPDGSYTEEQSQESEMKVLATDFDDEFDDEEPLPAIGTCKALYTFEGQNEGTISVVEGETLTVIEEDKGDGWTRIRRNEDEEG

>In-frame_VAV2_ENST00000371851_chr9_136857197_-_FNBP1_ENST00000446176_chr9_132757237_-_678aa
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQDQFDNLEKHTQWGIDILEKTIK
FVKERTEIELSTAKQLRNLSKKYQPKKNSKEEEEYKTTSCKAFISNLNEMNDYAGQHEVISENMASQIIVDLARTVQELKQERKSNFHDG
RKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDSKADYSSILQKFNHEQHETYHTHIP
NIFQKIQEMEERRIVRMGESMKTTAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIEATKSGFEPPGDIEFEDYTQPMKRTVSDNSL
SNSRGEGKPDLKFGGKSKGKLWPFIKKNKLMSLLTSPHQPPPPPPASASPSAVPNGPQSPKQQKEPLSHRFNEFMTSKPKIHCFRSLKRG
LSLKLGATPEDFSNLPPEQRRKKLQQKVDELNKEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVSQNIEKLRVETQKFEAWLA
EVEGRLPARSEQARRQSGLYDSQNPPTVNNCAQDRESPDGSYTEEQSQESEMKVLATDFDDEFDDEEPLPAIGTCKALYTFEGQNEGTIS

>In-frame_VAV2_ENST00000371851_chr9_136857197_-_FNBP1_ENST00000420781_chr9_132757237_-_669aa
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQDQFDNLEKHTQWGIDILEKTIK
FVKERTEIELSTAKQLRNLSKKYQPKKNSKEEEEYKTTSCKAFISNLNEMNDYAGQHEVISENMASQIIVDLARTVQELKQERKSNFHDG
RKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDSKADYSSILQKFNHEQHETYHTHIP
NIFQKIQEMEERRIVRMGESMKTTAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIEATKSGFEPPGDIEFEDYTQPMKRTVSDNSL
SNSRGEGKPDLKFGGKSKGKLWPFIKKNKPPPPPPASASPSAVPNGPQSPKQQKEPLSHRFNEFMTSKPKIHCFRSLKRGHSLTLQGATP
EDFSNLPPEQRRKKLQQKVDELNKEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVSQNIEKLRVETQKFEAWLAEVEGRLPAR
SEQARRQSGLYDSQNPPTVNNCAQDRESPDGSYTEEQSQESEMKVLATDFDDEFDDEEPLPAIGTCKALYTFEGQNEGTISVVEGETLTV

>In-frame_VAV2_ENST00000371851_chr9_136857197_-_FNBP1_ENST00000355681_chr9_132757237_-_653aa
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQDQFDNLEKHTQWGIDILEKTIK
FVKERTEIELSTAKQLRNLSKKYQPKKNSKEEEEYKTTSCKAFISNLNEMNDYAGQHEVISENMASQIIVDLARTVQELKQERKSNFHDG
RKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDSKADYSSILQKFNHEQHETYHTHIP
NIFQKIQEMEERRIVRMGESMKTTAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIEATKSGFEPPGDIEFEDYTQPMKRTVSDNSL
SNSRGEGKPDLKFGGKSKGKLWPFIKKNKSPKQQKEPLSHRFNEFMTSKPKIHCFRSLKRGLSLKLGATPEDFSNLPPEQRRKKLQQKVD
ELNKEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVSQNIEKLRVETQKFEAWLAEVEGRLPARSEQARRQSGLYDSQNPPTVN
NCAQDRESPDGSYTEEQSQESEMKVLATDFDDEFDDEEPLPAIGTCKALYTFEGQNEGTISVVEGETLTVIEEDKGDGWTRIRRNEDEEG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_VAV2_ENST00000406606_chr9_136857197_-_FNBP1_ENST00000446176_chr9_132757237_-_2034nt
ATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCATCGATTGCAAGGTCCTGCCGCCCAACCACCGGGTGGTGTGGCCCTCGGCCGTGGTC
TTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCCTTCTGTGCCAGCTGCTGCACAACCTCTCCCCCGGCTCCATCGACCTCAAGGACATC
AACTTCCGGCCGCAGATGTCCCAGGATCAGTTTGACAACTTAGAAAAACACACACAGTGGGGAATTGATATTCTTGAGAAATATATCAAG
TTTGTGAAAGAAAGGACAGAGATTGAACTCAGCTATGCAAAGCAACTCAGGAATCTTTCAAAGAAGTACCAACCTAAAAAGAACTCGAAG
GAGGAAGAAGAATACAAGTATACGTCATGTAAAGCTTTCATTTCCAACCTGAACGAAATGAATGATTACGCAGGGCAGCATGAAGTTATC
TCCGAGAACATGGCATCACAGATCATTGTGGACTTGGCACGCTATGTTCAGGAACTGAAACAGGAGAGGAAATCAAACTTTCACGATGGC
CGTAAAGCACAGCAGCACATCGAGACTTGCTGGAAGCAGCTTGAATCTAGTAAAAGGCGATTTGAACGCGATTGCAAAGAGGCGGACAGG
GCGCAGCAGTACTTTGAGAAAATGGACGCTGACATCAATGTCACAAAAGCGGATGTTGAAAAGGCCCGACAACAAGCTCAAATACGTCAC
CAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATCCCC
AACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGGCAG
GTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATAGAA
GCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGCCTT
TCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAGCTT
ATGTCCCTTTTAACATCCCCCCATCAGCCTCCCCCTCCCCCTCCTGCCTCTGCCTCACCCTCTGCTGTTCCCAACGGCCCCCAGTCTCCC
AAGCAGCAAAAGGAACCCCTCTCCCATCGCTTCAACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGTGGG
CTTTCTCTCAAGCTGGGTGCAACACCGGAGGATTTCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCGATGAG
TTAAATAAAGAAATTCAGAAGGAGATGGATCAAAGAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATGGGAGAC
CCAGCCAGTTTGGATCACAAATTAGCAGAAGTCAGCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGCTGGCT
GAGGTTGAAGGCCGGCTCCCAGCACGCAGCGAGCAGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTCAACAAC
TGCGCCCAGGACCGTGAGAGCCCAGATGGCAGTTACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATTTTGAC
GACGAGTTTGATGATGAGGAGCCCCTCCCTGCCATAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACGATTTCC
GTAGTTGAAGGAGAAACATTGTATGTCATAGAGGAAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGGGTTAT

>In-frame_VAV2_ENST00000406606_chr9_136857197_-_FNBP1_ENST00000420781_chr9_132757237_-_2007nt
ATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCATCGATTGCAAGGTCCTGCCGCCCAACCACCGGGTGGTGTGGCCCTCGGCCGTGGTC
TTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCCTTCTGTGCCAGCTGCTGCACAACCTCTCCCCCGGCTCCATCGACCTCAAGGACATC
AACTTCCGGCCGCAGATGTCCCAGGATCAGTTTGACAACTTAGAAAAACACACACAGTGGGGAATTGATATTCTTGAGAAATATATCAAG
TTTGTGAAAGAAAGGACAGAGATTGAACTCAGCTATGCAAAGCAACTCAGGAATCTTTCAAAGAAGTACCAACCTAAAAAGAACTCGAAG
GAGGAAGAAGAATACAAGTATACGTCATGTAAAGCTTTCATTTCCAACCTGAACGAAATGAATGATTACGCAGGGCAGCATGAAGTTATC
TCCGAGAACATGGCATCACAGATCATTGTGGACTTGGCACGCTATGTTCAGGAACTGAAACAGGAGAGGAAATCAAACTTTCACGATGGC
CGTAAAGCACAGCAGCACATCGAGACTTGCTGGAAGCAGCTTGAATCTAGTAAAAGGCGATTTGAACGCGATTGCAAAGAGGCGGACAGG
GCGCAGCAGTACTTTGAGAAAATGGACGCTGACATCAATGTCACAAAAGCGGATGTTGAAAAGGCCCGACAACAAGCTCAAATACGTCAC
CAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATCCCC
AACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGGCAG
GTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATAGAA
GCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGCCTT
TCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAGCCT
CCCCCTCCCCCTCCTGCCTCTGCCTCACCCTCTGCTGTTCCCAACGGCCCCCAGTCTCCCAAGCAGCAAAAGGAACCCCTCTCCCATCGC
TTCAACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGTGGGCATAGCCTCACTCTGCAGGGTGCAACACCG
GAGGATTTCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCGATGAGTTAAATAAAGAAATTCAGAAGGAGATG
GATCAAAGAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATGGGAGACCCAGCCAGTTTGGATCACAAATTAGCA
GAAGTCAGCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGCTGGCTGAGGTTGAAGGCCGGCTCCCAGCACGC
AGCGAGCAGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTCAACAACTGCGCCCAGGACCGTGAGAGCCCAGAT
GGCAGTTACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATTTTGACGACGAGTTTGATGATGAGGAGCCCCTC
CCTGCCATAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACGATTTCCGTAGTTGAAGGAGAAACATTGTATGTC
ATAGAGGAAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGGGTTATGTCCCCACTTCATATGTCGAAGTCTGT

>In-frame_VAV2_ENST00000406606_chr9_136857197_-_FNBP1_ENST00000355681_chr9_132757237_-_1959nt
ATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCATCGATTGCAAGGTCCTGCCGCCCAACCACCGGGTGGTGTGGCCCTCGGCCGTGGTC
TTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCCTTCTGTGCCAGCTGCTGCACAACCTCTCCCCCGGCTCCATCGACCTCAAGGACATC
AACTTCCGGCCGCAGATGTCCCAGGATCAGTTTGACAACTTAGAAAAACACACACAGTGGGGAATTGATATTCTTGAGAAATATATCAAG
TTTGTGAAAGAAAGGACAGAGATTGAACTCAGCTATGCAAAGCAACTCAGGAATCTTTCAAAGAAGTACCAACCTAAAAAGAACTCGAAG
GAGGAAGAAGAATACAAGTATACGTCATGTAAAGCTTTCATTTCCAACCTGAACGAAATGAATGATTACGCAGGGCAGCATGAAGTTATC
TCCGAGAACATGGCATCACAGATCATTGTGGACTTGGCACGCTATGTTCAGGAACTGAAACAGGAGAGGAAATCAAACTTTCACGATGGC
CGTAAAGCACAGCAGCACATCGAGACTTGCTGGAAGCAGCTTGAATCTAGTAAAAGGCGATTTGAACGCGATTGCAAAGAGGCGGACAGG
GCGCAGCAGTACTTTGAGAAAATGGACGCTGACATCAATGTCACAAAAGCGGATGTTGAAAAGGCCCGACAACAAGCTCAAATACGTCAC
CAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATCCCC
AACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGGCAG
GTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATAGAA
GCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGCCTT
TCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAGTCT
CCCAAGCAGCAAAAGGAACCCCTCTCCCATCGCTTCAACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGT
GGGCTTTCTCTCAAGCTGGGTGCAACACCGGAGGATTTCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCGAT
GAGTTAAATAAAGAAATTCAGAAGGAGATGGATCAAAGAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATGGGA
GACCCAGCCAGTTTGGATCACAAATTAGCAGAAGTCAGCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGCTG
GCTGAGGTTGAAGGCCGGCTCCCAGCACGCAGCGAGCAGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTCAAC
AACTGCGCCCAGGACCGTGAGAGCCCAGATGGCAGTTACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATTTT
GACGACGAGTTTGATGATGAGGAGCCCCTCCCTGCCATAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACGATT
TCCGTAGTTGAAGGAGAAACATTGTATGTCATAGAGGAAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGGGT

>In-frame_VAV2_ENST00000371850_chr9_136857197_-_FNBP1_ENST00000446176_chr9_132757237_-_2034nt
ATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCATCGATTGCAAGGTCCTGCCGCCCAACCACCGGGTGGTGTGGCCCTCGGCCGTGGTC
TTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCCTTCTGTGCCAGCTGCTGCACAACCTCTCCCCCGGCTCCATCGACCTCAAGGACATC
AACTTCCGGCCGCAGATGTCCCAGGATCAGTTTGACAACTTAGAAAAACACACACAGTGGGGAATTGATATTCTTGAGAAATATATCAAG
TTTGTGAAAGAAAGGACAGAGATTGAACTCAGCTATGCAAAGCAACTCAGGAATCTTTCAAAGAAGTACCAACCTAAAAAGAACTCGAAG
GAGGAAGAAGAATACAAGTATACGTCATGTAAAGCTTTCATTTCCAACCTGAACGAAATGAATGATTACGCAGGGCAGCATGAAGTTATC
TCCGAGAACATGGCATCACAGATCATTGTGGACTTGGCACGCTATGTTCAGGAACTGAAACAGGAGAGGAAATCAAACTTTCACGATGGC
CGTAAAGCACAGCAGCACATCGAGACTTGCTGGAAGCAGCTTGAATCTAGTAAAAGGCGATTTGAACGCGATTGCAAAGAGGCGGACAGG
GCGCAGCAGTACTTTGAGAAAATGGACGCTGACATCAATGTCACAAAAGCGGATGTTGAAAAGGCCCGACAACAAGCTCAAATACGTCAC
CAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATCCCC
AACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGGCAG
GTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATAGAA
GCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGCCTT
TCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAGCTT
ATGTCCCTTTTAACATCCCCCCATCAGCCTCCCCCTCCCCCTCCTGCCTCTGCCTCACCCTCTGCTGTTCCCAACGGCCCCCAGTCTCCC
AAGCAGCAAAAGGAACCCCTCTCCCATCGCTTCAACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGTGGG
CTTTCTCTCAAGCTGGGTGCAACACCGGAGGATTTCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCGATGAG
TTAAATAAAGAAATTCAGAAGGAGATGGATCAAAGAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATGGGAGAC
CCAGCCAGTTTGGATCACAAATTAGCAGAAGTCAGCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGCTGGCT
GAGGTTGAAGGCCGGCTCCCAGCACGCAGCGAGCAGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTCAACAAC
TGCGCCCAGGACCGTGAGAGCCCAGATGGCAGTTACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATTTTGAC
GACGAGTTTGATGATGAGGAGCCCCTCCCTGCCATAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACGATTTCC
GTAGTTGAAGGAGAAACATTGTATGTCATAGAGGAAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGGGTTAT

>In-frame_VAV2_ENST00000371850_chr9_136857197_-_FNBP1_ENST00000420781_chr9_132757237_-_2007nt
ATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCATCGATTGCAAGGTCCTGCCGCCCAACCACCGGGTGGTGTGGCCCTCGGCCGTGGTC
TTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCCTTCTGTGCCAGCTGCTGCACAACCTCTCCCCCGGCTCCATCGACCTCAAGGACATC
AACTTCCGGCCGCAGATGTCCCAGGATCAGTTTGACAACTTAGAAAAACACACACAGTGGGGAATTGATATTCTTGAGAAATATATCAAG
TTTGTGAAAGAAAGGACAGAGATTGAACTCAGCTATGCAAAGCAACTCAGGAATCTTTCAAAGAAGTACCAACCTAAAAAGAACTCGAAG
GAGGAAGAAGAATACAAGTATACGTCATGTAAAGCTTTCATTTCCAACCTGAACGAAATGAATGATTACGCAGGGCAGCATGAAGTTATC
TCCGAGAACATGGCATCACAGATCATTGTGGACTTGGCACGCTATGTTCAGGAACTGAAACAGGAGAGGAAATCAAACTTTCACGATGGC
CGTAAAGCACAGCAGCACATCGAGACTTGCTGGAAGCAGCTTGAATCTAGTAAAAGGCGATTTGAACGCGATTGCAAAGAGGCGGACAGG
GCGCAGCAGTACTTTGAGAAAATGGACGCTGACATCAATGTCACAAAAGCGGATGTTGAAAAGGCCCGACAACAAGCTCAAATACGTCAC
CAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATCCCC
AACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGGCAG
GTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATAGAA
GCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGCCTT
TCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAGCCT
CCCCCTCCCCCTCCTGCCTCTGCCTCACCCTCTGCTGTTCCCAACGGCCCCCAGTCTCCCAAGCAGCAAAAGGAACCCCTCTCCCATCGC
TTCAACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGTGGGCATAGCCTCACTCTGCAGGGTGCAACACCG
GAGGATTTCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCGATGAGTTAAATAAAGAAATTCAGAAGGAGATG
GATCAAAGAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATGGGAGACCCAGCCAGTTTGGATCACAAATTAGCA
GAAGTCAGCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGCTGGCTGAGGTTGAAGGCCGGCTCCCAGCACGC
AGCGAGCAGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTCAACAACTGCGCCCAGGACCGTGAGAGCCCAGAT
GGCAGTTACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATTTTGACGACGAGTTTGATGATGAGGAGCCCCTC
CCTGCCATAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACGATTTCCGTAGTTGAAGGAGAAACATTGTATGTC
ATAGAGGAAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGGGTTATGTCCCCACTTCATATGTCGAAGTCTGT

>In-frame_VAV2_ENST00000371850_chr9_136857197_-_FNBP1_ENST00000355681_chr9_132757237_-_1959nt
ATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCATCGATTGCAAGGTCCTGCCGCCCAACCACCGGGTGGTGTGGCCCTCGGCCGTGGTC
TTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCCTTCTGTGCCAGCTGCTGCACAACCTCTCCCCCGGCTCCATCGACCTCAAGGACATC
AACTTCCGGCCGCAGATGTCCCAGGATCAGTTTGACAACTTAGAAAAACACACACAGTGGGGAATTGATATTCTTGAGAAATATATCAAG
TTTGTGAAAGAAAGGACAGAGATTGAACTCAGCTATGCAAAGCAACTCAGGAATCTTTCAAAGAAGTACCAACCTAAAAAGAACTCGAAG
GAGGAAGAAGAATACAAGTATACGTCATGTAAAGCTTTCATTTCCAACCTGAACGAAATGAATGATTACGCAGGGCAGCATGAAGTTATC
TCCGAGAACATGGCATCACAGATCATTGTGGACTTGGCACGCTATGTTCAGGAACTGAAACAGGAGAGGAAATCAAACTTTCACGATGGC
CGTAAAGCACAGCAGCACATCGAGACTTGCTGGAAGCAGCTTGAATCTAGTAAAAGGCGATTTGAACGCGATTGCAAAGAGGCGGACAGG
GCGCAGCAGTACTTTGAGAAAATGGACGCTGACATCAATGTCACAAAAGCGGATGTTGAAAAGGCCCGACAACAAGCTCAAATACGTCAC
CAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATCCCC
AACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGGCAG
GTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATAGAA
GCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGCCTT
TCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAGTCT
CCCAAGCAGCAAAAGGAACCCCTCTCCCATCGCTTCAACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGT
GGGCTTTCTCTCAAGCTGGGTGCAACACCGGAGGATTTCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCGAT
GAGTTAAATAAAGAAATTCAGAAGGAGATGGATCAAAGAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATGGGA
GACCCAGCCAGTTTGGATCACAAATTAGCAGAAGTCAGCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGCTG
GCTGAGGTTGAAGGCCGGCTCCCAGCACGCAGCGAGCAGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTCAAC
AACTGCGCCCAGGACCGTGAGAGCCCAGATGGCAGTTACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATTTT
GACGACGAGTTTGATGATGAGGAGCCCCTCCCTGCCATAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACGATT
TCCGTAGTTGAAGGAGAAACATTGTATGTCATAGAGGAAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGGGT

>In-frame_VAV2_ENST00000371851_chr9_136857197_-_FNBP1_ENST00000446176_chr9_132757237_-_2034nt
ATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCATCGATTGCAAGGTCCTGCCGCCCAACCACCGGGTGGTGTGGCCCTCGGCCGTGGTC
TTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCCTTCTGTGCCAGCTGCTGCACAACCTCTCCCCCGGCTCCATCGACCTCAAGGACATC
AACTTCCGGCCGCAGATGTCCCAGGATCAGTTTGACAACTTAGAAAAACACACACAGTGGGGAATTGATATTCTTGAGAAATATATCAAG
TTTGTGAAAGAAAGGACAGAGATTGAACTCAGCTATGCAAAGCAACTCAGGAATCTTTCAAAGAAGTACCAACCTAAAAAGAACTCGAAG
GAGGAAGAAGAATACAAGTATACGTCATGTAAAGCTTTCATTTCCAACCTGAACGAAATGAATGATTACGCAGGGCAGCATGAAGTTATC
TCCGAGAACATGGCATCACAGATCATTGTGGACTTGGCACGCTATGTTCAGGAACTGAAACAGGAGAGGAAATCAAACTTTCACGATGGC
CGTAAAGCACAGCAGCACATCGAGACTTGCTGGAAGCAGCTTGAATCTAGTAAAAGGCGATTTGAACGCGATTGCAAAGAGGCGGACAGG
GCGCAGCAGTACTTTGAGAAAATGGACGCTGACATCAATGTCACAAAAGCGGATGTTGAAAAGGCCCGACAACAAGCTCAAATACGTCAC
CAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATCCCC
AACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGGCAG
GTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATAGAA
GCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGCCTT
TCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAGCTT
ATGTCCCTTTTAACATCCCCCCATCAGCCTCCCCCTCCCCCTCCTGCCTCTGCCTCACCCTCTGCTGTTCCCAACGGCCCCCAGTCTCCC
AAGCAGCAAAAGGAACCCCTCTCCCATCGCTTCAACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGTGGG
CTTTCTCTCAAGCTGGGTGCAACACCGGAGGATTTCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCGATGAG
TTAAATAAAGAAATTCAGAAGGAGATGGATCAAAGAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATGGGAGAC
CCAGCCAGTTTGGATCACAAATTAGCAGAAGTCAGCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGCTGGCT
GAGGTTGAAGGCCGGCTCCCAGCACGCAGCGAGCAGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTCAACAAC
TGCGCCCAGGACCGTGAGAGCCCAGATGGCAGTTACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATTTTGAC
GACGAGTTTGATGATGAGGAGCCCCTCCCTGCCATAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACGATTTCC
GTAGTTGAAGGAGAAACATTGTATGTCATAGAGGAAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGGGTTAT

>In-frame_VAV2_ENST00000371851_chr9_136857197_-_FNBP1_ENST00000420781_chr9_132757237_-_2007nt
ATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCATCGATTGCAAGGTCCTGCCGCCCAACCACCGGGTGGTGTGGCCCTCGGCCGTGGTC
TTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCCTTCTGTGCCAGCTGCTGCACAACCTCTCCCCCGGCTCCATCGACCTCAAGGACATC
AACTTCCGGCCGCAGATGTCCCAGGATCAGTTTGACAACTTAGAAAAACACACACAGTGGGGAATTGATATTCTTGAGAAATATATCAAG
TTTGTGAAAGAAAGGACAGAGATTGAACTCAGCTATGCAAAGCAACTCAGGAATCTTTCAAAGAAGTACCAACCTAAAAAGAACTCGAAG
GAGGAAGAAGAATACAAGTATACGTCATGTAAAGCTTTCATTTCCAACCTGAACGAAATGAATGATTACGCAGGGCAGCATGAAGTTATC
TCCGAGAACATGGCATCACAGATCATTGTGGACTTGGCACGCTATGTTCAGGAACTGAAACAGGAGAGGAAATCAAACTTTCACGATGGC
CGTAAAGCACAGCAGCACATCGAGACTTGCTGGAAGCAGCTTGAATCTAGTAAAAGGCGATTTGAACGCGATTGCAAAGAGGCGGACAGG
GCGCAGCAGTACTTTGAGAAAATGGACGCTGACATCAATGTCACAAAAGCGGATGTTGAAAAGGCCCGACAACAAGCTCAAATACGTCAC
CAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATCCCC
AACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGGCAG
GTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATAGAA
GCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGCCTT
TCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAGCCT
CCCCCTCCCCCTCCTGCCTCTGCCTCACCCTCTGCTGTTCCCAACGGCCCCCAGTCTCCCAAGCAGCAAAAGGAACCCCTCTCCCATCGC
TTCAACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGTGGGCATAGCCTCACTCTGCAGGGTGCAACACCG
GAGGATTTCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCGATGAGTTAAATAAAGAAATTCAGAAGGAGATG
GATCAAAGAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATGGGAGACCCAGCCAGTTTGGATCACAAATTAGCA
GAAGTCAGCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGCTGGCTGAGGTTGAAGGCCGGCTCCCAGCACGC
AGCGAGCAGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTCAACAACTGCGCCCAGGACCGTGAGAGCCCAGAT
GGCAGTTACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATTTTGACGACGAGTTTGATGATGAGGAGCCCCTC
CCTGCCATAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACGATTTCCGTAGTTGAAGGAGAAACATTGTATGTC
ATAGAGGAAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGGGTTATGTCCCCACTTCATATGTCGAAGTCTGT

>In-frame_VAV2_ENST00000371851_chr9_136857197_-_FNBP1_ENST00000355681_chr9_132757237_-_1959nt
ATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCATCGATTGCAAGGTCCTGCCGCCCAACCACCGGGTGGTGTGGCCCTCGGCCGTGGTC
TTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCCTTCTGTGCCAGCTGCTGCACAACCTCTCCCCCGGCTCCATCGACCTCAAGGACATC
AACTTCCGGCCGCAGATGTCCCAGGATCAGTTTGACAACTTAGAAAAACACACACAGTGGGGAATTGATATTCTTGAGAAATATATCAAG
TTTGTGAAAGAAAGGACAGAGATTGAACTCAGCTATGCAAAGCAACTCAGGAATCTTTCAAAGAAGTACCAACCTAAAAAGAACTCGAAG
GAGGAAGAAGAATACAAGTATACGTCATGTAAAGCTTTCATTTCCAACCTGAACGAAATGAATGATTACGCAGGGCAGCATGAAGTTATC
TCCGAGAACATGGCATCACAGATCATTGTGGACTTGGCACGCTATGTTCAGGAACTGAAACAGGAGAGGAAATCAAACTTTCACGATGGC
CGTAAAGCACAGCAGCACATCGAGACTTGCTGGAAGCAGCTTGAATCTAGTAAAAGGCGATTTGAACGCGATTGCAAAGAGGCGGACAGG
GCGCAGCAGTACTTTGAGAAAATGGACGCTGACATCAATGTCACAAAAGCGGATGTTGAAAAGGCCCGACAACAAGCTCAAATACGTCAC
CAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATCCCC
AACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGGCAG
GTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATAGAA
GCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGCCTT
TCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAGTCT
CCCAAGCAGCAAAAGGAACCCCTCTCCCATCGCTTCAACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGT
GGGCTTTCTCTCAAGCTGGGTGCAACACCGGAGGATTTCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCGAT
GAGTTAAATAAAGAAATTCAGAAGGAGATGGATCAAAGAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATGGGA
GACCCAGCCAGTTTGGATCACAAATTAGCAGAAGTCAGCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGCTG
GCTGAGGTTGAAGGCCGGCTCCCAGCACGCAGCGAGCAGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTCAAC
AACTGCGCCCAGGACCGTGAGAGCCCAGATGGCAGTTACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATTTT
GACGACGAGTTTGATGATGAGGAGCCCCTCCCTGCCATAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACGATT
TCCGTAGTTGAAGGAGAAACATTGTATGTCATAGAGGAAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGGGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_VAV2_ENST00000406606_chr9_136857197_-_FNBP1_ENST00000446176_chr9_132757237_-_5389nt
GCCATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCATCGATTGCAAGGTCCTGCCGCCCAACCACCGGGTGGTGTGGCCCTCGGCCGTG
GTCTTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCCTTCTGTGCCAGCTGCTGCACAACCTCTCCCCCGGCTCCATCGACCTCAAGGAC
ATCAACTTCCGGCCGCAGATGTCCCAGGATCAGTTTGACAACTTAGAAAAACACACACAGTGGGGAATTGATATTCTTGAGAAATATATC
AAGTTTGTGAAAGAAAGGACAGAGATTGAACTCAGCTATGCAAAGCAACTCAGGAATCTTTCAAAGAAGTACCAACCTAAAAAGAACTCG
AAGGAGGAAGAAGAATACAAGTATACGTCATGTAAAGCTTTCATTTCCAACCTGAACGAAATGAATGATTACGCAGGGCAGCATGAAGTT
ATCTCCGAGAACATGGCATCACAGATCATTGTGGACTTGGCACGCTATGTTCAGGAACTGAAACAGGAGAGGAAATCAAACTTTCACGAT
GGCCGTAAAGCACAGCAGCACATCGAGACTTGCTGGAAGCAGCTTGAATCTAGTAAAAGGCGATTTGAACGCGATTGCAAAGAGGCGGAC
AGGGCGCAGCAGTACTTTGAGAAAATGGACGCTGACATCAATGTCACAAAAGCGGATGTTGAAAAGGCCCGACAACAAGCTCAAATACGT
CACCAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATC
CCCAACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGG
CAGGTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATA
GAAGCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGC
CTTTCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAG
CTTATGTCCCTTTTAACATCCCCCCATCAGCCTCCCCCTCCCCCTCCTGCCTCTGCCTCACCCTCTGCTGTTCCCAACGGCCCCCAGTCT
CCCAAGCAGCAAAAGGAACCCCTCTCCCATCGCTTCAACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGT
GGGCTTTCTCTCAAGCTGGGTGCAACACCGGAGGATTTCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCGAT
GAGTTAAATAAAGAAATTCAGAAGGAGATGGATCAAAGAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATGGGA
GACCCAGCCAGTTTGGATCACAAATTAGCAGAAGTCAGCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGCTG
GCTGAGGTTGAAGGCCGGCTCCCAGCACGCAGCGAGCAGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTCAAC
AACTGCGCCCAGGACCGTGAGAGCCCAGATGGCAGTTACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATTTT
GACGACGAGTTTGATGATGAGGAGCCCCTCCCTGCCATAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACGATT
TCCGTAGTTGAAGGAGAAACATTGTATGTCATAGAGGAAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGGGT
TATGTCCCCACTTCATATGTCGAAGTCTGTTTGGACAAAAATGCCAAAGATTCCTAGAGGGGAGTGCCTGCGAGCCTCGGGTGAGCCTTC
CTGGAGGAGCCTCCGTCTGCTTGTTCCCACAGGCCTCCAGCGCCCTGCCCTGTGGACAGCCCACCCCTCCGCAGCCCCATCCCTGCGGGG
CGGTCTCTCTCTCTCTCCAGCATGCTCCCTGCGGCCCTGCCCTCCCGCCCAGCCCGGGCCACCTCGTGGGGGACAAGTCTCGCCAGCGCC
CACCCCCATGGCTCGGGTCAGTCCTCATCGCTCCCCCTCCCCACCCCGCGCAGGCCACTGAGACGGTGGGACACACGCCCCTACCTGCTC
CTTCCTGGGCCCTCAGTCCACCCGGGCTCGTCCTGGCAGCCCTTCCGCGCTTCACACAGTGCCTTTTGTGAAAGTGTCATCACGGGTCCC
CTGAGGAGACAAGGCAGGTCCAGCGCACATCAGGCGGACTGAGCACTCGATGTCATCCGTGTCGATGTCATCCGTGTGTCCCAGACTGTC
TGCTGTAGAAAACACTTCCTCCTCTCCTGAGTCTGTGAAGTCCTCAGTGGTCCTTTTTGGATTCTAGGCTTGCACCTCATACTAAACATT
GACCCTTTCACTATGCCCTCAACCTGGGAGCATCTGGCAGGCAGGGGGGCAGGTACACACACACCCACAGGCACACCCACCAGTACACAC
GCGTGCGCATACACACATTTTGGTTTGACGCCCTGTTTTCAGTGGCCTGGGGAGGTCCACACTGGAAGTCGAATTCCAGCTCGCCTTGTT
GACTCGCCTGTGTCCACCGGCCATGAGGAGCCCACGCCTGTCCTCCCCATCACTTTCCTGTCCCTGAGAACTGTAGATCATGCGCTTGTG
AGCGAGGCCCTCCCCTCTGCACCAGCTCATTGCAAAGCGAACATCCTCTCCTTTCCAGGAGCCCCAGGATTAGCATCTGAAAAGGGTAGC
ACTTCCTTTTTTGTTGTTGTTTTTTTTTTTTTTTTGAGACGGGAGTCTCGCTCTATTGTTCAGACTGGAGTGCAGTGGCATGATCTCGGC
TCACTACAACCTCCACCTCCTGGGTTCCAGCGATTCTCCTGCCTCAGCCTCCCAAATAGCTGTGATTACAGGCGTGCACCACCACGCCCG
GCTAATGTTTGTATTTTTAGTAGAGACAGGGTTTCACCGTGTTGGTCAGGCTGGTCTCAAACTCCTGACCTCAGGTGATCCGCCCGCCTC
AGCCTCCCAAAGTGCTGAGATTACAGGTGTGAGCTACCGCACCCCGCCGAGGTTAGCACTTTCATCACCAAAGACCCCGTGCCTCTCGTG
GTCCTTTGAGGGATCCCGCCGCCACCACCCTTGTATTTTATCACGTGCTCTTCAGGGCATGTGGAATTCGTTGAGTTTGCTTTTAGAGCC
AAGTTTCTTTCCCTGTGTGGGTTTTTGAGGAAAACCTGAGGTCCCCTAATCTGTGGCCACCACCCCCCCCCCCCGCCACGCCTTAGAGCA
GAGCAGCCCCTCCTCTCATTTGGTGCAGAAACAGTCAAGAGGAACCATTGGCCTAGAGCTCCTGTGACCGAGAGCGCCACGGAAGCCTGG
GGATGACGTCGGGCAGCTTTATTCTTTGCTTGGCTTTGGTAACTAGGTGGTCCCCTCAAGCATCCTCAGTTCCTCTTGCTGTTTATGAAT
CTAAGACAAGGAAGTCCTATAGAAGCCAAAGGGACAGGGACGGAAAGGACAGGTCCCAAGGGATGGGGCTGTCTTTACTTGTGGAAACCA
GGAAATTGCTCCTCTCAGCCAACCAAGGTTGACCACACACCACCCTTCCGGAGCAGCTCAGTCAGCCCTCGGGGACGAGAAACCACAAGC
GCAGAGACGCTGAGGCCCAGGCAGGTGAAGAGGAAGTGGCTTTGGGTTTTTAAAGTAGGTGAGCGTGAGCCTCTCTGACTGCTTCTTCCC
CGGGGGGGACTGCAAACCGCTCAGGGTTGCGGCAGAGCCATGGACTTCCGGTCCCTGCAACGGGTGACCTAAGCGTGGTGCACCCATCAG
TCACGCAGGAGGACTGACTTGACAGACGAAAGACAAGCCCGGATGACACAGGGTGAGAAGAGTCAGGGCCGCACCTCTGTCCCTGCAAAC
CAACAGGTGCATGGTGAGTGTGGCAGTCCCCACAGCTCCACAATGGGCTCCCCCGCCAACGGGGACGACAGGGATCTTCAGGAACTTCTG
ACCTCACCAAGTCAAGTGGACCACTCTCCACTCCACGAGGATGTGAAACGGTTCTTTAAAATGGGATTTTAGAGCCTCGGGAATGCATGT
GCGTCACATCTTTCATATTATGGGTCAGGATAGATTCATTTCTTGCAACATAGTGGAAAAGATATAAGCTGCAGTAATTTGCTCTTTGAA
TGACCGTCACCCCCAGTATAGGATATGCTTGTATCCCCCCGTCACTCCTCCGCCTGTTTTTTAAACTTTTCCACCACCTGCGTCCAAAAA
GAATGTTATAGCGAGTGCTCTTAAATGTTGAACCTGGGTGTTGCTTCCGGGCCAGTCTGCGTGGCTCCATGAAAAGCTCACTGCTGCCCC
AGCCGGGCTTCTTAGAGGAGGTCAGTTGTCCTATGTATCATCATTTACTCTGGGAATCCTACTGTGAAATCATGTCTGTATTTTTCTGGA
GCAGTTCACATAGAGTAGAATGTGGAATTTCCCGTGAACGTCTCCTTCCTCCCCCGTATCTGCCGCCTGTCACTTCGCCACCGTGCTAGA
ATACTGTTGTGTTGTAAGATGACTAATTTTAAAAGAACCTGCCCTGAAAAGTTCTTAGAAACGCAGTGAAAGGGAGGAACTTGTCCTTTA
CCCAGTTTTTCCTTTGTAGGATGGGAAAGTATAAAAAGGCACAGAAGGTTGTCATGGGCTGTTCCTTGGGGGTTTTTATCCTGCTCACCG
TGGAGATAAGCCTGCGGCTTGTCTAACCAGCGCAGCGCAAAGGTCTCGATGCCTTTTGGTAACATCCGTCATTGCAGAAGAAAGTTTACA
CGACGTCAAAAAGTGACGTTCATGCTAAGTGTTTTTCCAGAAATATTGGTTTCATGTTTCTTATTGGCTCTGCCTCCTGTGCTTATATCA
TCCAAAAACTTTTTAAAAAGGTCCAGAATTCTATTTTAACCTGATGTTGAGCACCTTTAAAATGTTCGTATGTGTGTTGCACTAATTCTA
AACTTTGGAGGCATTTTGCTGTGTGAGGCCGATCGCCACTGTAAAGGTCCTAGAGTTGCCTGTTTGTCTCTGGAGATGGAATTAAACCAA

>In-frame_VAV2_ENST00000406606_chr9_136857197_-_FNBP1_ENST00000420781_chr9_132757237_-_5362nt
GCCATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCATCGATTGCAAGGTCCTGCCGCCCAACCACCGGGTGGTGTGGCCCTCGGCCGTG
GTCTTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCCTTCTGTGCCAGCTGCTGCACAACCTCTCCCCCGGCTCCATCGACCTCAAGGAC
ATCAACTTCCGGCCGCAGATGTCCCAGGATCAGTTTGACAACTTAGAAAAACACACACAGTGGGGAATTGATATTCTTGAGAAATATATC
AAGTTTGTGAAAGAAAGGACAGAGATTGAACTCAGCTATGCAAAGCAACTCAGGAATCTTTCAAAGAAGTACCAACCTAAAAAGAACTCG
AAGGAGGAAGAAGAATACAAGTATACGTCATGTAAAGCTTTCATTTCCAACCTGAACGAAATGAATGATTACGCAGGGCAGCATGAAGTT
ATCTCCGAGAACATGGCATCACAGATCATTGTGGACTTGGCACGCTATGTTCAGGAACTGAAACAGGAGAGGAAATCAAACTTTCACGAT
GGCCGTAAAGCACAGCAGCACATCGAGACTTGCTGGAAGCAGCTTGAATCTAGTAAAAGGCGATTTGAACGCGATTGCAAAGAGGCGGAC
AGGGCGCAGCAGTACTTTGAGAAAATGGACGCTGACATCAATGTCACAAAAGCGGATGTTGAAAAGGCCCGACAACAAGCTCAAATACGT
CACCAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATC
CCCAACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGG
CAGGTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATA
GAAGCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGC
CTTTCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAG
CCTCCCCCTCCCCCTCCTGCCTCTGCCTCACCCTCTGCTGTTCCCAACGGCCCCCAGTCTCCCAAGCAGCAAAAGGAACCCCTCTCCCAT
CGCTTCAACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGTGGGCATAGCCTCACTCTGCAGGGTGCAACA
CCGGAGGATTTCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCGATGAGTTAAATAAAGAAATTCAGAAGGAG
ATGGATCAAAGAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATGGGAGACCCAGCCAGTTTGGATCACAAATTA
GCAGAAGTCAGCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGCTGGCTGAGGTTGAAGGCCGGCTCCCAGCA
CGCAGCGAGCAGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTCAACAACTGCGCCCAGGACCGTGAGAGCCCA
GATGGCAGTTACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATTTTGACGACGAGTTTGATGATGAGGAGCCC
CTCCCTGCCATAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACGATTTCCGTAGTTGAAGGAGAAACATTGTAT
GTCATAGAGGAAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGGGTTATGTCCCCACTTCATATGTCGAAGTC
TGTTTGGACAAAAATGCCAAAGATTCCTAGAGGGGAGTGCCTGCGAGCCTCGGGTGAGCCTTCCTGGAGGAGCCTCCGTCTGCTTGTTCC
CACAGGCCTCCAGCGCCCTGCCCTGTGGACAGCCCACCCCTCCGCAGCCCCATCCCTGCGGGGCGGTCTCTCTCTCTCTCCAGCATGCTC
CCTGCGGCCCTGCCCTCCCGCCCAGCCCGGGCCACCTCGTGGGGGACAAGTCTCGCCAGCGCCCACCCCCATGGCTCGGGTCAGTCCTCA
TCGCTCCCCCTCCCCACCCCGCGCAGGCCACTGAGACGGTGGGACACACGCCCCTACCTGCTCCTTCCTGGGCCCTCAGTCCACCCGGGC
TCGTCCTGGCAGCCCTTCCGCGCTTCACACAGTGCCTTTTGTGAAAGTGTCATCACGGGTCCCCTGAGGAGACAAGGCAGGTCCAGCGCA
CATCAGGCGGACTGAGCACTCGATGTCATCCGTGTCGATGTCATCCGTGTGTCCCAGACTGTCTGCTGTAGAAAACACTTCCTCCTCTCC
TGAGTCTGTGAAGTCCTCAGTGGTCCTTTTTGGATTCTAGGCTTGCACCTCATACTAAACATTGACCCTTTCACTATGCCCTCAACCTGG
GAGCATCTGGCAGGCAGGGGGGCAGGTACACACACACCCACAGGCACACCCACCAGTACACACGCGTGCGCATACACACATTTTGGTTTG
ACGCCCTGTTTTCAGTGGCCTGGGGAGGTCCACACTGGAAGTCGAATTCCAGCTCGCCTTGTTGACTCGCCTGTGTCCACCGGCCATGAG
GAGCCCACGCCTGTCCTCCCCATCACTTTCCTGTCCCTGAGAACTGTAGATCATGCGCTTGTGAGCGAGGCCCTCCCCTCTGCACCAGCT
CATTGCAAAGCGAACATCCTCTCCTTTCCAGGAGCCCCAGGATTAGCATCTGAAAAGGGTAGCACTTCCTTTTTTGTTGTTGTTTTTTTT
TTTTTTTTGAGACGGGAGTCTCGCTCTATTGTTCAGACTGGAGTGCAGTGGCATGATCTCGGCTCACTACAACCTCCACCTCCTGGGTTC
CAGCGATTCTCCTGCCTCAGCCTCCCAAATAGCTGTGATTACAGGCGTGCACCACCACGCCCGGCTAATGTTTGTATTTTTAGTAGAGAC
AGGGTTTCACCGTGTTGGTCAGGCTGGTCTCAAACTCCTGACCTCAGGTGATCCGCCCGCCTCAGCCTCCCAAAGTGCTGAGATTACAGG
TGTGAGCTACCGCACCCCGCCGAGGTTAGCACTTTCATCACCAAAGACCCCGTGCCTCTCGTGGTCCTTTGAGGGATCCCGCCGCCACCA
CCCTTGTATTTTATCACGTGCTCTTCAGGGCATGTGGAATTCGTTGAGTTTGCTTTTAGAGCCAAGTTTCTTTCCCTGTGTGGGTTTTTG
AGGAAAACCTGAGGTCCCCTAATCTGTGGCCACCACCCCCCCCCCCCGCCACGCCTTAGAGCAGAGCAGCCCCTCCTCTCATTTGGTGCA
GAAACAGTCAAGAGGAACCATTGGCCTAGAGCTCCTGTGACCGAGAGCGCCACGGAAGCCTGGGGATGACGTCGGGCAGCTTTATTCTTT
GCTTGGCTTTGGTAACTAGGTGGTCCCCTCAAGCATCCTCAGTTCCTCTTGCTGTTTATGAATCTAAGACAAGGAAGTCCTATAGAAGCC
AAAGGGACAGGGACGGAAAGGACAGGTCCCAAGGGATGGGGCTGTCTTTACTTGTGGAAACCAGGAAATTGCTCCTCTCAGCCAACCAAG
GTTGACCACACACCACCCTTCCGGAGCAGCTCAGTCAGCCCTCGGGGACGAGAAACCACAAGCGCAGAGACGCTGAGGCCCAGGCAGGTG
AAGAGGAAGTGGCTTTGGGTTTTTAAAGTAGGTGAGCGTGAGCCTCTCTGACTGCTTCTTCCCCGGGGGGGACTGCAAACCGCTCAGGGT
TGCGGCAGAGCCATGGACTTCCGGTCCCTGCAACGGGTGACCTAAGCGTGGTGCACCCATCAGTCACGCAGGAGGACTGACTTGACAGAC
GAAAGACAAGCCCGGATGACACAGGGTGAGAAGAGTCAGGGCCGCACCTCTGTCCCTGCAAACCAACAGGTGCATGGTGAGTGTGGCAGT
CCCCACAGCTCCACAATGGGCTCCCCCGCCAACGGGGACGACAGGGATCTTCAGGAACTTCTGACCTCACCAAGTCAAGTGGACCACTCT
CCACTCCACGAGGATGTGAAACGGTTCTTTAAAATGGGATTTTAGAGCCTCGGGAATGCATGTGCGTCACATCTTTCATATTATGGGTCA
GGATAGATTCATTTCTTGCAACATAGTGGAAAAGATATAAGCTGCAGTAATTTGCTCTTTGAATGACCGTCACCCCCAGTATAGGATATG
CTTGTATCCCCCCGTCACTCCTCCGCCTGTTTTTTAAACTTTTCCACCACCTGCGTCCAAAAAGAATGTTATAGCGAGTGCTCTTAAATG
TTGAACCTGGGTGTTGCTTCCGGGCCAGTCTGCGTGGCTCCATGAAAAGCTCACTGCTGCCCCAGCCGGGCTTCTTAGAGGAGGTCAGTT
GTCCTATGTATCATCATTTACTCTGGGAATCCTACTGTGAAATCATGTCTGTATTTTTCTGGAGCAGTTCACATAGAGTAGAATGTGGAA
TTTCCCGTGAACGTCTCCTTCCTCCCCCGTATCTGCCGCCTGTCACTTCGCCACCGTGCTAGAATACTGTTGTGTTGTAAGATGACTAAT
TTTAAAAGAACCTGCCCTGAAAAGTTCTTAGAAACGCAGTGAAAGGGAGGAACTTGTCCTTTACCCAGTTTTTCCTTTGTAGGATGGGAA
AGTATAAAAAGGCACAGAAGGTTGTCATGGGCTGTTCCTTGGGGGTTTTTATCCTGCTCACCGTGGAGATAAGCCTGCGGCTTGTCTAAC
CAGCGCAGCGCAAAGGTCTCGATGCCTTTTGGTAACATCCGTCATTGCAGAAGAAAGTTTACACGACGTCAAAAAGTGACGTTCATGCTA
AGTGTTTTTCCAGAAATATTGGTTTCATGTTTCTTATTGGCTCTGCCTCCTGTGCTTATATCATCCAAAAACTTTTTAAAAAGGTCCAGA
ATTCTATTTTAACCTGATGTTGAGCACCTTTAAAATGTTCGTATGTGTGTTGCACTAATTCTAAACTTTGGAGGCATTTTGCTGTGTGAG
GCCGATCGCCACTGTAAAGGTCCTAGAGTTGCCTGTTTGTCTCTGGAGATGGAATTAAACCAAATAAAGAGCTTCCACTGGAGGCTTGTA

>In-frame_VAV2_ENST00000406606_chr9_136857197_-_FNBP1_ENST00000355681_chr9_132757237_-_1968nt
GCCATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCATCGATTGCAAGGTCCTGCCGCCCAACCACCGGGTGGTGTGGCCCTCGGCCGTG
GTCTTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCCTTCTGTGCCAGCTGCTGCACAACCTCTCCCCCGGCTCCATCGACCTCAAGGAC
ATCAACTTCCGGCCGCAGATGTCCCAGGATCAGTTTGACAACTTAGAAAAACACACACAGTGGGGAATTGATATTCTTGAGAAATATATC
AAGTTTGTGAAAGAAAGGACAGAGATTGAACTCAGCTATGCAAAGCAACTCAGGAATCTTTCAAAGAAGTACCAACCTAAAAAGAACTCG
AAGGAGGAAGAAGAATACAAGTATACGTCATGTAAAGCTTTCATTTCCAACCTGAACGAAATGAATGATTACGCAGGGCAGCATGAAGTT
ATCTCCGAGAACATGGCATCACAGATCATTGTGGACTTGGCACGCTATGTTCAGGAACTGAAACAGGAGAGGAAATCAAACTTTCACGAT
GGCCGTAAAGCACAGCAGCACATCGAGACTTGCTGGAAGCAGCTTGAATCTAGTAAAAGGCGATTTGAACGCGATTGCAAAGAGGCGGAC
AGGGCGCAGCAGTACTTTGAGAAAATGGACGCTGACATCAATGTCACAAAAGCGGATGTTGAAAAGGCCCGACAACAAGCTCAAATACGT
CACCAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATC
CCCAACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGG
CAGGTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATA
GAAGCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGC
CTTTCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAG
TCTCCCAAGCAGCAAAAGGAACCCCTCTCCCATCGCTTCAACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAG
CGTGGGCTTTCTCTCAAGCTGGGTGCAACACCGGAGGATTTCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTC
GATGAGTTAAATAAAGAAATTCAGAAGGAGATGGATCAAAGAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATG
GGAGACCCAGCCAGTTTGGATCACAAATTAGCAGAAGTCAGCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGG
CTGGCTGAGGTTGAAGGCCGGCTCCCAGCACGCAGCGAGCAGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTC
AACAACTGCGCCCAGGACCGTGAGAGCCCAGATGGCAGTTACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGAT
TTTGACGACGAGTTTGATGATGAGGAGCCCCTCCCTGCCATAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACG
ATTTCCGTAGTTGAAGGAGAAACATTGTATGTCATAGAGGAAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAG

>In-frame_VAV2_ENST00000371850_chr9_136857197_-_FNBP1_ENST00000446176_chr9_132757237_-_5418nt
ACTGCCCTGAGCCGGTCGGGCCCGCGGGCGCCATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCATCGATTGCAAGGTCCTGCCGCCCA
ACCACCGGGTGGTGTGGCCCTCGGCCGTGGTCTTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCCTTCTGTGCCAGCTGCTGCACAACC
TCTCCCCCGGCTCCATCGACCTCAAGGACATCAACTTCCGGCCGCAGATGTCCCAGGATCAGTTTGACAACTTAGAAAAACACACACAGT
GGGGAATTGATATTCTTGAGAAATATATCAAGTTTGTGAAAGAAAGGACAGAGATTGAACTCAGCTATGCAAAGCAACTCAGGAATCTTT
CAAAGAAGTACCAACCTAAAAAGAACTCGAAGGAGGAAGAAGAATACAAGTATACGTCATGTAAAGCTTTCATTTCCAACCTGAACGAAA
TGAATGATTACGCAGGGCAGCATGAAGTTATCTCCGAGAACATGGCATCACAGATCATTGTGGACTTGGCACGCTATGTTCAGGAACTGA
AACAGGAGAGGAAATCAAACTTTCACGATGGCCGTAAAGCACAGCAGCACATCGAGACTTGCTGGAAGCAGCTTGAATCTAGTAAAAGGC
GATTTGAACGCGATTGCAAAGAGGCGGACAGGGCGCAGCAGTACTTTGAGAAAATGGACGCTGACATCAATGTCACAAAAGCGGATGTTG
AAAAGGCCCGACAACAAGCTCAAATACGTCACCAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATG
AGCAGCATGAATATTACCATACTCACATCCCCAACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGT
CCATGAAGACATATGCAGAGGTTGATCGGCAGGTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTG
ATCAGAAAAATGATTCACAGCTGGTAATAGAAGCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGC
CAATGAAGCGCACTGTGTCAGATAACAGCCTTTCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAA
AGTTATGGCCGTTCATCAAAAAAAATAAGCTTATGTCCCTTTTAACATCCCCCCATCAGCCTCCCCCTCCCCCTCCTGCCTCTGCCTCAC
CCTCTGCTGTTCCCAACGGCCCCCAGTCTCCCAAGCAGCAAAAGGAACCCCTCTCCCATCGCTTCAACGAGTTCATGACCTCCAAACCCA
AAATCCACTGCTTCAGGAGCCTAAAGCGTGGGCTTTCTCTCAAGCTGGGTGCAACACCGGAGGATTTCAGCAACCTCCCACCTGAACAAA
GAAGGAAAAAGCTGCAGCAGAAAGTCGATGAGTTAAATAAAGAAATTCAGAAGGAGATGGATCAAAGAGATGCCATAACAAAAATGAAAG
ATGTCTACCTAAAGAATCCTCAGATGGGAGACCCAGCCAGTTTGGATCACAAATTAGCAGAAGTCAGCCAAAATATAGAGAAACTGCGAG
TAGAGACCCAGAAATTTGAGGCCTGGCTGGCTGAGGTTGAAGGCCGGCTCCCAGCACGCAGCGAGCAGGCGCGCCGGCAGAGCGGACTGT
ACGACAGCCAGAACCCACCCACAGTCAACAACTGCGCCCAGGACCGTGAGAGCCCAGATGGCAGTTACACAGAGGAGCAGAGTCAGGAGA
GTGAGATGAAGGTGCTGGCCACGGATTTTGACGACGAGTTTGATGATGAGGAGCCCCTCCCTGCCATAGGGACGTGCAAAGCTCTCTACA
CATTTGAAGGTCAGAATGAAGGAACGATTTCCGTAGTTGAAGGAGAAACATTGTATGTCATAGAGGAAGACAAAGGCGATGGCTGGACCC
GCATTCGGAGAAATGAAGATGAAGAGGGTTATGTCCCCACTTCATATGTCGAAGTCTGTTTGGACAAAAATGCCAAAGATTCCTAGAGGG
GAGTGCCTGCGAGCCTCGGGTGAGCCTTCCTGGAGGAGCCTCCGTCTGCTTGTTCCCACAGGCCTCCAGCGCCCTGCCCTGTGGACAGCC
CACCCCTCCGCAGCCCCATCCCTGCGGGGCGGTCTCTCTCTCTCTCCAGCATGCTCCCTGCGGCCCTGCCCTCCCGCCCAGCCCGGGCCA
CCTCGTGGGGGACAAGTCTCGCCAGCGCCCACCCCCATGGCTCGGGTCAGTCCTCATCGCTCCCCCTCCCCACCCCGCGCAGGCCACTGA
GACGGTGGGACACACGCCCCTACCTGCTCCTTCCTGGGCCCTCAGTCCACCCGGGCTCGTCCTGGCAGCCCTTCCGCGCTTCACACAGTG
CCTTTTGTGAAAGTGTCATCACGGGTCCCCTGAGGAGACAAGGCAGGTCCAGCGCACATCAGGCGGACTGAGCACTCGATGTCATCCGTG
TCGATGTCATCCGTGTGTCCCAGACTGTCTGCTGTAGAAAACACTTCCTCCTCTCCTGAGTCTGTGAAGTCCTCAGTGGTCCTTTTTGGA
TTCTAGGCTTGCACCTCATACTAAACATTGACCCTTTCACTATGCCCTCAACCTGGGAGCATCTGGCAGGCAGGGGGGCAGGTACACACA
CACCCACAGGCACACCCACCAGTACACACGCGTGCGCATACACACATTTTGGTTTGACGCCCTGTTTTCAGTGGCCTGGGGAGGTCCACA
CTGGAAGTCGAATTCCAGCTCGCCTTGTTGACTCGCCTGTGTCCACCGGCCATGAGGAGCCCACGCCTGTCCTCCCCATCACTTTCCTGT
CCCTGAGAACTGTAGATCATGCGCTTGTGAGCGAGGCCCTCCCCTCTGCACCAGCTCATTGCAAAGCGAACATCCTCTCCTTTCCAGGAG
CCCCAGGATTAGCATCTGAAAAGGGTAGCACTTCCTTTTTTGTTGTTGTTTTTTTTTTTTTTTTGAGACGGGAGTCTCGCTCTATTGTTC
AGACTGGAGTGCAGTGGCATGATCTCGGCTCACTACAACCTCCACCTCCTGGGTTCCAGCGATTCTCCTGCCTCAGCCTCCCAAATAGCT
GTGATTACAGGCGTGCACCACCACGCCCGGCTAATGTTTGTATTTTTAGTAGAGACAGGGTTTCACCGTGTTGGTCAGGCTGGTCTCAAA
CTCCTGACCTCAGGTGATCCGCCCGCCTCAGCCTCCCAAAGTGCTGAGATTACAGGTGTGAGCTACCGCACCCCGCCGAGGTTAGCACTT
TCATCACCAAAGACCCCGTGCCTCTCGTGGTCCTTTGAGGGATCCCGCCGCCACCACCCTTGTATTTTATCACGTGCTCTTCAGGGCATG
TGGAATTCGTTGAGTTTGCTTTTAGAGCCAAGTTTCTTTCCCTGTGTGGGTTTTTGAGGAAAACCTGAGGTCCCCTAATCTGTGGCCACC
ACCCCCCCCCCCCGCCACGCCTTAGAGCAGAGCAGCCCCTCCTCTCATTTGGTGCAGAAACAGTCAAGAGGAACCATTGGCCTAGAGCTC
CTGTGACCGAGAGCGCCACGGAAGCCTGGGGATGACGTCGGGCAGCTTTATTCTTTGCTTGGCTTTGGTAACTAGGTGGTCCCCTCAAGC
ATCCTCAGTTCCTCTTGCTGTTTATGAATCTAAGACAAGGAAGTCCTATAGAAGCCAAAGGGACAGGGACGGAAAGGACAGGTCCCAAGG
GATGGGGCTGTCTTTACTTGTGGAAACCAGGAAATTGCTCCTCTCAGCCAACCAAGGTTGACCACACACCACCCTTCCGGAGCAGCTCAG
TCAGCCCTCGGGGACGAGAAACCACAAGCGCAGAGACGCTGAGGCCCAGGCAGGTGAAGAGGAAGTGGCTTTGGGTTTTTAAAGTAGGTG
AGCGTGAGCCTCTCTGACTGCTTCTTCCCCGGGGGGGACTGCAAACCGCTCAGGGTTGCGGCAGAGCCATGGACTTCCGGTCCCTGCAAC
GGGTGACCTAAGCGTGGTGCACCCATCAGTCACGCAGGAGGACTGACTTGACAGACGAAAGACAAGCCCGGATGACACAGGGTGAGAAGA
GTCAGGGCCGCACCTCTGTCCCTGCAAACCAACAGGTGCATGGTGAGTGTGGCAGTCCCCACAGCTCCACAATGGGCTCCCCCGCCAACG
GGGACGACAGGGATCTTCAGGAACTTCTGACCTCACCAAGTCAAGTGGACCACTCTCCACTCCACGAGGATGTGAAACGGTTCTTTAAAA
TGGGATTTTAGAGCCTCGGGAATGCATGTGCGTCACATCTTTCATATTATGGGTCAGGATAGATTCATTTCTTGCAACATAGTGGAAAAG
ATATAAGCTGCAGTAATTTGCTCTTTGAATGACCGTCACCCCCAGTATAGGATATGCTTGTATCCCCCCGTCACTCCTCCGCCTGTTTTT
TAAACTTTTCCACCACCTGCGTCCAAAAAGAATGTTATAGCGAGTGCTCTTAAATGTTGAACCTGGGTGTTGCTTCCGGGCCAGTCTGCG
TGGCTCCATGAAAAGCTCACTGCTGCCCCAGCCGGGCTTCTTAGAGGAGGTCAGTTGTCCTATGTATCATCATTTACTCTGGGAATCCTA
CTGTGAAATCATGTCTGTATTTTTCTGGAGCAGTTCACATAGAGTAGAATGTGGAATTTCCCGTGAACGTCTCCTTCCTCCCCCGTATCT
GCCGCCTGTCACTTCGCCACCGTGCTAGAATACTGTTGTGTTGTAAGATGACTAATTTTAAAAGAACCTGCCCTGAAAAGTTCTTAGAAA
CGCAGTGAAAGGGAGGAACTTGTCCTTTACCCAGTTTTTCCTTTGTAGGATGGGAAAGTATAAAAAGGCACAGAAGGTTGTCATGGGCTG
TTCCTTGGGGGTTTTTATCCTGCTCACCGTGGAGATAAGCCTGCGGCTTGTCTAACCAGCGCAGCGCAAAGGTCTCGATGCCTTTTGGTA
ACATCCGTCATTGCAGAAGAAAGTTTACACGACGTCAAAAAGTGACGTTCATGCTAAGTGTTTTTCCAGAAATATTGGTTTCATGTTTCT
TATTGGCTCTGCCTCCTGTGCTTATATCATCCAAAAACTTTTTAAAAAGGTCCAGAATTCTATTTTAACCTGATGTTGAGCACCTTTAAA
ATGTTCGTATGTGTGTTGCACTAATTCTAAACTTTGGAGGCATTTTGCTGTGTGAGGCCGATCGCCACTGTAAAGGTCCTAGAGTTGCCT
GTTTGTCTCTGGAGATGGAATTAAACCAAATAAAGAGCTTCCACTGGAGGCTTGTATTGACCTTGTAACTATATGTTAATCTCGTGTTAA

>In-frame_VAV2_ENST00000371850_chr9_136857197_-_FNBP1_ENST00000420781_chr9_132757237_-_5391nt
ACTGCCCTGAGCCGGTCGGGCCCGCGGGCGCCATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCATCGATTGCAAGGTCCTGCCGCCCA
ACCACCGGGTGGTGTGGCCCTCGGCCGTGGTCTTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCCTTCTGTGCCAGCTGCTGCACAACC
TCTCCCCCGGCTCCATCGACCTCAAGGACATCAACTTCCGGCCGCAGATGTCCCAGGATCAGTTTGACAACTTAGAAAAACACACACAGT
GGGGAATTGATATTCTTGAGAAATATATCAAGTTTGTGAAAGAAAGGACAGAGATTGAACTCAGCTATGCAAAGCAACTCAGGAATCTTT
CAAAGAAGTACCAACCTAAAAAGAACTCGAAGGAGGAAGAAGAATACAAGTATACGTCATGTAAAGCTTTCATTTCCAACCTGAACGAAA
TGAATGATTACGCAGGGCAGCATGAAGTTATCTCCGAGAACATGGCATCACAGATCATTGTGGACTTGGCACGCTATGTTCAGGAACTGA
AACAGGAGAGGAAATCAAACTTTCACGATGGCCGTAAAGCACAGCAGCACATCGAGACTTGCTGGAAGCAGCTTGAATCTAGTAAAAGGC
GATTTGAACGCGATTGCAAAGAGGCGGACAGGGCGCAGCAGTACTTTGAGAAAATGGACGCTGACATCAATGTCACAAAAGCGGATGTTG
AAAAGGCCCGACAACAAGCTCAAATACGTCACCAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATG
AGCAGCATGAATATTACCATACTCACATCCCCAACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGT
CCATGAAGACATATGCAGAGGTTGATCGGCAGGTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTG
ATCAGAAAAATGATTCACAGCTGGTAATAGAAGCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGC
CAATGAAGCGCACTGTGTCAGATAACAGCCTTTCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAA
AGTTATGGCCGTTCATCAAAAAAAATAAGCCTCCCCCTCCCCCTCCTGCCTCTGCCTCACCCTCTGCTGTTCCCAACGGCCCCCAGTCTC
CCAAGCAGCAAAAGGAACCCCTCTCCCATCGCTTCAACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGTG
GGCATAGCCTCACTCTGCAGGGTGCAACACCGGAGGATTTCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCG
ATGAGTTAAATAAAGAAATTCAGAAGGAGATGGATCAAAGAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATGG
GAGACCCAGCCAGTTTGGATCACAAATTAGCAGAAGTCAGCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGC
TGGCTGAGGTTGAAGGCCGGCTCCCAGCACGCAGCGAGCAGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTCA
ACAACTGCGCCCAGGACCGTGAGAGCCCAGATGGCAGTTACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATT
TTGACGACGAGTTTGATGATGAGGAGCCCCTCCCTGCCATAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACGA
TTTCCGTAGTTGAAGGAGAAACATTGTATGTCATAGAGGAAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGG
GTTATGTCCCCACTTCATATGTCGAAGTCTGTTTGGACAAAAATGCCAAAGATTCCTAGAGGGGAGTGCCTGCGAGCCTCGGGTGAGCCT
TCCTGGAGGAGCCTCCGTCTGCTTGTTCCCACAGGCCTCCAGCGCCCTGCCCTGTGGACAGCCCACCCCTCCGCAGCCCCATCCCTGCGG
GGCGGTCTCTCTCTCTCTCCAGCATGCTCCCTGCGGCCCTGCCCTCCCGCCCAGCCCGGGCCACCTCGTGGGGGACAAGTCTCGCCAGCG
CCCACCCCCATGGCTCGGGTCAGTCCTCATCGCTCCCCCTCCCCACCCCGCGCAGGCCACTGAGACGGTGGGACACACGCCCCTACCTGC
TCCTTCCTGGGCCCTCAGTCCACCCGGGCTCGTCCTGGCAGCCCTTCCGCGCTTCACACAGTGCCTTTTGTGAAAGTGTCATCACGGGTC
CCCTGAGGAGACAAGGCAGGTCCAGCGCACATCAGGCGGACTGAGCACTCGATGTCATCCGTGTCGATGTCATCCGTGTGTCCCAGACTG
TCTGCTGTAGAAAACACTTCCTCCTCTCCTGAGTCTGTGAAGTCCTCAGTGGTCCTTTTTGGATTCTAGGCTTGCACCTCATACTAAACA
TTGACCCTTTCACTATGCCCTCAACCTGGGAGCATCTGGCAGGCAGGGGGGCAGGTACACACACACCCACAGGCACACCCACCAGTACAC
ACGCGTGCGCATACACACATTTTGGTTTGACGCCCTGTTTTCAGTGGCCTGGGGAGGTCCACACTGGAAGTCGAATTCCAGCTCGCCTTG
TTGACTCGCCTGTGTCCACCGGCCATGAGGAGCCCACGCCTGTCCTCCCCATCACTTTCCTGTCCCTGAGAACTGTAGATCATGCGCTTG
TGAGCGAGGCCCTCCCCTCTGCACCAGCTCATTGCAAAGCGAACATCCTCTCCTTTCCAGGAGCCCCAGGATTAGCATCTGAAAAGGGTA
GCACTTCCTTTTTTGTTGTTGTTTTTTTTTTTTTTTTGAGACGGGAGTCTCGCTCTATTGTTCAGACTGGAGTGCAGTGGCATGATCTCG
GCTCACTACAACCTCCACCTCCTGGGTTCCAGCGATTCTCCTGCCTCAGCCTCCCAAATAGCTGTGATTACAGGCGTGCACCACCACGCC
CGGCTAATGTTTGTATTTTTAGTAGAGACAGGGTTTCACCGTGTTGGTCAGGCTGGTCTCAAACTCCTGACCTCAGGTGATCCGCCCGCC
TCAGCCTCCCAAAGTGCTGAGATTACAGGTGTGAGCTACCGCACCCCGCCGAGGTTAGCACTTTCATCACCAAAGACCCCGTGCCTCTCG
TGGTCCTTTGAGGGATCCCGCCGCCACCACCCTTGTATTTTATCACGTGCTCTTCAGGGCATGTGGAATTCGTTGAGTTTGCTTTTAGAG
CCAAGTTTCTTTCCCTGTGTGGGTTTTTGAGGAAAACCTGAGGTCCCCTAATCTGTGGCCACCACCCCCCCCCCCCGCCACGCCTTAGAG
CAGAGCAGCCCCTCCTCTCATTTGGTGCAGAAACAGTCAAGAGGAACCATTGGCCTAGAGCTCCTGTGACCGAGAGCGCCACGGAAGCCT
GGGGATGACGTCGGGCAGCTTTATTCTTTGCTTGGCTTTGGTAACTAGGTGGTCCCCTCAAGCATCCTCAGTTCCTCTTGCTGTTTATGA
ATCTAAGACAAGGAAGTCCTATAGAAGCCAAAGGGACAGGGACGGAAAGGACAGGTCCCAAGGGATGGGGCTGTCTTTACTTGTGGAAAC
CAGGAAATTGCTCCTCTCAGCCAACCAAGGTTGACCACACACCACCCTTCCGGAGCAGCTCAGTCAGCCCTCGGGGACGAGAAACCACAA
GCGCAGAGACGCTGAGGCCCAGGCAGGTGAAGAGGAAGTGGCTTTGGGTTTTTAAAGTAGGTGAGCGTGAGCCTCTCTGACTGCTTCTTC
CCCGGGGGGGACTGCAAACCGCTCAGGGTTGCGGCAGAGCCATGGACTTCCGGTCCCTGCAACGGGTGACCTAAGCGTGGTGCACCCATC
AGTCACGCAGGAGGACTGACTTGACAGACGAAAGACAAGCCCGGATGACACAGGGTGAGAAGAGTCAGGGCCGCACCTCTGTCCCTGCAA
ACCAACAGGTGCATGGTGAGTGTGGCAGTCCCCACAGCTCCACAATGGGCTCCCCCGCCAACGGGGACGACAGGGATCTTCAGGAACTTC
TGACCTCACCAAGTCAAGTGGACCACTCTCCACTCCACGAGGATGTGAAACGGTTCTTTAAAATGGGATTTTAGAGCCTCGGGAATGCAT
GTGCGTCACATCTTTCATATTATGGGTCAGGATAGATTCATTTCTTGCAACATAGTGGAAAAGATATAAGCTGCAGTAATTTGCTCTTTG
AATGACCGTCACCCCCAGTATAGGATATGCTTGTATCCCCCCGTCACTCCTCCGCCTGTTTTTTAAACTTTTCCACCACCTGCGTCCAAA
AAGAATGTTATAGCGAGTGCTCTTAAATGTTGAACCTGGGTGTTGCTTCCGGGCCAGTCTGCGTGGCTCCATGAAAAGCTCACTGCTGCC
CCAGCCGGGCTTCTTAGAGGAGGTCAGTTGTCCTATGTATCATCATTTACTCTGGGAATCCTACTGTGAAATCATGTCTGTATTTTTCTG
GAGCAGTTCACATAGAGTAGAATGTGGAATTTCCCGTGAACGTCTCCTTCCTCCCCCGTATCTGCCGCCTGTCACTTCGCCACCGTGCTA
GAATACTGTTGTGTTGTAAGATGACTAATTTTAAAAGAACCTGCCCTGAAAAGTTCTTAGAAACGCAGTGAAAGGGAGGAACTTGTCCTT
TACCCAGTTTTTCCTTTGTAGGATGGGAAAGTATAAAAAGGCACAGAAGGTTGTCATGGGCTGTTCCTTGGGGGTTTTTATCCTGCTCAC
CGTGGAGATAAGCCTGCGGCTTGTCTAACCAGCGCAGCGCAAAGGTCTCGATGCCTTTTGGTAACATCCGTCATTGCAGAAGAAAGTTTA
CACGACGTCAAAAAGTGACGTTCATGCTAAGTGTTTTTCCAGAAATATTGGTTTCATGTTTCTTATTGGCTCTGCCTCCTGTGCTTATAT
CATCCAAAAACTTTTTAAAAAGGTCCAGAATTCTATTTTAACCTGATGTTGAGCACCTTTAAAATGTTCGTATGTGTGTTGCACTAATTC
TAAACTTTGGAGGCATTTTGCTGTGTGAGGCCGATCGCCACTGTAAAGGTCCTAGAGTTGCCTGTTTGTCTCTGGAGATGGAATTAAACC

>In-frame_VAV2_ENST00000371850_chr9_136857197_-_FNBP1_ENST00000355681_chr9_132757237_-_1997nt
ACTGCCCTGAGCCGGTCGGGCCCGCGGGCGCCATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCATCGATTGCAAGGTCCTGCCGCCCA
ACCACCGGGTGGTGTGGCCCTCGGCCGTGGTCTTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCCTTCTGTGCCAGCTGCTGCACAACC
TCTCCCCCGGCTCCATCGACCTCAAGGACATCAACTTCCGGCCGCAGATGTCCCAGGATCAGTTTGACAACTTAGAAAAACACACACAGT
GGGGAATTGATATTCTTGAGAAATATATCAAGTTTGTGAAAGAAAGGACAGAGATTGAACTCAGCTATGCAAAGCAACTCAGGAATCTTT
CAAAGAAGTACCAACCTAAAAAGAACTCGAAGGAGGAAGAAGAATACAAGTATACGTCATGTAAAGCTTTCATTTCCAACCTGAACGAAA
TGAATGATTACGCAGGGCAGCATGAAGTTATCTCCGAGAACATGGCATCACAGATCATTGTGGACTTGGCACGCTATGTTCAGGAACTGA
AACAGGAGAGGAAATCAAACTTTCACGATGGCCGTAAAGCACAGCAGCACATCGAGACTTGCTGGAAGCAGCTTGAATCTAGTAAAAGGC
GATTTGAACGCGATTGCAAAGAGGCGGACAGGGCGCAGCAGTACTTTGAGAAAATGGACGCTGACATCAATGTCACAAAAGCGGATGTTG
AAAAGGCCCGACAACAAGCTCAAATACGTCACCAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATG
AGCAGCATGAATATTACCATACTCACATCCCCAACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGT
CCATGAAGACATATGCAGAGGTTGATCGGCAGGTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTG
ATCAGAAAAATGATTCACAGCTGGTAATAGAAGCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGC
CAATGAAGCGCACTGTGTCAGATAACAGCCTTTCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAA
AGTTATGGCCGTTCATCAAAAAAAATAAGTCTCCCAAGCAGCAAAAGGAACCCCTCTCCCATCGCTTCAACGAGTTCATGACCTCCAAAC
CCAAAATCCACTGCTTCAGGAGCCTAAAGCGTGGGCTTTCTCTCAAGCTGGGTGCAACACCGGAGGATTTCAGCAACCTCCCACCTGAAC
AAAGAAGGAAAAAGCTGCAGCAGAAAGTCGATGAGTTAAATAAAGAAATTCAGAAGGAGATGGATCAAAGAGATGCCATAACAAAAATGA
AAGATGTCTACCTAAAGAATCCTCAGATGGGAGACCCAGCCAGTTTGGATCACAAATTAGCAGAAGTCAGCCAAAATATAGAGAAACTGC
GAGTAGAGACCCAGAAATTTGAGGCCTGGCTGGCTGAGGTTGAAGGCCGGCTCCCAGCACGCAGCGAGCAGGCGCGCCGGCAGAGCGGAC
TGTACGACAGCCAGAACCCACCCACAGTCAACAACTGCGCCCAGGACCGTGAGAGCCCAGATGGCAGTTACACAGAGGAGCAGAGTCAGG
AGAGTGAGATGAAGGTGCTGGCCACGGATTTTGACGACGAGTTTGATGATGAGGAGCCCCTCCCTGCCATAGGGACGTGCAAAGCTCTCT
ACACATTTGAAGGTCAGAATGAAGGAACGATTTCCGTAGTTGAAGGAGAAACATTGTATGTCATAGAGGAAGACAAAGGCGATGGCTGGA
CCCGCATTCGGAGAAATGAAGATGAAGAGGGTTATGTCCCCACTTCATATGTCGAAGTCTGTTTGGACAAAAATGCCAAAGGTGCTAAGA

>In-frame_VAV2_ENST00000371851_chr9_136857197_-_FNBP1_ENST00000446176_chr9_132757237_-_5712nt
CGCGGATTGGGGAGCGCTGCGGCGACTGGCTGCGTGGAGCCCGGCCCGGGGCCCGCAGGCACTTGCGTGTGTGAAGCGGGGAGATCCGGC
GCGCTGCCCGTTGCCCGCCCCGCGGCCGCACGTGGGCGGGAGCGGCGGCCCGAGAGGAGCCCGAGGAGTAGGAGGAGGAAGAGGAGGGGA
CGCACGGCGGCGCAGCGGGGGACCTGGGGCAGCCCGCGCGAAGCCCCGCCCCGGCCCTGAGCCCCGCGCGCGCGCGGGCGGGATGCCCCG
CGGCCGCTGCACTTTGGCTCGAGCACTGCCCTGAGCCGGTCGGGCCCGCGGGCGCCATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCA
TCGATTGCAAGGTCCTGCCGCCCAACCACCGGGTGGTGTGGCCCTCGGCCGTGGTCTTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCC
TTCTGTGCCAGCTGCTGCACAACCTCTCCCCCGGCTCCATCGACCTCAAGGACATCAACTTCCGGCCGCAGATGTCCCAGGATCAGTTTG
ACAACTTAGAAAAACACACACAGTGGGGAATTGATATTCTTGAGAAATATATCAAGTTTGTGAAAGAAAGGACAGAGATTGAACTCAGCT
ATGCAAAGCAACTCAGGAATCTTTCAAAGAAGTACCAACCTAAAAAGAACTCGAAGGAGGAAGAAGAATACAAGTATACGTCATGTAAAG
CTTTCATTTCCAACCTGAACGAAATGAATGATTACGCAGGGCAGCATGAAGTTATCTCCGAGAACATGGCATCACAGATCATTGTGGACT
TGGCACGCTATGTTCAGGAACTGAAACAGGAGAGGAAATCAAACTTTCACGATGGCCGTAAAGCACAGCAGCACATCGAGACTTGCTGGA
AGCAGCTTGAATCTAGTAAAAGGCGATTTGAACGCGATTGCAAAGAGGCGGACAGGGCGCAGCAGTACTTTGAGAAAATGGACGCTGACA
TCAATGTCACAAAAGCGGATGTTGAAAAGGCCCGACAACAAGCTCAAATACGTCACCAAATGGCAGAGGACAGCAAAGCAGATTACTCAT
CCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATCCCCAACATCTTCCAGAAAATACAAGAGATGGAGGAAA
GGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGGCAGGTGATCCCAATCATTGGGAAGTGCCTGGATGGAA
TAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATAGAAGCTTATAAATCAGGGTTTGAGCCTCCTGGAGACA
TTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGCCTTTCAAATTCCAGAGGAGAAGGCAAACCAGACCTCA
AATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAGCTTATGTCCCTTTTAACATCCCCCCATCAGCCTCCCC
CTCCCCCTCCTGCCTCTGCCTCACCCTCTGCTGTTCCCAACGGCCCCCAGTCTCCCAAGCAGCAAAAGGAACCCCTCTCCCATCGCTTCA
ACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGTGGGCTTTCTCTCAAGCTGGGTGCAACACCGGAGGATT
TCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCGATGAGTTAAATAAAGAAATTCAGAAGGAGATGGATCAAA
GAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATGGGAGACCCAGCCAGTTTGGATCACAAATTAGCAGAAGTCA
GCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGCTGGCTGAGGTTGAAGGCCGGCTCCCAGCACGCAGCGAGC
AGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTCAACAACTGCGCCCAGGACCGTGAGAGCCCAGATGGCAGTT
ACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATTTTGACGACGAGTTTGATGATGAGGAGCCCCTCCCTGCCA
TAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACGATTTCCGTAGTTGAAGGAGAAACATTGTATGTCATAGAGG
AAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGGGTTATGTCCCCACTTCATATGTCGAAGTCTGTTTGGACA
AAAATGCCAAAGATTCCTAGAGGGGAGTGCCTGCGAGCCTCGGGTGAGCCTTCCTGGAGGAGCCTCCGTCTGCTTGTTCCCACAGGCCTC
CAGCGCCCTGCCCTGTGGACAGCCCACCCCTCCGCAGCCCCATCCCTGCGGGGCGGTCTCTCTCTCTCTCCAGCATGCTCCCTGCGGCCC
TGCCCTCCCGCCCAGCCCGGGCCACCTCGTGGGGGACAAGTCTCGCCAGCGCCCACCCCCATGGCTCGGGTCAGTCCTCATCGCTCCCCC
TCCCCACCCCGCGCAGGCCACTGAGACGGTGGGACACACGCCCCTACCTGCTCCTTCCTGGGCCCTCAGTCCACCCGGGCTCGTCCTGGC
AGCCCTTCCGCGCTTCACACAGTGCCTTTTGTGAAAGTGTCATCACGGGTCCCCTGAGGAGACAAGGCAGGTCCAGCGCACATCAGGCGG
ACTGAGCACTCGATGTCATCCGTGTCGATGTCATCCGTGTGTCCCAGACTGTCTGCTGTAGAAAACACTTCCTCCTCTCCTGAGTCTGTG
AAGTCCTCAGTGGTCCTTTTTGGATTCTAGGCTTGCACCTCATACTAAACATTGACCCTTTCACTATGCCCTCAACCTGGGAGCATCTGG
CAGGCAGGGGGGCAGGTACACACACACCCACAGGCACACCCACCAGTACACACGCGTGCGCATACACACATTTTGGTTTGACGCCCTGTT
TTCAGTGGCCTGGGGAGGTCCACACTGGAAGTCGAATTCCAGCTCGCCTTGTTGACTCGCCTGTGTCCACCGGCCATGAGGAGCCCACGC
CTGTCCTCCCCATCACTTTCCTGTCCCTGAGAACTGTAGATCATGCGCTTGTGAGCGAGGCCCTCCCCTCTGCACCAGCTCATTGCAAAG
CGAACATCCTCTCCTTTCCAGGAGCCCCAGGATTAGCATCTGAAAAGGGTAGCACTTCCTTTTTTGTTGTTGTTTTTTTTTTTTTTTTGA
GACGGGAGTCTCGCTCTATTGTTCAGACTGGAGTGCAGTGGCATGATCTCGGCTCACTACAACCTCCACCTCCTGGGTTCCAGCGATTCT
CCTGCCTCAGCCTCCCAAATAGCTGTGATTACAGGCGTGCACCACCACGCCCGGCTAATGTTTGTATTTTTAGTAGAGACAGGGTTTCAC
CGTGTTGGTCAGGCTGGTCTCAAACTCCTGACCTCAGGTGATCCGCCCGCCTCAGCCTCCCAAAGTGCTGAGATTACAGGTGTGAGCTAC
CGCACCCCGCCGAGGTTAGCACTTTCATCACCAAAGACCCCGTGCCTCTCGTGGTCCTTTGAGGGATCCCGCCGCCACCACCCTTGTATT
TTATCACGTGCTCTTCAGGGCATGTGGAATTCGTTGAGTTTGCTTTTAGAGCCAAGTTTCTTTCCCTGTGTGGGTTTTTGAGGAAAACCT
GAGGTCCCCTAATCTGTGGCCACCACCCCCCCCCCCCGCCACGCCTTAGAGCAGAGCAGCCCCTCCTCTCATTTGGTGCAGAAACAGTCA
AGAGGAACCATTGGCCTAGAGCTCCTGTGACCGAGAGCGCCACGGAAGCCTGGGGATGACGTCGGGCAGCTTTATTCTTTGCTTGGCTTT
GGTAACTAGGTGGTCCCCTCAAGCATCCTCAGTTCCTCTTGCTGTTTATGAATCTAAGACAAGGAAGTCCTATAGAAGCCAAAGGGACAG
GGACGGAAAGGACAGGTCCCAAGGGATGGGGCTGTCTTTACTTGTGGAAACCAGGAAATTGCTCCTCTCAGCCAACCAAGGTTGACCACA
CACCACCCTTCCGGAGCAGCTCAGTCAGCCCTCGGGGACGAGAAACCACAAGCGCAGAGACGCTGAGGCCCAGGCAGGTGAAGAGGAAGT
GGCTTTGGGTTTTTAAAGTAGGTGAGCGTGAGCCTCTCTGACTGCTTCTTCCCCGGGGGGGACTGCAAACCGCTCAGGGTTGCGGCAGAG
CCATGGACTTCCGGTCCCTGCAACGGGTGACCTAAGCGTGGTGCACCCATCAGTCACGCAGGAGGACTGACTTGACAGACGAAAGACAAG
CCCGGATGACACAGGGTGAGAAGAGTCAGGGCCGCACCTCTGTCCCTGCAAACCAACAGGTGCATGGTGAGTGTGGCAGTCCCCACAGCT
CCACAATGGGCTCCCCCGCCAACGGGGACGACAGGGATCTTCAGGAACTTCTGACCTCACCAAGTCAAGTGGACCACTCTCCACTCCACG
AGGATGTGAAACGGTTCTTTAAAATGGGATTTTAGAGCCTCGGGAATGCATGTGCGTCACATCTTTCATATTATGGGTCAGGATAGATTC
ATTTCTTGCAACATAGTGGAAAAGATATAAGCTGCAGTAATTTGCTCTTTGAATGACCGTCACCCCCAGTATAGGATATGCTTGTATCCC
CCCGTCACTCCTCCGCCTGTTTTTTAAACTTTTCCACCACCTGCGTCCAAAAAGAATGTTATAGCGAGTGCTCTTAAATGTTGAACCTGG
GTGTTGCTTCCGGGCCAGTCTGCGTGGCTCCATGAAAAGCTCACTGCTGCCCCAGCCGGGCTTCTTAGAGGAGGTCAGTTGTCCTATGTA
TCATCATTTACTCTGGGAATCCTACTGTGAAATCATGTCTGTATTTTTCTGGAGCAGTTCACATAGAGTAGAATGTGGAATTTCCCGTGA
ACGTCTCCTTCCTCCCCCGTATCTGCCGCCTGTCACTTCGCCACCGTGCTAGAATACTGTTGTGTTGTAAGATGACTAATTTTAAAAGAA
CCTGCCCTGAAAAGTTCTTAGAAACGCAGTGAAAGGGAGGAACTTGTCCTTTACCCAGTTTTTCCTTTGTAGGATGGGAAAGTATAAAAA
GGCACAGAAGGTTGTCATGGGCTGTTCCTTGGGGGTTTTTATCCTGCTCACCGTGGAGATAAGCCTGCGGCTTGTCTAACCAGCGCAGCG
CAAAGGTCTCGATGCCTTTTGGTAACATCCGTCATTGCAGAAGAAAGTTTACACGACGTCAAAAAGTGACGTTCATGCTAAGTGTTTTTC
CAGAAATATTGGTTTCATGTTTCTTATTGGCTCTGCCTCCTGTGCTTATATCATCCAAAAACTTTTTAAAAAGGTCCAGAATTCTATTTT
AACCTGATGTTGAGCACCTTTAAAATGTTCGTATGTGTGTTGCACTAATTCTAAACTTTGGAGGCATTTTGCTGTGTGAGGCCGATCGCC
ACTGTAAAGGTCCTAGAGTTGCCTGTTTGTCTCTGGAGATGGAATTAAACCAAATAAAGAGCTTCCACTGGAGGCTTGTATTGACCTTGT

>In-frame_VAV2_ENST00000371851_chr9_136857197_-_FNBP1_ENST00000420781_chr9_132757237_-_5685nt
CGCGGATTGGGGAGCGCTGCGGCGACTGGCTGCGTGGAGCCCGGCCCGGGGCCCGCAGGCACTTGCGTGTGTGAAGCGGGGAGATCCGGC
GCGCTGCCCGTTGCCCGCCCCGCGGCCGCACGTGGGCGGGAGCGGCGGCCCGAGAGGAGCCCGAGGAGTAGGAGGAGGAAGAGGAGGGGA
CGCACGGCGGCGCAGCGGGGGACCTGGGGCAGCCCGCGCGAAGCCCCGCCCCGGCCCTGAGCCCCGCGCGCGCGCGGGCGGGATGCCCCG
CGGCCGCTGCACTTTGGCTCGAGCACTGCCCTGAGCCGGTCGGGCCCGCGGGCGCCATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCA
TCGATTGCAAGGTCCTGCCGCCCAACCACCGGGTGGTGTGGCCCTCGGCCGTGGTCTTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCC
TTCTGTGCCAGCTGCTGCACAACCTCTCCCCCGGCTCCATCGACCTCAAGGACATCAACTTCCGGCCGCAGATGTCCCAGGATCAGTTTG
ACAACTTAGAAAAACACACACAGTGGGGAATTGATATTCTTGAGAAATATATCAAGTTTGTGAAAGAAAGGACAGAGATTGAACTCAGCT
ATGCAAAGCAACTCAGGAATCTTTCAAAGAAGTACCAACCTAAAAAGAACTCGAAGGAGGAAGAAGAATACAAGTATACGTCATGTAAAG
CTTTCATTTCCAACCTGAACGAAATGAATGATTACGCAGGGCAGCATGAAGTTATCTCCGAGAACATGGCATCACAGATCATTGTGGACT
TGGCACGCTATGTTCAGGAACTGAAACAGGAGAGGAAATCAAACTTTCACGATGGCCGTAAAGCACAGCAGCACATCGAGACTTGCTGGA
AGCAGCTTGAATCTAGTAAAAGGCGATTTGAACGCGATTGCAAAGAGGCGGACAGGGCGCAGCAGTACTTTGAGAAAATGGACGCTGACA
TCAATGTCACAAAAGCGGATGTTGAAAAGGCCCGACAACAAGCTCAAATACGTCACCAAATGGCAGAGGACAGCAAAGCAGATTACTCAT
CCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATCCCCAACATCTTCCAGAAAATACAAGAGATGGAGGAAA
GGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGGCAGGTGATCCCAATCATTGGGAAGTGCCTGGATGGAA
TAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATAGAAGCTTATAAATCAGGGTTTGAGCCTCCTGGAGACA
TTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGCCTTTCAAATTCCAGAGGAGAAGGCAAACCAGACCTCA
AATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAGCCTCCCCCTCCCCCTCCTGCCTCTGCCTCACCCTCTG
CTGTTCCCAACGGCCCCCAGTCTCCCAAGCAGCAAAAGGAACCCCTCTCCCATCGCTTCAACGAGTTCATGACCTCCAAACCCAAAATCC
ACTGCTTCAGGAGCCTAAAGCGTGGGCATAGCCTCACTCTGCAGGGTGCAACACCGGAGGATTTCAGCAACCTCCCACCTGAACAAAGAA
GGAAAAAGCTGCAGCAGAAAGTCGATGAGTTAAATAAAGAAATTCAGAAGGAGATGGATCAAAGAGATGCCATAACAAAAATGAAAGATG
TCTACCTAAAGAATCCTCAGATGGGAGACCCAGCCAGTTTGGATCACAAATTAGCAGAAGTCAGCCAAAATATAGAGAAACTGCGAGTAG
AGACCCAGAAATTTGAGGCCTGGCTGGCTGAGGTTGAAGGCCGGCTCCCAGCACGCAGCGAGCAGGCGCGCCGGCAGAGCGGACTGTACG
ACAGCCAGAACCCACCCACAGTCAACAACTGCGCCCAGGACCGTGAGAGCCCAGATGGCAGTTACACAGAGGAGCAGAGTCAGGAGAGTG
AGATGAAGGTGCTGGCCACGGATTTTGACGACGAGTTTGATGATGAGGAGCCCCTCCCTGCCATAGGGACGTGCAAAGCTCTCTACACAT
TTGAAGGTCAGAATGAAGGAACGATTTCCGTAGTTGAAGGAGAAACATTGTATGTCATAGAGGAAGACAAAGGCGATGGCTGGACCCGCA
TTCGGAGAAATGAAGATGAAGAGGGTTATGTCCCCACTTCATATGTCGAAGTCTGTTTGGACAAAAATGCCAAAGATTCCTAGAGGGGAG
TGCCTGCGAGCCTCGGGTGAGCCTTCCTGGAGGAGCCTCCGTCTGCTTGTTCCCACAGGCCTCCAGCGCCCTGCCCTGTGGACAGCCCAC
CCCTCCGCAGCCCCATCCCTGCGGGGCGGTCTCTCTCTCTCTCCAGCATGCTCCCTGCGGCCCTGCCCTCCCGCCCAGCCCGGGCCACCT
CGTGGGGGACAAGTCTCGCCAGCGCCCACCCCCATGGCTCGGGTCAGTCCTCATCGCTCCCCCTCCCCACCCCGCGCAGGCCACTGAGAC
GGTGGGACACACGCCCCTACCTGCTCCTTCCTGGGCCCTCAGTCCACCCGGGCTCGTCCTGGCAGCCCTTCCGCGCTTCACACAGTGCCT
TTTGTGAAAGTGTCATCACGGGTCCCCTGAGGAGACAAGGCAGGTCCAGCGCACATCAGGCGGACTGAGCACTCGATGTCATCCGTGTCG
ATGTCATCCGTGTGTCCCAGACTGTCTGCTGTAGAAAACACTTCCTCCTCTCCTGAGTCTGTGAAGTCCTCAGTGGTCCTTTTTGGATTC
TAGGCTTGCACCTCATACTAAACATTGACCCTTTCACTATGCCCTCAACCTGGGAGCATCTGGCAGGCAGGGGGGCAGGTACACACACAC
CCACAGGCACACCCACCAGTACACACGCGTGCGCATACACACATTTTGGTTTGACGCCCTGTTTTCAGTGGCCTGGGGAGGTCCACACTG
GAAGTCGAATTCCAGCTCGCCTTGTTGACTCGCCTGTGTCCACCGGCCATGAGGAGCCCACGCCTGTCCTCCCCATCACTTTCCTGTCCC
TGAGAACTGTAGATCATGCGCTTGTGAGCGAGGCCCTCCCCTCTGCACCAGCTCATTGCAAAGCGAACATCCTCTCCTTTCCAGGAGCCC
CAGGATTAGCATCTGAAAAGGGTAGCACTTCCTTTTTTGTTGTTGTTTTTTTTTTTTTTTTGAGACGGGAGTCTCGCTCTATTGTTCAGA
CTGGAGTGCAGTGGCATGATCTCGGCTCACTACAACCTCCACCTCCTGGGTTCCAGCGATTCTCCTGCCTCAGCCTCCCAAATAGCTGTG
ATTACAGGCGTGCACCACCACGCCCGGCTAATGTTTGTATTTTTAGTAGAGACAGGGTTTCACCGTGTTGGTCAGGCTGGTCTCAAACTC
CTGACCTCAGGTGATCCGCCCGCCTCAGCCTCCCAAAGTGCTGAGATTACAGGTGTGAGCTACCGCACCCCGCCGAGGTTAGCACTTTCA
TCACCAAAGACCCCGTGCCTCTCGTGGTCCTTTGAGGGATCCCGCCGCCACCACCCTTGTATTTTATCACGTGCTCTTCAGGGCATGTGG
AATTCGTTGAGTTTGCTTTTAGAGCCAAGTTTCTTTCCCTGTGTGGGTTTTTGAGGAAAACCTGAGGTCCCCTAATCTGTGGCCACCACC
CCCCCCCCCCGCCACGCCTTAGAGCAGAGCAGCCCCTCCTCTCATTTGGTGCAGAAACAGTCAAGAGGAACCATTGGCCTAGAGCTCCTG
TGACCGAGAGCGCCACGGAAGCCTGGGGATGACGTCGGGCAGCTTTATTCTTTGCTTGGCTTTGGTAACTAGGTGGTCCCCTCAAGCATC
CTCAGTTCCTCTTGCTGTTTATGAATCTAAGACAAGGAAGTCCTATAGAAGCCAAAGGGACAGGGACGGAAAGGACAGGTCCCAAGGGAT
GGGGCTGTCTTTACTTGTGGAAACCAGGAAATTGCTCCTCTCAGCCAACCAAGGTTGACCACACACCACCCTTCCGGAGCAGCTCAGTCA
GCCCTCGGGGACGAGAAACCACAAGCGCAGAGACGCTGAGGCCCAGGCAGGTGAAGAGGAAGTGGCTTTGGGTTTTTAAAGTAGGTGAGC
GTGAGCCTCTCTGACTGCTTCTTCCCCGGGGGGGACTGCAAACCGCTCAGGGTTGCGGCAGAGCCATGGACTTCCGGTCCCTGCAACGGG
TGACCTAAGCGTGGTGCACCCATCAGTCACGCAGGAGGACTGACTTGACAGACGAAAGACAAGCCCGGATGACACAGGGTGAGAAGAGTC
AGGGCCGCACCTCTGTCCCTGCAAACCAACAGGTGCATGGTGAGTGTGGCAGTCCCCACAGCTCCACAATGGGCTCCCCCGCCAACGGGG
ACGACAGGGATCTTCAGGAACTTCTGACCTCACCAAGTCAAGTGGACCACTCTCCACTCCACGAGGATGTGAAACGGTTCTTTAAAATGG
GATTTTAGAGCCTCGGGAATGCATGTGCGTCACATCTTTCATATTATGGGTCAGGATAGATTCATTTCTTGCAACATAGTGGAAAAGATA
TAAGCTGCAGTAATTTGCTCTTTGAATGACCGTCACCCCCAGTATAGGATATGCTTGTATCCCCCCGTCACTCCTCCGCCTGTTTTTTAA
ACTTTTCCACCACCTGCGTCCAAAAAGAATGTTATAGCGAGTGCTCTTAAATGTTGAACCTGGGTGTTGCTTCCGGGCCAGTCTGCGTGG
CTCCATGAAAAGCTCACTGCTGCCCCAGCCGGGCTTCTTAGAGGAGGTCAGTTGTCCTATGTATCATCATTTACTCTGGGAATCCTACTG
TGAAATCATGTCTGTATTTTTCTGGAGCAGTTCACATAGAGTAGAATGTGGAATTTCCCGTGAACGTCTCCTTCCTCCCCCGTATCTGCC
GCCTGTCACTTCGCCACCGTGCTAGAATACTGTTGTGTTGTAAGATGACTAATTTTAAAAGAACCTGCCCTGAAAAGTTCTTAGAAACGC
AGTGAAAGGGAGGAACTTGTCCTTTACCCAGTTTTTCCTTTGTAGGATGGGAAAGTATAAAAAGGCACAGAAGGTTGTCATGGGCTGTTC
CTTGGGGGTTTTTATCCTGCTCACCGTGGAGATAAGCCTGCGGCTTGTCTAACCAGCGCAGCGCAAAGGTCTCGATGCCTTTTGGTAACA
TCCGTCATTGCAGAAGAAAGTTTACACGACGTCAAAAAGTGACGTTCATGCTAAGTGTTTTTCCAGAAATATTGGTTTCATGTTTCTTAT
TGGCTCTGCCTCCTGTGCTTATATCATCCAAAAACTTTTTAAAAAGGTCCAGAATTCTATTTTAACCTGATGTTGAGCACCTTTAAAATG
TTCGTATGTGTGTTGCACTAATTCTAAACTTTGGAGGCATTTTGCTGTGTGAGGCCGATCGCCACTGTAAAGGTCCTAGAGTTGCCTGTT
TGTCTCTGGAGATGGAATTAAACCAAATAAAGAGCTTCCACTGGAGGCTTGTATTGACCTTGTAACTATATGTTAATCTCGTGTTAAAAT

>In-frame_VAV2_ENST00000371851_chr9_136857197_-_FNBP1_ENST00000355681_chr9_132757237_-_2291nt
CGCGGATTGGGGAGCGCTGCGGCGACTGGCTGCGTGGAGCCCGGCCCGGGGCCCGCAGGCACTTGCGTGTGTGAAGCGGGGAGATCCGGC
GCGCTGCCCGTTGCCCGCCCCGCGGCCGCACGTGGGCGGGAGCGGCGGCCCGAGAGGAGCCCGAGGAGTAGGAGGAGGAAGAGGAGGGGA
CGCACGGCGGCGCAGCGGGGGACCTGGGGCAGCCCGCGCGAAGCCCCGCCCCGGCCCTGAGCCCCGCGCGCGCGCGGGCGGGATGCCCCG
CGGCCGCTGCACTTTGGCTCGAGCACTGCCCTGAGCCGGTCGGGCCCGCGGGCGCCATGGAGCAGTGGCGGCAGTGCGGCCGCTGGCTCA
TCGATTGCAAGGTCCTGCCGCCCAACCACCGGGTGGTGTGGCCCTCGGCCGTGGTCTTCGACCTGGCGCAGGCGCTGCGCGACGGGGTCC
TTCTGTGCCAGCTGCTGCACAACCTCTCCCCCGGCTCCATCGACCTCAAGGACATCAACTTCCGGCCGCAGATGTCCCAGGATCAGTTTG
ACAACTTAGAAAAACACACACAGTGGGGAATTGATATTCTTGAGAAATATATCAAGTTTGTGAAAGAAAGGACAGAGATTGAACTCAGCT
ATGCAAAGCAACTCAGGAATCTTTCAAAGAAGTACCAACCTAAAAAGAACTCGAAGGAGGAAGAAGAATACAAGTATACGTCATGTAAAG
CTTTCATTTCCAACCTGAACGAAATGAATGATTACGCAGGGCAGCATGAAGTTATCTCCGAGAACATGGCATCACAGATCATTGTGGACT
TGGCACGCTATGTTCAGGAACTGAAACAGGAGAGGAAATCAAACTTTCACGATGGCCGTAAAGCACAGCAGCACATCGAGACTTGCTGGA
AGCAGCTTGAATCTAGTAAAAGGCGATTTGAACGCGATTGCAAAGAGGCGGACAGGGCGCAGCAGTACTTTGAGAAAATGGACGCTGACA
TCAATGTCACAAAAGCGGATGTTGAAAAGGCCCGACAACAAGCTCAAATACGTCACCAAATGGCAGAGGACAGCAAAGCAGATTACTCAT
CCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATCCCCAACATCTTCCAGAAAATACAAGAGATGGAGGAAA
GGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGGCAGGTGATCCCAATCATTGGGAAGTGCCTGGATGGAA
TAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATAGAAGCTTATAAATCAGGGTTTGAGCCTCCTGGAGACA
TTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGCCTTTCAAATTCCAGAGGAGAAGGCAAACCAGACCTCA
AATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAGTCTCCCAAGCAGCAAAAGGAACCCCTCTCCCATCGCT
TCAACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGTGGGCTTTCTCTCAAGCTGGGTGCAACACCGGAGG
ATTTCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCGATGAGTTAAATAAAGAAATTCAGAAGGAGATGGATC
AAAGAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATGGGAGACCCAGCCAGTTTGGATCACAAATTAGCAGAAG
TCAGCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGCTGGCTGAGGTTGAAGGCCGGCTCCCAGCACGCAGCG
AGCAGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTCAACAACTGCGCCCAGGACCGTGAGAGCCCAGATGGCA
GTTACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATTTTGACGACGAGTTTGATGATGAGGAGCCCCTCCCTG
CCATAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACGATTTCCGTAGTTGAAGGAGAAACATTGTATGTCATAG
AGGAAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGGGTTATGTCCCCACTTCATATGTCGAAGTCTGTTTGG


Top

FusionGenePPI for VAV2_FNBP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
VAV2GRB2, SOCS1, PDGFRB, EGFR, CD44, CD19, CBL, CCNO, BRDT, EIF4G3, RBBP6, ST13, TOM1L1, VCPIP1, PNMA1, BOD1L1, SRRT, FNTA, TCP11, MARCH7, HSPH1, BZW1, SERBP1, USP38, UBE4B, GAPVD1, POGZ, MRGBP, TARBP2, SF3A3, SNW1, IPO4, FUCA1, CHMP3, NCKAP5, CEP170, MED21, RAD23A, HNRNPF, DNAJC21, TTN, CCT3, DCUN1D4, STK24, PHF10, PPM1B, ARIH1, BIRC6, SRPK2, CCT2, CRCP, ELAVL1, SYK, FYN, SMAD3, CBLB, THOP1, ERBB2, ERBB3, CAV1, NTRK1, TPD52L2, PRKAR2B, RTEL1, TRIM25FNBP1TNKS, AKAP9, FNBP1, DNM1, EGF, TF, SNX2, FASLG, ARHGAP17, TUBB, HSPA1A, WAS, GABARAP, ITSN1, ELAVL1, WASL, DNM2, SHMT2, NXF1, FCHO1, PPP2CA, MYO1E, SF3A1, TMEM17, RBPJ, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneFNBP1chr9:136857197chr9:132757237ENST00000355681-016550_6178593ARHGAP17%2C DAAM1%2C DIAPH1 and DIAPH2
TgeneFNBP1chr9:136857197chr9:132757237ENST00000446176-017550_6178618ARHGAP17%2C DAAM1%2C DIAPH1 and DIAPH2
TgeneFNBP1chr9:136857197chr9:132757237ENST00000355681-016535_6178593DNM1 and DNM3
TgeneFNBP1chr9:136857197chr9:132757237ENST00000446176-017535_6178618DNM1 and DNM3
TgeneFNBP1chr9:136857197chr9:132757237ENST00000355681-016553_6098593DNM2 and WASL
TgeneFNBP1chr9:136857197chr9:132757237ENST00000446176-017553_6098618DNM2 and WASL
TgeneFNBP1chr9:136857197chr9:132757237ENST00000355681-016553_6108593FASLG
TgeneFNBP1chr9:136857197chr9:132757237ENST00000446176-017553_6108618FASLG
TgeneFNBP1chr9:136857197chr9:132757237ENST00000355681-016495_6178593PDE6G
TgeneFNBP1chr9:136857197chr9:132757237ENST00000446176-017495_6178618PDE6G
TgeneFNBP1chr9:136857197chr9:132757237ENST00000355681-016400_5528593RND2
TgeneFNBP1chr9:136857197chr9:132757237ENST00000446176-017400_5528618RND2


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneFNBP1chr9:136857197chr9:132757237ENST00000355681-0161_3358593microtubules
TgeneFNBP1chr9:136857197chr9:132757237ENST00000446176-0171_3358618microtubules


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for VAV2_FNBP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for VAV2_FNBP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource