FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41364

FusionGeneSummary for VAT1_CTNND1

check button Fusion gene summary
Fusion gene informationFusion gene name: VAT1_CTNND1
Fusion gene ID: 41364
HgeneTgene
Gene symbol

VAT1

CTNND1

Gene ID

10493

1500

Gene namevesicle amine transport 1catenin delta 1
SynonymsVATIBCDS2|CAS|CTNND|P120CAS|P120CTN|p120|p120(CAS)|p120(CTN)
Cytomap

17q21.31

11q12.1

Type of geneprotein-codingprotein-coding
Descriptionsynaptic vesicle membrane protein VAT-1 homologmembrane protein of cholinergic synaptic vesiclesvesicle amine transport protein 1 homolog (T. californica)catenin delta-1cadherin-associated Src substratecatenin (cadherin-associated protein), delta 1p120 catenin
Modification date2018051920180523
UniProtAcc

Q99536

O60716

Ensembl transtripts involved in fusion geneENST00000355653, ENST00000587173, 
ENST00000420567, 
ENST00000524630, 
ENST00000529919, ENST00000399039, 
ENST00000360682, ENST00000361796, 
ENST00000361391, ENST00000530094, 
ENST00000428599, ENST00000361332, 
ENST00000527467, ENST00000415361, 
ENST00000532245, ENST00000532463, 
ENST00000528232, ENST00000529986, 
ENST00000531014, ENST00000358694, 
ENST00000526772, ENST00000532787, 
ENST00000533667, ENST00000529873, 
ENST00000525902, ENST00000529526, 
ENST00000532649, ENST00000426142, 
ENST00000532844, ENST00000528621, 
ENST00000399050, ENST00000526357, 
ENST00000530748, ENST00000534579, 
ENST00000526938, 
Fusion gene scores* DoF score8 X 6 X 2=968 X 7 X 5=280
# samples 99
** MAII scorelog2(9/96*10)=-0.0931094043914815
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/280*10)=-1.63742992061529
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: VAT1 [Title/Abstract] AND CTNND1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-ER-A2NE-06AVAT1chr17

41166624

-CTNND1chr11

57574387

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000355653ENST00000524630VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000529919VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000399039VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000360682VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000361796VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000361391VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000530094VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000428599VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000361332VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000527467VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000415361VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000532245VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000532463VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000528232VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000529986VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000531014VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000358694VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000526772VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000532787VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000533667VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000529873VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000525902VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000529526VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000532649VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000426142VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000532844VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000528621VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000399050VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000526357VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000530748VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000534579VAT1chr17

41166624

-CTNND1chr11

57574387

+
In-frameENST00000355653ENST00000526938VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000524630VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000529919VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000399039VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000360682VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000361796VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000361391VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000530094VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000428599VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000361332VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000527467VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000415361VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000532245VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000532463VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000528232VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000529986VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000531014VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000358694VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000526772VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000532787VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000533667VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000529873VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000525902VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000529526VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000532649VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000426142VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000532844VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000528621VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000399050VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000526357VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000530748VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000534579VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000587173ENST00000526938VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000524630VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000529919VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000399039VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000360682VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000361796VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000361391VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000530094VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000428599VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000361332VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000527467VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000415361VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000532245VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000532463VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000528232VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000529986VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000531014VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000358694VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000526772VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000532787VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000533667VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000529873VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000525902VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000529526VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000532649VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000426142VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000532844VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000528621VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000399050VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000526357VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000530748VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000534579VAT1chr17

41166624

-CTNND1chr11

57574387

+
intron-3CDSENST00000420567ENST00000526938VAT1chr17

41166624

-CTNND1chr11

57574387

+

Top

FusionProtFeatures for VAT1_CTNND1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
VAT1

Q99536

CTNND1

O60716

Possesses ATPase activity (By similarity). Plays a partin calcium-regulated keratinocyte activation in epidermal repairmechanisms. Has no effect on cell proliferation. Negativelyregulates mitochondrial fusion in cooperation with mitofusinproteins (MFN1-2). {ECO:0000250, ECO:0000269|PubMed:12898150,ECO:0000269|PubMed:17105775, ECO:0000269|PubMed:19508442}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCTNND1chr17:41166624chr11:57574387ENST00000358694+919653_693625934RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000358694+919700_739625934RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000358694+919740_780625934RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000358694+919781_826625934RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000360682+1020653_693631948RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000360682+1020700_739631948RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000360682+1020740_780631948RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000360682+1020781_826631948RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361332+920653_693625963RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361332+920700_739625963RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361332+920740_780625963RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361332+920781_826625963RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361391+919653_693625942RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361391+919700_739625942RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361391+919740_780625942RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361391+919781_826625942RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361796+919653_693625934RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361796+919700_739625934RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361796+919740_780625934RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361796+919781_826625934RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000399050+1021653_693631969RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000399050+1021700_739631969RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000399050+1021740_780631969RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000399050+1021781_826631969RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000415361+819534_573530868RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000415361+819583_624530868RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000415361+819653_693530868RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000415361+819700_739530868RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000415361+819740_780530868RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000415361+819781_826530868RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000426142+717534_573524833RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000426142+717583_624524833RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000426142+717653_693524833RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000426142+717700_739524833RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000426142+717740_780524833RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000426142+717781_826524833RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000428599+818653_693625934RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000428599+818700_739625934RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000428599+818740_780625934RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000428599+818781_826625934RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000524630+919653_693625934RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000524630+919700_739625934RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000524630+919740_780625934RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000524630+919781_826625934RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000525902+515358_395308617RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000525902+515398_437308617RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000525902+515441_475308617RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000525902+515476_516308617RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000525902+515534_573308617RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000525902+515583_624308617RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000525902+515653_693308617RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000525902+515700_739308617RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000525902+515740_780308617RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000525902+515781_826308617RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526357+819583_624571909RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526357+819653_693571909RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526357+819700_739571909RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526357+819740_780571909RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526357+819781_826571909RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526772+414358_395302611RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526772+414398_437302611RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526772+414441_475302611RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526772+414476_516302611RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526772+414534_573302611RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526772+414583_624302611RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526772+414653_693302611RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526772+414700_739302611RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526772+414740_780302611RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526772+414781_826302611RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526938+918653_693631919RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526938+918700_739631919RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526938+918740_780631919RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526938+918781_826631919RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000527467+516358_395308646RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000527467+516398_437308646RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000527467+516441_475308646RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000527467+516476_516308646RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000527467+516534_573308646RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000527467+516583_624308646RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000527467+516653_693308646RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000527467+516700_739308646RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000527467+516740_780308646RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000527467+516781_826308646RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528232+818534_573530839RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528232+818583_624530839RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528232+818653_693530839RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528232+818700_739530839RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528232+818740_780530839RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528232+818781_826530839RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528621+818583_624571880RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528621+818653_693571880RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528621+818700_739571880RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528621+818740_780571880RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528621+818781_826571880RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529526+919583_624571880RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529526+919653_693571880RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529526+919700_739571880RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529526+919740_780571880RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529526+919781_826571880RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529873+818583_624571888RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529873+818653_693571888RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529873+818700_739571888RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529873+818740_780571888RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529873+818781_826571888RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529986+717534_573524833RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529986+717583_624524833RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529986+717653_693524833RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529986+717700_739524833RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529986+717740_780524833RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529986+717781_826524833RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530094+718534_573524862RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530094+718583_624524862RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530094+718653_693524862RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530094+718700_739524862RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530094+718740_780524862RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530094+718781_826524862RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530748+919583_624577886RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530748+919653_693577886RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530748+919700_739577886RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530748+919740_780577886RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530748+919781_826577886RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000531014+415358_395302640RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000531014+415398_437302640RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000531014+415441_475302640RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000531014+415476_516302640RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000531014+415534_573302640RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000531014+415583_624302640RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000531014+415653_693302640RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000531014+415700_739302640RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000531014+415740_780302640RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000531014+415781_826302640RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532245+616534_573524833RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532245+616583_624524833RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532245+616653_693524833RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532245+616700_739524833RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532245+616740_780524833RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532245+616781_826524833RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532463+717534_573524833RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532463+717583_624524833RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532463+717653_693524833RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532463+717700_739524833RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532463+717740_780524833RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532463+717781_826524833RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532649+919583_624571880RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532649+919653_693571880RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532649+919700_739571880RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532649+919740_780571880RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532649+919781_826571880RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532787+717534_573524841RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532787+717583_624524841RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532787+717653_693524841RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532787+717700_739524841RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532787+717740_780524841RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532787+717781_826524841RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532844+920583_624577915RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532844+920653_693577915RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532844+920700_739577915RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532844+920740_780577915RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532844+920781_826577915RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000533667+414358_395302619RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000533667+414398_437302619RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000533667+414441_475302619RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000533667+414476_516302619RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000533667+414534_573302619RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000533667+414583_624302619RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000533667+414653_693302619RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000533667+414700_739302619RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000533667+414740_780302619RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000533667+414781_826302619RepeatNote=ARM 10
TgeneCTNND1chr17:41166624chr11:57574387ENST00000534579+919583_624571880RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000534579+919653_693571880RepeatNote=ARM 7
TgeneCTNND1chr17:41166624chr11:57574387ENST00000534579+919700_739571880RepeatNote=ARM 8
TgeneCTNND1chr17:41166624chr11:57574387ENST00000534579+919740_780571880RepeatNote=ARM 9
TgeneCTNND1chr17:41166624chr11:57574387ENST00000534579+919781_826571880RepeatNote=ARM 10

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCTNND1chr17:41166624chr11:57574387ENST00000358694+91910_46625934Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000360682+102010_46631948Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361332+92010_46625963Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361391+91910_46625942Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361796+91910_46625934Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000399050+102110_46631969Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000415361+81910_46530868Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000426142+71710_46524833Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000428599+81810_46625934Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000524630+91910_46625934Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000525902+51510_46308617Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526357+81910_46571909Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526772+41410_46302611Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526938+91810_46631919Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000527467+51610_46308646Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528232+81810_46530839Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528621+81810_46571880Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529526+91910_46571880Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529873+81810_46571888Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529986+71710_46524833Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530094+71810_46524862Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530748+91910_46577886Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000531014+41510_46302640Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532245+61610_46524833Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532463+71710_46524833Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532649+91910_46571880Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532787+71710_46524841Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532844+92010_46577915Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000533667+41410_46302619Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000534579+91910_46571880Coiled coilOntology_term=ECO:0000255
TgeneCTNND1chr17:41166624chr11:57574387ENST00000358694+919358_395625934RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000358694+919398_437625934RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000358694+919441_475625934RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000358694+919476_516625934RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000358694+919534_573625934RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000358694+919583_624625934RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000360682+1020358_395631948RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000360682+1020398_437631948RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000360682+1020441_475631948RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000360682+1020476_516631948RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000360682+1020534_573631948RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000360682+1020583_624631948RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361332+920358_395625963RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361332+920398_437625963RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361332+920441_475625963RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361332+920476_516625963RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361332+920534_573625963RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361332+920583_624625963RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361391+919358_395625942RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361391+919398_437625942RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361391+919441_475625942RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361391+919476_516625942RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361391+919534_573625942RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361391+919583_624625942RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361796+919358_395625934RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361796+919398_437625934RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361796+919441_475625934RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361796+919476_516625934RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361796+919534_573625934RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000361796+919583_624625934RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000399050+1021358_395631969RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000399050+1021398_437631969RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000399050+1021441_475631969RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000399050+1021476_516631969RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000399050+1021534_573631969RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000399050+1021583_624631969RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000415361+819358_395530868RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000415361+819398_437530868RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000415361+819441_475530868RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000415361+819476_516530868RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000426142+717358_395524833RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000426142+717398_437524833RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000426142+717441_475524833RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000426142+717476_516524833RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000428599+818358_395625934RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000428599+818398_437625934RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000428599+818441_475625934RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000428599+818476_516625934RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000428599+818534_573625934RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000428599+818583_624625934RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000524630+919358_395625934RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000524630+919398_437625934RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000524630+919441_475625934RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000524630+919476_516625934RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000524630+919534_573625934RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000524630+919583_624625934RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526357+819358_395571909RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526357+819398_437571909RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526357+819441_475571909RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526357+819476_516571909RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526357+819534_573571909RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526938+918358_395631919RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526938+918398_437631919RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526938+918441_475631919RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526938+918476_516631919RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526938+918534_573631919RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000526938+918583_624631919RepeatNote=ARM 6
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528232+818358_395530839RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528232+818398_437530839RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528232+818441_475530839RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528232+818476_516530839RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528621+818358_395571880RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528621+818398_437571880RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528621+818441_475571880RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528621+818476_516571880RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000528621+818534_573571880RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529526+919358_395571880RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529526+919398_437571880RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529526+919441_475571880RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529526+919476_516571880RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529526+919534_573571880RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529873+818358_395571888RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529873+818398_437571888RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529873+818441_475571888RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529873+818476_516571888RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529873+818534_573571888RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529986+717358_395524833RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529986+717398_437524833RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529986+717441_475524833RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000529986+717476_516524833RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530094+718358_395524862RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530094+718398_437524862RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530094+718441_475524862RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530094+718476_516524862RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530748+919358_395577886RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530748+919398_437577886RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530748+919441_475577886RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530748+919476_516577886RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000530748+919534_573577886RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532245+616358_395524833RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532245+616398_437524833RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532245+616441_475524833RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532245+616476_516524833RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532463+717358_395524833RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532463+717398_437524833RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532463+717441_475524833RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532463+717476_516524833RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532649+919358_395571880RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532649+919398_437571880RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532649+919441_475571880RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532649+919476_516571880RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532649+919534_573571880RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532787+717358_395524841RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532787+717398_437524841RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532787+717441_475524841RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532787+717476_516524841RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532844+920358_395577915RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532844+920398_437577915RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532844+920441_475577915RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532844+920476_516577915RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000532844+920534_573577915RepeatNote=ARM 5
TgeneCTNND1chr17:41166624chr11:57574387ENST00000534579+919358_395571880RepeatNote=ARM 1
TgeneCTNND1chr17:41166624chr11:57574387ENST00000534579+919398_437571880RepeatNote=ARM 2
TgeneCTNND1chr17:41166624chr11:57574387ENST00000534579+919441_475571880RepeatNote=ARM 3
TgeneCTNND1chr17:41166624chr11:57574387ENST00000534579+919476_516571880RepeatNote=ARM 4
TgeneCTNND1chr17:41166624chr11:57574387ENST00000534579+919534_573571880RepeatNote=ARM 5


Top

FusionGeneSequence for VAT1_CTNND1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000524630_chr11_57574387_+_308aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000529919_chr11_57574387_+_307aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000399039_chr11_57574387_+_307aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000360682_chr11_57574387_+_316aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQITTIPHQMREETTIEHWIDRGI

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000361796_chr11_57574387_+_308aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000361391_chr11_57574387_+_316aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQITTIPHQMREETTIEHWIDRGI

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000530094_chr11_57574387_+_337aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000428599_chr11_57574387_+_308aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000361332_chr11_57574387_+_337aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000527467_chr11_57574387_+_337aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000415361_chr11_57574387_+_337aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000532245_chr11_57574387_+_308aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000532463_chr11_57574387_+_308aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000528232_chr11_57574387_+_308aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000529986_chr11_57574387_+_308aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000531014_chr11_57574387_+_337aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000358694_chr11_57574387_+_308aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000526772_chr11_57574387_+_308aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000532787_chr11_57574387_+_316aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQITTIPHQMREETTIEHWIDRGI

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000533667_chr11_57574387_+_316aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQITTIPHQMREETTIEHWIDRGI

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000529873_chr11_57574387_+_316aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQITTIPHQMREETTIEHWIDRGI

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000525902_chr11_57574387_+_308aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000529526_chr11_57574387_+_308aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000532649_chr11_57574387_+_308aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000426142_chr11_57574387_+_308aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000532844_chr11_57574387_+_337aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000528621_chr11_57574387_+_308aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000399050_chr11_57574387_+_337aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000526357_chr11_57574387_+_337aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000530748_chr11_57574387_+_308aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000534579_chr11_57574387_+_308aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQIRNLIGKKFR_AIWDQTQNH_I

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000526938_chr11_57574387_+_287aa
GKNL_RIQQTIQWISLKERVQLEAMSSTFSQRWFGTTSHFLRRARLLPS_KPQLELSRTCVLGAGRMVDTSALLCVKRRLFLP_LTS_LM
NMNGW_KLHLEH_ETWLWMLATKN_LVNMLFLTW_RICQEDSRTPLGISLRTLSSLF_TLSTRLSLRTWRLPKSFERHRVLRSWC_STNQ
GTAQKKKFEQQHLTYRQSGDIRNCGSHWKKKDGRNQTFR_I_TMLPEARAVIHMMIVLSLSLTGTKNQITTIPHQMREETTIEHWIDRGI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000524630_chr11_57574387_+_926nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000529919_chr11_57574387_+_923nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000399039_chr11_57574387_+_923nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000360682_chr11_57574387_+_950nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATC
TAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTT

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000361796_chr11_57574387_+_926nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000361391_chr11_57574387_+_950nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATC
TAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTT

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000530094_chr11_57574387_+_1013nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA
CAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTT

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000428599_chr11_57574387_+_926nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000361332_chr11_57574387_+_1013nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA
CAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTT

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000527467_chr11_57574387_+_1013nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA
CAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTT

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000415361_chr11_57574387_+_1013nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA
CAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTT

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000532245_chr11_57574387_+_926nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000532463_chr11_57574387_+_926nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000528232_chr11_57574387_+_926nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000529986_chr11_57574387_+_926nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000531014_chr11_57574387_+_1013nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA
CAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTT

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000358694_chr11_57574387_+_926nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000526772_chr11_57574387_+_926nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000532787_chr11_57574387_+_950nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATC
TAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTT

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000533667_chr11_57574387_+_950nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATC
TAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTT

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000529873_chr11_57574387_+_950nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATC
TAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTT

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000525902_chr11_57574387_+_926nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000529526_chr11_57574387_+_926nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000532649_chr11_57574387_+_926nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000426142_chr11_57574387_+_926nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000532844_chr11_57574387_+_1013nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA
CAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTT

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000528621_chr11_57574387_+_926nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000399050_chr11_57574387_+_1013nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA
CAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTT

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000526357_chr11_57574387_+_1013nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA
CAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTT

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000530748_chr11_57574387_+_926nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000534579_chr11_57574387_+_926nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATGAGCAATATGGGATCAAACACAAAATCACTAGATA
ACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000526938_chr11_57574387_+_863nt
GGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACGAGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGC
CAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATCCTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGT
GTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAGGCTCTTTCTGCCATAGCTGACCTCCTGACTAATG
AACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGATGCTCGCAACAAAGAATTAATTGGTAAACATGCTA
TTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTCTCTGAGGACACTGTCATCTCTATTTTGAACACTA
TCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAGGGTATTGAGAAGCTGGTGTTGATCAACAAATCAG
GGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGGGGATATAAGGAACTGCGGAAGCCACTGGAAAAAG
AAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAGAGCAGTCATTCATATGATGATAGTACTCTCCCTC
TCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCGGGGGATC


* Fusion transcript sequences (Full-length transcript).
>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000524630_chr11_57574387_+_6898nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA
ATGCTTTCTGTATGCCCAAATCTTTAGATTAAAATTATATAGCTGCTCCTGATGATGGTCCTGTCTTGTTTTATTGAACTAGGACTTGGG
TATGAAAACTTTCATGGGCTAGTGAGACCAGGAAATCAACTAGCTTTTAAAGCTTGATTTGTGTCTAACAATTGTAGTGTTAGATTAGAG
GTTGAAGTACAAAGCCAAAAAGCTATTAAGAGTTTACTTTCCAAAGAGTTTTGATAGCCCTGCTTGAGATGATTTTTATCTAAATAGAAA
AGCCTGGCTGCTTGTCAGCAACACTTTATTTCCCTGTTATGTTCTTATCCTTTGGCATTGAGCTAGATACAAACCCTACTCTTCTCTCTT

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000529919_chr11_57574387_+_5289nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATATG
TACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCT
TACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCC
CTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGA
ACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTATAT
GCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGG
AAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACCCT
TGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTCCA
TCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGAT
ATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGA
TGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCG
TTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCTGT
CCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATG
TGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAG
AAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAG
CATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTA
GGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACT
TTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTATTT

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000399039_chr11_57574387_+_5697nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATATG
TACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCT
TACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCC
CTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGA
ACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTATAT
GCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGG
AAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACCCT
TGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTCCA
TCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGAT
ATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGA
TGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCG
TTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCTGT
CCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATG
TGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAG
AAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAG
CATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTA
GGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACT
TTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTATTT
GCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCATTTCTTCCCAC
TTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCCATCCAGACCT
GGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAACAGCCGTGGG
CTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATCCCACCTTCCC
ACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACAAATGAGTTTT

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000360682_chr11_57574387_+_6555nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGA
GACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAG
GAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATGCAGAAGATTTAGCACCAC
TATCTCCGTTCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGT
GCCAACTGCCAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTG
TCTCAACGCCTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGAT
TAGTTCTTTTTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGG
AAGAATTGGAAGTTACATGCTGTATATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAG
GGACTTTTATTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATT
GGCACATGCCACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCA
GGGACCATCAAGAACCTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTC
CTTAACCCACCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAG
ACTTTTGGTAGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAG
TCTGAAACTGGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACT
AAAGGACTTGATGTACATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTG
GGGTGCATCTCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTC
TTACCTACTATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTT
CAGTCATAGCAAGCTTTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGA
AGTGAGTGGTGTGACTCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCC
CTCCCTCCAGTATTGCCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTAT
TATTATTTCTAATCCTTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCC
TCTCTTCCCCTTCCCTTATATATTGAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTT
ATTTACCCTTTTCCCCCTTCCCATTTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGC
ACACTGCACAGGGAAAATTGCCCCATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTT
CTCGGTGGGGTGTGGGTAATAGAACAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACA
TTCAATTCCAGAGAACCAAAAATCCCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCT
GTCTTGTTAATGCTTTTAAAAACAAATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCAC
TTCAAGCTGTTATTTCTTCCCTGCTTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACC
AGGATTTATTTTGAGCTCAGCCCCAACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAA
AAATTGAATGTGGCTGAAGTTGAACATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAA
TTACTGGAATTCTTCTGCAACATTTGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGAC
TAGAAGATTAGAAACTACCAATCCCAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCAT
AATGTTGCTTCTCAGGCTATATGCAGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTAC
CAGGGACTATCTTTGCTGCAGAGATCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000361796_chr11_57574387_+_6531nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000361391_chr11_57574387_+_6554nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGA
GACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAG
GAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATGCAGAAGATTTAGCACCAC
TATCTCCGTTCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGT
GCCAACTGCCAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTG
TCTCAACGCCTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGAT
TAGTTCTTTTTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGG
AAGAATTGGAAGTTACATGCTGTATATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAG
GGACTTTTATTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATT
GGCACATGCCACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCA
GGGACCATCAAGAACCTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTC
CTTAACCCACCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAG
ACTTTTGGTAGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAG
TCTGAAACTGGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACT
AAAGGACTTGATGTACATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTG
GGGTGCATCTCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTC
TTACCTACTATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTT
CAGTCATAGCAAGCTTTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGA
AGTGAGTGGTGTGACTCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCC
CTCCCTCCAGTATTGCCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTAT
TATTATTTCTAATCCTTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCC
TCTCTTCCCCTTCCCTTATATATTGAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTT
ATTTACCCTTTTCCCCCTTCCCATTTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGC
ACACTGCACAGGGAAAATTGCCCCATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTT
CTCGGTGGGGTGTGGGTAATAGAACAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACA
TTCAATTCCAGAGAACCAAAAATCCCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCT
GTCTTGTTAATGCTTTTAAAAACAAATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCAC
TTCAAGCTGTTATTTCTTCCCTGCTTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACC
AGGATTTATTTTGAGCTCAGCCCCAACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAA
AAATTGAATGTGGCTGAAGTTGAACATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAA
TTACTGGAATTCTTCTGCAACATTTGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGAC
TAGAAGATTAGAAACTACCAATCCCAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCAT
AATGTTGCTTCTCAGGCTATATGCAGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTAC
CAGGGACTATCTTTGCTGCAGAGATCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000530094_chr11_57574387_+_6617nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTG
TTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATATG
TACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCT
TACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCC
CTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGA
ACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTATAT
GCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGG
AAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACCCT
TGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTCCA
TCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGAT
ATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGA
TGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCG
TTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCTGT
CCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATG
TGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAG
AAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAG
CATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTA
GGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACT
TTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTATTT
GCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATTGAG
GCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCATTTC
TTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCCATC
CAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAACAG
CCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATCCCA
CCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACAAAT
GAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGCTTT
GCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCCAAC
TCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAACAT
GGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATTTGA
CAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCCCAA
CTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGCAGT
CCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGATCA
AGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAAATG

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000428599_chr11_57574387_+_6530nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000361332_chr11_57574387_+_6617nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTG
TTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATATG
TACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCT
TACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCC
CTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGA
ACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTATAT
GCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGG
AAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACCCT
TGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTCCA
TCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGAT
ATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGA
TGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCG
TTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCTGT
CCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATG
TGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAG
AAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAG
CATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTA
GGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACT
TTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTATTT
GCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATTGAG
GCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCATTTC
TTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCCATC
CAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAACAG
CCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATCCCA
CCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACAAAT
GAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGCTTT
GCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCCAAC
TCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAACAT
GGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATTTGA
CAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCCCAA
CTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGCAGT
CCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGATCA
AGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAAATG

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000527467_chr11_57574387_+_6617nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTG
TTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATATG
TACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCT
TACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCC
CTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGA
ACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTATAT
GCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGG
AAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACCCT
TGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTCCA
TCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGAT
ATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGA
TGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCG
TTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCTGT
CCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATG
TGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAG
AAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAG
CATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTA
GGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACT
TTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTATTT
GCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATTGAG
GCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCATTTC
TTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCCATC
CAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAACAG
CCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATCCCA
CCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACAAAT
GAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGCTTT
GCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCCAAC
TCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAACAT
GGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATTTGA
CAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCCCAA
CTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGCAGT
CCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGATCA
AGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAAATG

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000415361_chr11_57574387_+_6617nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTG
TTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATATG
TACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCT
TACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCC
CTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGA
ACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTATAT
GCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGG
AAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACCCT
TGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTCCA
TCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGAT
ATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGA
TGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCG
TTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCTGT
CCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATG
TGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAG
AAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAG
CATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTA
GGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACT
TTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTATTT
GCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATTGAG
GCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCATTTC
TTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCCATC
CAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAACAG
CCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATCCCA
CCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACAAAT
GAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGCTTT
GCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCCAAC
TCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAACAT
GGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATTTGA
CAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCCCAA
CTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGCAGT
CCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGATCA
AGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAAATG

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000532245_chr11_57574387_+_6530nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000532463_chr11_57574387_+_6530nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000528232_chr11_57574387_+_6530nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000529986_chr11_57574387_+_6530nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000531014_chr11_57574387_+_6617nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTG
TTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATATG
TACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCT
TACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCC
CTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGA
ACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTATAT
GCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGG
AAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACCCT
TGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTCCA
TCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGAT
ATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGA
TGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCG
TTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCTGT
CCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATG
TGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAG
AAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAG
CATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTA
GGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACT
TTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTATTT
GCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATTGAG
GCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCATTTC
TTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCCATC
CAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAACAG
CCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATCCCA
CCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACAAAT
GAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGCTTT
GCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCCAAC
TCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAACAT
GGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATTTGA
CAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCCCAA
CTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGCAGT
CCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGATCA
AGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAAATG

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000358694_chr11_57574387_+_6530nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000526772_chr11_57574387_+_6530nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000532787_chr11_57574387_+_6554nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGA
GACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAG
GAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATGCAGAAGATTTAGCACCAC
TATCTCCGTTCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGT
GCCAACTGCCAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTG
TCTCAACGCCTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGAT
TAGTTCTTTTTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGG
AAGAATTGGAAGTTACATGCTGTATATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAG
GGACTTTTATTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATT
GGCACATGCCACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCA
GGGACCATCAAGAACCTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTC
CTTAACCCACCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAG
ACTTTTGGTAGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAG
TCTGAAACTGGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACT
AAAGGACTTGATGTACATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTG
GGGTGCATCTCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTC
TTACCTACTATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTT
CAGTCATAGCAAGCTTTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGA
AGTGAGTGGTGTGACTCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCC
CTCCCTCCAGTATTGCCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTAT
TATTATTTCTAATCCTTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCC
TCTCTTCCCCTTCCCTTATATATTGAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTT
ATTTACCCTTTTCCCCCTTCCCATTTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGC
ACACTGCACAGGGAAAATTGCCCCATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTT
CTCGGTGGGGTGTGGGTAATAGAACAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACA
TTCAATTCCAGAGAACCAAAAATCCCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCT
GTCTTGTTAATGCTTTTAAAAACAAATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCAC
TTCAAGCTGTTATTTCTTCCCTGCTTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACC
AGGATTTATTTTGAGCTCAGCCCCAACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAA
AAATTGAATGTGGCTGAAGTTGAACATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAA
TTACTGGAATTCTTCTGCAACATTTGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGAC
TAGAAGATTAGAAACTACCAATCCCAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCAT
AATGTTGCTTCTCAGGCTATATGCAGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTAC
CAGGGACTATCTTTGCTGCAGAGATCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000533667_chr11_57574387_+_6554nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGA
GACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAG
GAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATGCAGAAGATTTAGCACCAC
TATCTCCGTTCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGT
GCCAACTGCCAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTG
TCTCAACGCCTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGAT
TAGTTCTTTTTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGG
AAGAATTGGAAGTTACATGCTGTATATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAG
GGACTTTTATTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATT
GGCACATGCCACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCA
GGGACCATCAAGAACCTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTC
CTTAACCCACCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAG
ACTTTTGGTAGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAG
TCTGAAACTGGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACT
AAAGGACTTGATGTACATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTG
GGGTGCATCTCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTC
TTACCTACTATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTT
CAGTCATAGCAAGCTTTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGA
AGTGAGTGGTGTGACTCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCC
CTCCCTCCAGTATTGCCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTAT
TATTATTTCTAATCCTTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCC
TCTCTTCCCCTTCCCTTATATATTGAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTT
ATTTACCCTTTTCCCCCTTCCCATTTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGC
ACACTGCACAGGGAAAATTGCCCCATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTT
CTCGGTGGGGTGTGGGTAATAGAACAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACA
TTCAATTCCAGAGAACCAAAAATCCCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCT
GTCTTGTTAATGCTTTTAAAAACAAATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCAC
TTCAAGCTGTTATTTCTTCCCTGCTTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACC
AGGATTTATTTTGAGCTCAGCCCCAACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAA
AAATTGAATGTGGCTGAAGTTGAACATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAA
TTACTGGAATTCTTCTGCAACATTTGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGAC
TAGAAGATTAGAAACTACCAATCCCAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCAT
AATGTTGCTTCTCAGGCTATATGCAGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTAC
CAGGGACTATCTTTGCTGCAGAGATCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000529873_chr11_57574387_+_6554nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGA
GACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAG
GAATCTCTGGAGGAAGAGTTGGATGTGTTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATGCAGAAGATTTAGCACCAC
TATCTCCGTTCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGT
GCCAACTGCCAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTG
TCTCAACGCCTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGAT
TAGTTCTTTTTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGG
AAGAATTGGAAGTTACATGCTGTATATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAG
GGACTTTTATTTTCTTTTAGAGAGGGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATT
GGCACATGCCACCTGGCAAAGGACCCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCA
GGGACCATCAAGAACCTACAGACTCCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTC
CTTAACCCACCTCTCCTGCCCTGTGATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAG
ACTTTTGGTAGAGAAGGAGCAGAAAGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAG
TCTGAAACTGGCTTCCCCACTCCCCCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACT
AAAGGACTTGATGTACATAACTCCTGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTG
GGGTGCATCTCCTCCCGCCCTTCCATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTC
TTACCTACTATTGGCCCTAAATAGCAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTT
CAGTCATAGCAAGCTTTTGCTCAACAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGA
AGTGAGTGGTGTGACTCTTACTCCTTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCC
CTCCCTCCAGTATTGCCCCCTCTCACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTAT
TATTATTTCTAATCCTTTTCCTTATTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCC
TCTCTTCCCCTTCCCTTATATATTGAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTT
ATTTACCCTTTTCCCCCTTCCCATTTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGC
ACACTGCACAGGGAAAATTGCCCCATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTT
CTCGGTGGGGTGTGGGTAATAGAACAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACA
TTCAATTCCAGAGAACCAAAAATCCCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCT
GTCTTGTTAATGCTTTTAAAAACAAATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCAC
TTCAAGCTGTTATTTCTTCCCTGCTTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACC
AGGATTTATTTTGAGCTCAGCCCCAACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAA
AAATTGAATGTGGCTGAAGTTGAACATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAA
TTACTGGAATTCTTCTGCAACATTTGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGAC
TAGAAGATTAGAAACTACCAATCCCAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCAT
AATGTTGCTTCTCAGGCTATATGCAGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTAC
CAGGGACTATCTTTGCTGCAGAGATCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000525902_chr11_57574387_+_6530nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000529526_chr11_57574387_+_6530nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000532649_chr11_57574387_+_6530nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000426142_chr11_57574387_+_6530nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000532844_chr11_57574387_+_6617nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTG
TTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATATG
TACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCT
TACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCC
CTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGA
ACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTATAT
GCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGG
AAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACCCT
TGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTCCA
TCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGAT
ATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGA
TGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCG
TTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCTGT
CCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATG
TGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAG
AAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAG
CATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTA
GGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACT
TTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTATTT
GCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATTGAG
GCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCATTTC
TTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCCATC
CAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAACAG
CCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATCCCA
CCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACAAAT
GAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGCTTT
GCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCCAAC
TCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAACAT
GGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATTTGA
CAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCCCAA
CTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGCAGT
CCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGATCA
AGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAAATG

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000528621_chr11_57574387_+_6530nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000399050_chr11_57574387_+_6617nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTG
TTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATATG
TACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCT
TACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCC
CTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGA
ACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTATAT
GCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGG
AAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACCCT
TGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTCCA
TCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGAT
ATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGA
TGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCG
TTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCTGT
CCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATG
TGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAG
AAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAG
CATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTA
GGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACT
TTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTATTT
GCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATTGAG
GCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCATTTC
TTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCCATC
CAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAACAG
CCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATCCCA
CCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACAAAT
GAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGCTTT
GCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCCAAC
TCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAACAT
GGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATTTGA
CAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCCCAA
CTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGCAGT
CCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGATCA
AGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAAATG

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000526357_chr11_57574387_+_6617nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGGACGAGGGGCAGGAATCTCTGGAGGAAGAGTTGGATGTG
TTGGTTTTGGATGATGAGGGGGGCCAAGTGTCTTACCCCTCCATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTATATG
TACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGCCCT
TACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCATTCC
CTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCTGGA
ACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTATAT
GCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAGGGG
AAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGACCCT
TGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACTCCA
TCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGTGAT
ATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAAAGA
TGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCCCCG
TTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCCTGT
CCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCCATG
TGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAGCAG
AAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAACAG
CATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCCTTA
GGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTCACT
TTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTATTT
GCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATTGAG
GCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCATTTC
TTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCCATC
CAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAACAG
CCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATCCCA
CCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACAAAT
GAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGCTTT
GCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCCAAC
TCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAACAT
GGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATTTGA
CAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCCCAA
CTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGCAGT
CCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGATCA
AGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAAATG

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000530748_chr11_57574387_+_6530nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000534579_chr11_57574387_+_6530nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAAGAAACCTGATCGGGAAGAAATTCAGATG
AGCAATATGGGATCAAACACAAAATCACTAGATAACAACTATTCCACACCAAATGAGAGAGGAGACCACAATAGAACACTGGATCGATCG
GGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCACCACTATCTCCGTTCCATCTGGGCTTAT
ATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTATTGTGCCAACTGCCAGGCTGCCTCCTGC
CCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAATTGTCTCAACGCCTCCCCCTCCCCCAT
TCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCAGATTAGTTCTTTTTGCCAGTTTTCCCT
GGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGTGGGAAGAATTGGAAGTTACATGCTGTA
TATGCAATGTCCAGCAGTCTGATAAACTGACGATTCTTAATCAAGATTTTTTTCCTGATGGGGAAGGGACTTTTATTTTCTTTTAGAGAG
GGGAAAGTGTGAGCTCTTCCCTTATTCCTAATGGCTATTTTTGAAGCAAAGAAGGCCAGCAACATTGGCACATGCCACCTGGCAAAGGAC
CCTTGAGTAAGTGAAGGTCTCCTAAAACTGGGATTAAGAAACCTTGCTCTCCTCATCTCCAAGGCAGGGACCATCAAGAACCTACAGACT
CCATCTCTTCTGCAAGCCTCATGCCAACCCTGGGCTATTGCTGCTGCCCCTTAAACACAGGCTGTCCTTAACCCACCTCTCCTGCCCTGT
GATATGTCTGCTGAGTTGGCCTGGCCATTTCCAAGAGGCTGTAGAAAGGGGAGAATGTCAAGGAAGACTTTTGGTAGAGAAGGAGCAGAA
AGATGTGTTTTTGGGAAGAAGAAGACCTCTAGGAGGAGCTAGTAGGAATGTACATGAAGCAATTAGTCTGAAACTGGCTTCCCCACTCCC
CCGTTTCTCCTTTTCCTATCCTTATAGGCCTGTCCCTTGCCTCTGCCCTGGATTGGTTGGCAAACTAAAGGACTTGATGTACATAACTCC
TGTCCCTTTTCCCTTACAAGGTGGGGATTGCCCCTGGCTTTGCCTCTTCTTTGTGCCTTTGGCCTGGGGTGCATCTCCTCCCGCCCTTCC
ATGTGCCTTTCTTTGCCTCTGCAGTCTCATTTCTCATAATTTTGCAAATTATATTTTGTTGCTTTCTTACCTACTATTGGCCCTAAATAG
CAGAAAGAAGAGAAGTGACCGAGAGAACCTCAGATTCTTCATTGAGGATTGGTATAGCCATGATTTCAGTCATAGCAAGCTTTTGCTCAA
CAGCATATGGGTGGGATTTTGCAAAAATCCTATTCTGATGAATCTCAAAGTAAGGCTGGTAAGAGAAGTGAGTGGTGTGACTCTTACTCC
TTAGGTGCCCAGAATTTACCATCATCTCTGAAGGAGTTACAGGGAAGTGGTCTCCCCAATTCTCCCCTCCCTCCAGTATTGCCCCCTCTC
ACTTTAGCATATATTAATTAGCAGGTTGGGCTAGAGAAATCAGCTGCTATGCGGGTTGATTATTATTATTATTTCTAATCCTTTTCCTTA
TTTGCCTTCTACTCCCCTTAATCTAATCTAAAAGCTCTGTTCCATGCAACTGGAGTTCCTTATCCCTCTCTTCCCCTTCCCTTATATATT
GAGGCTATGGGGTAGGAGAAAAGTGCACAACCCACCACCCCCTTTACTCGTGCATTAAAATTTCTTATTTACCCTTTTCCCCCTTCCCAT
TTCTTCCCACTTTCATCTACCTTTTCTGGCAAAAAGGAGCCTTTTGCTCTCTGTGACCCTAAGAGCACACTGCACAGGGAAAATTGCCCC
ATCCAGACCTGGCTCCACTCTTGATCTCTCTTGTCCTCTTCTGCTCTTTTCCTGGTGCTCTTTTTTCTCGGTGGGGTGTGGGTAATAGAA
CAGCCGTGGGCTTTTGGGGACCTTTAACTTTTTTTTCTCTCTTTTGTTTATAAAAAACACTAAACATTCAATTCCAGAGAACCAAAAATC
CCACCTTCCCACCGAACACTACTAAGGGGCTTGTGTTCTGCTCCATACCTTTTCTCTTTTCTTTCTGTCTTGTTAATGCTTTTAAAAACA
AATGAGTTTTTTATATAAATAAAGTTTTTAAAGTGTGTATGTGGGGGGTCTGTGTCATTTCTTCACTTCAAGCTGTTATTTCTTCCCTGC
TTTGCATCTTTGTTACTTCCTTATGTATCAGTGTCCTTTCCAGAGCAACCAGAAGGAGGTTATACCAGGATTTATTTTGAGCTCAGCCCC
AACTCTTTATCAAGCAACATTCTTGTTAACTATATGTGAAACATTTTTTCTTCTGAAGATTCTTAAAAATTGAATGTGGCTGAAGTTGAA
CATGGGAGCTTATTGCTAATTTAGAGATAGGAAACTGAAGCATAAAGAATTAATGACTTACTTTAATTACTGGAATTCTTCTGCAACATT
TGACAAAACTAACCTTGAATAAGGCCCACTGTAATACGTAGCTCTCTTAAATATAACACTTAGGACTAGAAGATTAGAAACTACCAATCC
CAACTACGTAATAGGAAAATGTAGGATCAAAAGGCCCATGTATATAAGTACTGACCACTGGGCCATAATGTTGCTTCTCAGGCTATATGC
AGTCCTTTAGTCAGAAGTCAATAGGCCTATTTATTAATATTTTACAGACCATATTACCTGGATTACCAGGGACTATCTTTGCTGCAGAGA
TCAAGGGTTAAGATCTATGGGAAGATACTTATTTTTCTGAGGTCCTTATGTCCTGTCATATAATTAAAGACTCAAGAGAATTTATGTGAA

>In-frame_VAT1_ENST00000355653_chr17_41166624_-_CTNND1_ENST00000526938_chr11_57574387_+_4006nt
GCTGGATCCCGCAGCCGCGGCTCTTCCCGACGCGTTCCGCCTTCCCCAGCTGTGCACTCTCCATCCAGCTGTGCGCTCTCGTCGGGAGTC
CCAGCCATGTCCGACGAGAGAGAGGTAGCCGAGGCAGCGACCGGGGAAGACGCCTCTTCGCCGCCTCCGAAAACCGAGGCAGCGAGCGAC
CCCCAGCATCCCGCGGCCTCCGAAGGGGCCGCCGCCGCCGCCGCCTCGCCGCCACTGCTGCGCTGCCTAGTGCTCACCGGCTTTGGAGGC
TACGACAAGGTGAAGCTGCAGAGCCGGCCGGCAGCGCCCCCGGCCCCTGGGCCCGGCCAGCTGACGCTGCGTCTGCGGGCCTGCGGGCTC
AACTTCGCAGACCTCATGGCTAGGCAGGGGCTGTACGACCGTCTCCCGCCTCTGCCTGTCACTCCGGGCATGGAGGGCGCGGGTGTTGTG
ATCGCAGTGGGCGAGGGAGTCAGCGACCGCAAGGCAGGAGACCGGGTGATGGTGTTGAACCGGTCAGGGATGTGGCAGGAAGAGGTGACT
GTGCCCTCGGTCCAGACCTTCCTGATTCCTGAGGCCATGACCTTTGAGGAAGCTGCTGCCTTGCTCGTCAATTACATTACAGCCTACATG
GTCCTCTTTGACTTCGGCAACCTACAGCCTGGCCACAGCGTCTTGGTACACATGGCTGCAGGGGGTGTGGGTATGGCTGCCGTGCAGCTG
TGCCGTACAGTGGAGAATGTGACAGTGTTCGGAACGGCCTCGGCCAGCAAGCACGAGGCACTGAAGGAGAATGGGGTCACACATCCCATC
GACTATCACACGACTGACTACGTGGATGAGATCAAGAAGATTTCCCCTAAAGGAGTGGACATTGTCATGGACCCTCTGGGTGGGTCAGAT
ACTGCCAAGGGCTACAACCTCCTGAAACCCATGGGCAAAGTCGTCACCTATGGAATGGCCAACCTGCTGACGGGCCCCAAACGGAACCTG
ATGGCCCTGGCCCGGACATGGTGGAATCAGTTCAGCGTGACAGCTCTGCAGCTGCTGCAGGCCAACCGGGCTGTGTGTGGCTTCCACCTG
GGCTACCTGGATGGTGAGGTGGAGCTGGTCAGTGGTGTGGTGGCCCGCCTCCTGGCTCTGTACAACCAGGGCCACATCAAGCCCCACATT
GACTCAGTCTGGCCCTTCGAGAAGGTGGCTGATGCCATGAAACAGATGCAGGAGAAGAAGAATGTGGGCAAGGTCCTCCTGGTTCCAGGG
CCAGAGAAGGAGAACTAGGGCAAGTGGCTGTGAGACCCTAGAGACCAGCGAAGGGAGAAGTTGGGAAGCTACGTTCTGTTGGCCACCAGA
CTTGCATTTCAGCCTCTGTCATAATGCTCTGCCCTCCCTCCCCCGAAGGTCTCTGTGGTGATGACCGCTCTCCCCTGCCCCTCCCCGCTT
CCTGACCTCTGAAGAGGTTGGGAAGTGACCATTTGGATGTCTGGGCCCTGCCAAGGCGACAGGGAGGGTCAGAGGGAGGCCGGCTGCTTC
CTGCCCCCACCCTTTCCCCGGGCCTGCTGTGCTGCTTTTGTGCCAAGGTTAGCCAGTCCCCCCTGTTGTGTTCCATGTGCTTTCACCTCT
GCCTCATCTTTCCTCCCGTCCCTGCCCCGCCACCTCCCCAAAGAATTGAAACGTCAGCTCAGGATATGGGGCCAATCTCTGTGAGTCCAG
CATGTACCTGTCTCTCCCTAGTGTCCCTTCAGCCTGGGCTGACCAGTGCCCGCCTCTGGGCTTGACCAGTTCCCAATCTCGTCCTCTGTC
CCCAACTTCTTAAGCACAATTGGGCTTCTTCCATCTCCAGGTTTTCTGCCATTCTTAACCAAGGCTGCCTCTTCCAACAGGGCGGGAATC
AGACCTACTCCCCTAGGTCACAACTCTGGGAAGGATACAGAGCCCCCACCCTTCACTGAGTTCTCTGGATTTGTTCTCAGTGCCTTAGCA
ACGAAAACCTGTGCTTGTGTGTGTGTGGCGGCGGGGAGGGAGGATCCTGTTTCCCACCTCCTTCTCCTCCCCTGTACTCCCCAGTGCCTT
CCTTGTTCTGGTGGAGCTGGGGTTTCTCTCCTCCCCAGTCCCACAACACTGCCAAAAATCTGTGTATGTGCCATTGGGTGGGGCAGCCCC
AAGCCTCCTGGGGAGGCAGGGCAAAAACAGGTGCCCTCATCGTGGTCTGTGCCATGTCCCGTCTCTATGGTGGTTGAGGAGAAAGGCGGG
GAAGCTTCCTCAGCCTTGCAGATATGTGTGGCATTTACTAGCCAGAGCTCTGAAAGGCAGTGCTGTCTGTTTCTTGTACTGGGACCAAAG
TAAAAATCCAAGCACATTCCCCTTGCAGTTAGGGGAGGCCCTACTGCCTTCTCAAAGCAGAGAGGCAGCTTATCAAACTCAGCCCAAAAC
TCTGTTTACATGGGTGGGGAGATGGAGCAGGGAAGTACAGAGTGGGATGGTCAGGACCTGGGCCATTGCAACCAAAATGGGGACTTCCTG
GGTAGGGAGGTCACTCCCTCTACTCACTGAGCTAGGATTAGGGAGGGTTATTGCCCCAACCATTGCAATGGGAGGTGGAGGGACAGGCTC
AGCCTCCTCATTGTCTAAATGAGGCCTAAATGTGTGAAGTGCGATTTCTGCTTTTGTGTACCCCACCACCCCATTACCACAGCTGCCTTT
GTGTGTTTGTGTCAATAAAAAGCCAAACCCTGGGGGAAAAAACCTATAGAGGATCCAGCAAACGATACAGTGGATTTCCCTAAAAGAACG
AGTCCAGCTCGAGGCTATGAGCTCTTATTTCAGCCAGAGGTGGTTCGGATATACATCTCACTTCTTAAGGAGAGCAAGACTCCTGCCATC
CTAGAAGCCTCAGCTGGAGCTATCCAGAACTTGTGTGCTGGGCGCTGGACGTATGGTCGATACATCCGCTCTGCTCTGCGTCAAGAGAAG
GCTCTTTCTGCCATAGCTGACCTCCTGACTAATGAACATGAACGGGTGGTGAAAGCTGCATCTGGAGCACTGAGAAACCTGGCTGTGGAT
GCTCGCAACAAAGAATTAATTGGTAAACATGCTATTCCTAACTTGGTAAAGAATCTGCCAGGAGGACAGCAGAACTCCTCTTGGAATTTC
TCTGAGGACACTGTCATCTCTATTTTGAACACTATCAACGAGGTTATCGCTGAGAACTTGGAGGCTGCCAAAAAGCTTCGAGAGACACAG
GGTATTGAGAAGCTGGTGTTGATCAACAAATCAGGGAACCGCTCAGAAAAAGAAGTTCGAGCAGCAGCACTTGTATTACAGACAATCTGG
GGATATAAGGAACTGCGGAAGCCACTGGAAAAAGAAGGATGGAAGAAATCAGACTTTCAGGTGAATCTAAACAATGCTTCCCGAAGCCAG
AGCAGTCATTCATATGATGATAGTACTCTCCCTCTCATTGACCGGAACCAAAAATCAGATAACAACTATTCCACACCAAATGAGAGAGGA
GACCACAATAGAACACTGGATCGATCGGGGGATCTAGGCGACATGGAGCCATTGAAGGGAACAACACCCTTGATGCAGAAGATTTAGCAC
CACTATCTCCGTTCCATCTGGGCTTATATGTACTTTTATTTTTTGGTGGTGAAATTGACTGATGATTTTCCTTTTTCTTCGCTGGACTAT
TGTGCCAACTGCCAGGCTGCCTCCTGCCCTTACAGCCCTAAGTGGCTGCCTTCTTTCCATCAACTCCCAACTTCTTCCTGTGAAGTTTAA
TTGTCTCAACGCCTCCCCCTCCCCCATTCCCTCCATTTTTCTCCCAAGAAACCTGACTCAATTATTTGCATATTTTGAGAAACTGCTGCA
GATTAGTTCTTTTTGCCAGTTTTCCCTGGAACTCCTGGCCTTTTGTGGAGGGGAGGGATGGAGAGAATAGGAATCTTCACTAGAAGCCGT


Top

FusionGenePPI for VAT1_CTNND1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
VAT1PHLPP2, H2AFX, CDK2, WDR12, NRAS, ZFYVE21, WDR74, ATP4A, PARK2, MVP, S100A13, TTC1, GARS, SETSIP, NCBP1, PFKP, PLIN3, TP53, NTRK1, TMEM216, EIF2S2, DLD, SOD1CTNND1CDH1, CTNNB1, EGFR, CTNNA1, CDH2, ACTG1, CTTN, FYN, LCK, SRC, YES1, PTPRJ, ZBTB33, CDH3, CDH5, MUC1, PSEN1, PTPN6, PTPRM, COL17A1, ERBB2IP, WDR48, SQSTM1, SNCA, RIPK3, ARRB2, CUL3, CSNK1E, APP, VCP, MYC, ATF2, SOX2, ATP4A, AP2M1, AURKA, KCTD6, NXF1, CCDC8, BMI1, SUMO2, NTRK1, IFI16, CEP135, TMEM17, TMEM216, XPO1, PPP4R1, FOXB1, MCM2, CDC5L, OTUB1, PPAP2B, BTRC, GSK3B, CTDSPL, MTMR7, CDH8, CTNNA3, G3BP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for VAT1_CTNND1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for VAT1_CTNND1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource