FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4127

FusionGeneSummary for BFAR_SPNS1

check button Fusion gene summary
Fusion gene informationFusion gene name: BFAR_SPNS1
Fusion gene ID: 4127
HgeneTgene
Gene symbol

BFAR

SPNS1

Gene ID

51283

83985

Gene namebifunctional apoptosis regulatorsphingolipid transporter 1 (putative)
SynonymsBAR|RNF47HSpin1|LAT|PP2030|SPIN1|SPINL|nrs
Cytomap

16p13.12

16p11.2

Type of geneprotein-codingprotein-coding
Descriptionbifunctional apoptosis regulatorRING finger protein 47bifunctional apoptosis inhibitorprotein spinster homolog 1SPNS sphingolipid transporter 1 (putative)spinster homolog 1spinster-like protein 1
Modification date2018052320180522
UniProtAcc

Q9NZS9

Q9H2V7

Ensembl transtripts involved in fusion geneENST00000261658, ENST00000563971, 
ENST00000426842, ENST00000563082, 
ENST00000565975, ENST00000311008, 
ENST00000323081, ENST00000334536, 
ENST00000352260, ENST00000561868, 
Fusion gene scores* DoF score2 X 2 X 2=81 X 1 X 1=1
# samples 31
** MAII scorelog2(3/8*10)=1.90689059560852log2(1/1*10)=3.32192809488736
Context

PubMed: BFAR [Title/Abstract] AND SPNS1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneBFAR

GO:0000209

protein polyubiquitination

21068390

HgeneBFAR

GO:0006511

ubiquitin-dependent protein catabolic process

21068390

HgeneBFAR

GO:0043066

negative regulation of apoptotic process

10716992

HgeneBFAR

GO:0043161

proteasome-mediated ubiquitin-dependent protein catabolic process

21068390

HgeneBFAR

GO:0051865

protein autoubiquitination

21068390

HgeneBFAR

GO:0070534

protein K63-linked ubiquitination

21068390

HgeneBFAR

GO:0070936

protein K48-linked ubiquitination

21068390


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-DU-7006-01ABFARchr16

14749067

+SPNS1chr16

28994178

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000261658ENST00000565975BFARchr16

14749067

+SPNS1chr16

28994178

+
In-frameENST00000261658ENST00000311008BFARchr16

14749067

+SPNS1chr16

28994178

+
In-frameENST00000261658ENST00000323081BFARchr16

14749067

+SPNS1chr16

28994178

+
In-frameENST00000261658ENST00000334536BFARchr16

14749067

+SPNS1chr16

28994178

+
In-frameENST00000261658ENST00000352260BFARchr16

14749067

+SPNS1chr16

28994178

+
5CDS-intronENST00000261658ENST00000561868BFARchr16

14749067

+SPNS1chr16

28994178

+
In-frameENST00000563971ENST00000565975BFARchr16

14749067

+SPNS1chr16

28994178

+
In-frameENST00000563971ENST00000311008BFARchr16

14749067

+SPNS1chr16

28994178

+
In-frameENST00000563971ENST00000323081BFARchr16

14749067

+SPNS1chr16

28994178

+
In-frameENST00000563971ENST00000334536BFARchr16

14749067

+SPNS1chr16

28994178

+
In-frameENST00000563971ENST00000352260BFARchr16

14749067

+SPNS1chr16

28994178

+
5CDS-intronENST00000563971ENST00000561868BFARchr16

14749067

+SPNS1chr16

28994178

+
In-frameENST00000426842ENST00000565975BFARchr16

14749067

+SPNS1chr16

28994178

+
In-frameENST00000426842ENST00000311008BFARchr16

14749067

+SPNS1chr16

28994178

+
In-frameENST00000426842ENST00000323081BFARchr16

14749067

+SPNS1chr16

28994178

+
In-frameENST00000426842ENST00000334536BFARchr16

14749067

+SPNS1chr16

28994178

+
In-frameENST00000426842ENST00000352260BFARchr16

14749067

+SPNS1chr16

28994178

+
5CDS-intronENST00000426842ENST00000561868BFARchr16

14749067

+SPNS1chr16

28994178

+
intron-3CDSENST00000563082ENST00000565975BFARchr16

14749067

+SPNS1chr16

28994178

+
intron-3CDSENST00000563082ENST00000311008BFARchr16

14749067

+SPNS1chr16

28994178

+
intron-3CDSENST00000563082ENST00000323081BFARchr16

14749067

+SPNS1chr16

28994178

+
intron-3CDSENST00000563082ENST00000334536BFARchr16

14749067

+SPNS1chr16

28994178

+
intron-3CDSENST00000563082ENST00000352260BFARchr16

14749067

+SPNS1chr16

28994178

+
intron-intronENST00000563082ENST00000561868BFARchr16

14749067

+SPNS1chr16

28994178

+

Top

FusionProtFeatures for BFAR_SPNS1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BFAR

Q9NZS9

SPNS1

Q9H2V7

Apoptosis regulator. Has anti-apoptotic activity, bothfor apoptosis triggered via death-receptors and via mitochondrialfactors. {ECO:0000269|PubMed:14502241}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBFARchr16:14749067chr16:28994178ENST00000261658+58182_249261451DomainSAM
HgeneBFARchr16:14749067chr16:28994178ENST00000261658+581_140261451Topological domainCytoplasmic
HgeneBFARchr16:14749067chr16:28994178ENST00000261658+58141_161261451TransmembraneHelical
HgeneBFARchr16:14749067chr16:28994178ENST00000261658+5834_74261451Zinc fingerRING-type
TgeneSPNS1chr16:14749067chr16:28994178ENST00000311008+712421_441385529TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000311008+712465_485385529TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000323081+813323_343312456TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000323081+813357_377312456TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000323081+813381_401312456TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000323081+813421_441312456TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000323081+813465_485312456TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000334536+611357_377333477TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000334536+611381_401333477TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000334536+611421_441333477TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000334536+611465_485333477TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000352260+510323_343311455TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000352260+510357_377311455TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000352260+510381_401311455TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000352260+510421_441311455TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000352260+510465_485311455TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBFARchr16:14749067chr16:28994178ENST00000261658+58162_331261451Topological domainLumenal
HgeneBFARchr16:14749067chr16:28994178ENST00000261658+58353_360261451Topological domainCytoplasmic
HgeneBFARchr16:14749067chr16:28994178ENST00000261658+58382_404261451Topological domainLumenal
HgeneBFARchr16:14749067chr16:28994178ENST00000261658+58426_450261451Topological domainCytoplasmic
HgeneBFARchr16:14749067chr16:28994178ENST00000261658+58332_352261451TransmembraneHelical
HgeneBFARchr16:14749067chr16:28994178ENST00000261658+58361_381261451TransmembraneHelical
HgeneBFARchr16:14749067chr16:28994178ENST00000261658+58405_425261451TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000311008+712127_147385529TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000311008+712160_180385529TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000311008+712187_207385529TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000311008+712218_238385529TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000311008+712278_298385529TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000311008+712323_343385529TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000311008+712357_377385529TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000311008+712381_401385529TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000311008+71250_70385529TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000311008+71298_118385529TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000323081+813127_147312456TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000323081+813160_180312456TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000323081+813187_207312456TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000323081+813218_238312456TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000323081+813278_298312456TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000323081+81350_70312456TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000323081+81398_118312456TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000334536+611127_147333477TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000334536+611160_180333477TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000334536+611187_207333477TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000334536+611218_238333477TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000334536+611278_298333477TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000334536+611323_343333477TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000334536+61150_70333477TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000334536+61198_118333477TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000352260+510127_147311455TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000352260+510160_180311455TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000352260+510187_207311455TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000352260+510218_238311455TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000352260+510278_298311455TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000352260+51050_70311455TransmembraneHelical
TgeneSPNS1chr16:14749067chr16:28994178ENST00000352260+51098_118311455TransmembraneHelical


Top

FusionGeneSequence for BFAR_SPNS1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BFAR_ENST00000261658_chr16_14749067_+_SPNS1_ENST00000565975_chr16_28994178_+_405aa
MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTECPECREKWEGFPKVSILLRDA
IEKLFPDAIRLRFEDIQQNNDIVQSLAAFQKYGNDQIPLAPNTGRANQQMGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVA
KWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTLTEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKIFIFIGETL
LSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLLGDAGSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIF

>In-frame_BFAR_ENST00000261658_chr16_14749067_+_SPNS1_ENST00000311008_chr16_28994178_+_405aa
MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTECPECREKWEGFPKVSILLRDA
IEKLFPDAIRLRFEDIQQNNDIVQSLAAFQKYGNDQIPLAPNTGRANQQMGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVA
KWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTLTEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKIFIFIGETL
LSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLLGDAGSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIF

>In-frame_BFAR_ENST00000261658_chr16_14749067_+_SPNS1_ENST00000323081_chr16_28994178_+_405aa
MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTECPECREKWEGFPKVSILLRDA
IEKLFPDAIRLRFEDIQQNNDIVQSLAAFQKYGNDQIPLAPNTGRANQQMGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVA
KWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTLTEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKIFIFIGETL
LSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLLGDAGSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIF

>In-frame_BFAR_ENST00000261658_chr16_14749067_+_SPNS1_ENST00000334536_chr16_28994178_+_405aa
MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTECPECREKWEGFPKVSILLRDA
IEKLFPDAIRLRFEDIQQNNDIVQSLAAFQKYGNDQIPLAPNTGRANQQMGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVA
KWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTLTEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKIFIFIGETL
LSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLLGDAGSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIF

>In-frame_BFAR_ENST00000261658_chr16_14749067_+_SPNS1_ENST00000352260_chr16_28994178_+_405aa
MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTECPECREKWEGFPKVSILLRDA
IEKLFPDAIRLRFEDIQQNNDIVQSLAAFQKYGNDQIPLAPNTGRANQQMGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVA
KWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTLTEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKIFIFIGETL
LSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLLGDAGSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIF

>In-frame_BFAR_ENST00000563971_chr16_14749067_+_SPNS1_ENST00000565975_chr16_28994178_+_280aa
MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTECPECREKWEGFPKVSILLRLL
LTLTEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKIFIFIGETLLSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLL
GDAGSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIFIEADRRRAQLHVQGLLHEAGSTDDRIVVPQRGRST

>In-frame_BFAR_ENST00000563971_chr16_14749067_+_SPNS1_ENST00000311008_chr16_28994178_+_280aa
MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTECPECREKWEGFPKVSILLRLL
LTLTEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKIFIFIGETLLSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLL
GDAGSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIFIEADRRRAQLHVQGLLHEAGSTDDRIVVPQRGRST

>In-frame_BFAR_ENST00000563971_chr16_14749067_+_SPNS1_ENST00000323081_chr16_28994178_+_280aa
MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTECPECREKWEGFPKVSILLRLL
LTLTEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKIFIFIGETLLSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLL
GDAGSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIFIEADRRRAQLHVQGLLHEAGSTDDRIVVPQRGRST

>In-frame_BFAR_ENST00000563971_chr16_14749067_+_SPNS1_ENST00000334536_chr16_28994178_+_280aa
MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTECPECREKWEGFPKVSILLRLL
LTLTEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKIFIFIGETLLSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLL
GDAGSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIFIEADRRRAQLHVQGLLHEAGSTDDRIVVPQRGRST

>In-frame_BFAR_ENST00000563971_chr16_14749067_+_SPNS1_ENST00000352260_chr16_28994178_+_280aa
MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTECPECREKWEGFPKVSILLRLL
LTLTEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKIFIFIGETLLSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLL
GDAGSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIFIEADRRRAQLHVQGLLHEAGSTDDRIVVPQRGRST

>In-frame_BFAR_ENST00000426842_chr16_14749067_+_SPNS1_ENST00000565975_chr16_28994178_+_277aa
MVGIFKENRMSRMQRKMGRFPQSQYSPQVVLLVYHWSSRESEHDLLVHKAVAKWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTL
TEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKIFIFIGETLLSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLLGDA
GSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIFIEADRRRAQLHVQGLLHEAGSTDDRIVVPQRGRSTRVP

>In-frame_BFAR_ENST00000426842_chr16_14749067_+_SPNS1_ENST00000311008_chr16_28994178_+_277aa
MVGIFKENRMSRMQRKMGRFPQSQYSPQVVLLVYHWSSRESEHDLLVHKAVAKWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTL
TEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKIFIFIGETLLSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLLGDA
GSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIFIEADRRRAQLHVQGLLHEAGSTDDRIVVPQRGRSTRVP

>In-frame_BFAR_ENST00000426842_chr16_14749067_+_SPNS1_ENST00000323081_chr16_28994178_+_277aa
MVGIFKENRMSRMQRKMGRFPQSQYSPQVVLLVYHWSSRESEHDLLVHKAVAKWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTL
TEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKIFIFIGETLLSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLLGDA
GSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIFIEADRRRAQLHVQGLLHEAGSTDDRIVVPQRGRSTRVP

>In-frame_BFAR_ENST00000426842_chr16_14749067_+_SPNS1_ENST00000334536_chr16_28994178_+_277aa
MVGIFKENRMSRMQRKMGRFPQSQYSPQVVLLVYHWSSRESEHDLLVHKAVAKWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTL
TEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKIFIFIGETLLSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLLGDA
GSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIFIEADRRRAQLHVQGLLHEAGSTDDRIVVPQRGRSTRVP

>In-frame_BFAR_ENST00000426842_chr16_14749067_+_SPNS1_ENST00000352260_chr16_28994178_+_277aa
MVGIFKENRMSRMQRKMGRFPQSQYSPQVVLLVYHWSSRESEHDLLVHKAVAKWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTL
TEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKIFIFIGETLLSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLLGDA
GSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIFIEADRRRAQLHVQGLLHEAGSTDDRIVVPQRGRSTRVP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BFAR_ENST00000261658_chr16_14749067_+_SPNS1_ENST00000565975_chr16_28994178_+_1215nt
ATGGAGGAACCTCAGAAAAGCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGT
GAATTTTCTTGCCACTGCTGCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTA
TGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGGATGCC
ATTGAAAAGTTATTTCCTGATGCCATTAGACTGAGATTTGAAGACATTCAGCAGAATAATGACATAGTCCAAAGTCTTGCAGCCTTTCAG
AAATATGGGAATGATCAGATTCCTTTAGCTCCTAACACAGGCCGAGCGAATCAGCAGATGGGAGGGGGATTCTTTTCCGGTGTGCTCACA
GCTTTAACTGGAGTGGCAGTGGTCCTGCTCGTCTATCACTGGAGCAGCAGGGAATCTGAACACGACCTCCTGGTCCACAAGGCTGTGGCC
AAATGGACGGCGGAAGAAGTTGTCCTCTGGCTGGAGCAGCTGGGCCCTTGGGCATCTCTTTACAGGGAAAGGTTTTTATCTGAACGAGTA
AATGGAAGGTTGCTTTTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTC
ATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTC
CTGTCCATGAACTGGGCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTG
CTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTG
TCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTC
ATTGAGGCCGACCGCCGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAG

>In-frame_BFAR_ENST00000261658_chr16_14749067_+_SPNS1_ENST00000311008_chr16_28994178_+_1215nt
ATGGAGGAACCTCAGAAAAGCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGT
GAATTTTCTTGCCACTGCTGCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTA
TGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGGATGCC
ATTGAAAAGTTATTTCCTGATGCCATTAGACTGAGATTTGAAGACATTCAGCAGAATAATGACATAGTCCAAAGTCTTGCAGCCTTTCAG
AAATATGGGAATGATCAGATTCCTTTAGCTCCTAACACAGGCCGAGCGAATCAGCAGATGGGAGGGGGATTCTTTTCCGGTGTGCTCACA
GCTTTAACTGGAGTGGCAGTGGTCCTGCTCGTCTATCACTGGAGCAGCAGGGAATCTGAACACGACCTCCTGGTCCACAAGGCTGTGGCC
AAATGGACGGCGGAAGAAGTTGTCCTCTGGCTGGAGCAGCTGGGCCCTTGGGCATCTCTTTACAGGGAAAGGTTTTTATCTGAACGAGTA
AATGGAAGGTTGCTTTTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTC
ATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTC
CTGTCCATGAACTGGGCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTG
CTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTG
TCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTC
ATTGAGGCCGACCGCCGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAG

>In-frame_BFAR_ENST00000261658_chr16_14749067_+_SPNS1_ENST00000323081_chr16_28994178_+_1215nt
ATGGAGGAACCTCAGAAAAGCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGT
GAATTTTCTTGCCACTGCTGCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTA
TGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGGATGCC
ATTGAAAAGTTATTTCCTGATGCCATTAGACTGAGATTTGAAGACATTCAGCAGAATAATGACATAGTCCAAAGTCTTGCAGCCTTTCAG
AAATATGGGAATGATCAGATTCCTTTAGCTCCTAACACAGGCCGAGCGAATCAGCAGATGGGAGGGGGATTCTTTTCCGGTGTGCTCACA
GCTTTAACTGGAGTGGCAGTGGTCCTGCTCGTCTATCACTGGAGCAGCAGGGAATCTGAACACGACCTCCTGGTCCACAAGGCTGTGGCC
AAATGGACGGCGGAAGAAGTTGTCCTCTGGCTGGAGCAGCTGGGCCCTTGGGCATCTCTTTACAGGGAAAGGTTTTTATCTGAACGAGTA
AATGGAAGGTTGCTTTTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTC
ATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTC
CTGTCCATGAACTGGGCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTG
CTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTG
TCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTC
ATTGAGGCCGACCGCCGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAG

>In-frame_BFAR_ENST00000261658_chr16_14749067_+_SPNS1_ENST00000334536_chr16_28994178_+_1215nt
ATGGAGGAACCTCAGAAAAGCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGT
GAATTTTCTTGCCACTGCTGCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTA
TGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGGATGCC
ATTGAAAAGTTATTTCCTGATGCCATTAGACTGAGATTTGAAGACATTCAGCAGAATAATGACATAGTCCAAAGTCTTGCAGCCTTTCAG
AAATATGGGAATGATCAGATTCCTTTAGCTCCTAACACAGGCCGAGCGAATCAGCAGATGGGAGGGGGATTCTTTTCCGGTGTGCTCACA
GCTTTAACTGGAGTGGCAGTGGTCCTGCTCGTCTATCACTGGAGCAGCAGGGAATCTGAACACGACCTCCTGGTCCACAAGGCTGTGGCC
AAATGGACGGCGGAAGAAGTTGTCCTCTGGCTGGAGCAGCTGGGCCCTTGGGCATCTCTTTACAGGGAAAGGTTTTTATCTGAACGAGTA
AATGGAAGGTTGCTTTTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTC
ATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTC
CTGTCCATGAACTGGGCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTG
CTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTG
TCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTC
ATTGAGGCCGACCGCCGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAG

>In-frame_BFAR_ENST00000261658_chr16_14749067_+_SPNS1_ENST00000352260_chr16_28994178_+_1215nt
ATGGAGGAACCTCAGAAAAGCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGT
GAATTTTCTTGCCACTGCTGCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTA
TGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGGATGCC
ATTGAAAAGTTATTTCCTGATGCCATTAGACTGAGATTTGAAGACATTCAGCAGAATAATGACATAGTCCAAAGTCTTGCAGCCTTTCAG
AAATATGGGAATGATCAGATTCCTTTAGCTCCTAACACAGGCCGAGCGAATCAGCAGATGGGAGGGGGATTCTTTTCCGGTGTGCTCACA
GCTTTAACTGGAGTGGCAGTGGTCCTGCTCGTCTATCACTGGAGCAGCAGGGAATCTGAACACGACCTCCTGGTCCACAAGGCTGTGGCC
AAATGGACGGCGGAAGAAGTTGTCCTCTGGCTGGAGCAGCTGGGCCCTTGGGCATCTCTTTACAGGGAAAGGTTTTTATCTGAACGAGTA
AATGGAAGGTTGCTTTTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTC
ATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTC
CTGTCCATGAACTGGGCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTG
CTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTG
TCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTC
ATTGAGGCCGACCGCCGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAG

>In-frame_BFAR_ENST00000563971_chr16_14749067_+_SPNS1_ENST00000565975_chr16_28994178_+_840nt
ATGGAGGAACCTCAGAAAAGCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGT
GAATTTTCTTGCCACTGCTGCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTA
TGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTTGCTT
TTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGT
GTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGG
GCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTG
GGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCT
CTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGC
CGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACC

>In-frame_BFAR_ENST00000563971_chr16_14749067_+_SPNS1_ENST00000311008_chr16_28994178_+_840nt
ATGGAGGAACCTCAGAAAAGCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGT
GAATTTTCTTGCCACTGCTGCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTA
TGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTTGCTT
TTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGT
GTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGG
GCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTG
GGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCT
CTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGC
CGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACC

>In-frame_BFAR_ENST00000563971_chr16_14749067_+_SPNS1_ENST00000323081_chr16_28994178_+_840nt
ATGGAGGAACCTCAGAAAAGCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGT
GAATTTTCTTGCCACTGCTGCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTA
TGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTTGCTT
TTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGT
GTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGG
GCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTG
GGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCT
CTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGC
CGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACC

>In-frame_BFAR_ENST00000563971_chr16_14749067_+_SPNS1_ENST00000334536_chr16_28994178_+_840nt
ATGGAGGAACCTCAGAAAAGCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGT
GAATTTTCTTGCCACTGCTGCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTA
TGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTTGCTT
TTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGT
GTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGG
GCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTG
GGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCT
CTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGC
CGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACC

>In-frame_BFAR_ENST00000563971_chr16_14749067_+_SPNS1_ENST00000352260_chr16_28994178_+_840nt
ATGGAGGAACCTCAGAAAAGCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGT
GAATTTTCTTGCCACTGCTGCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTA
TGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTTGCTT
TTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGT
GTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGG
GCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTG
GGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCT
CTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGC
CGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACC

>In-frame_BFAR_ENST00000426842_chr16_14749067_+_SPNS1_ENST00000565975_chr16_28994178_+_831nt
ATGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTGGTC
CTGCTCGTCTATCACTGGAGCAGCAGGGAATCTGAACACGACCTCCTGGTCCACAAGGCTGTGGCCAAATGGACGGCGGAAGAAGTTGTC
CTCTGGCTGGAGCAGCTGGGCCCTTGGGCATCTCTTTACAGGGAAAGGTTTTTATCTGAACGAGTAAATGGAAGGTTGCTTTTAACTTTG
ACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGTGTCAAAGCA
TTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGGGCCATCGTG
GCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTGGGTGATGCT
GGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCTCTGCAGTTC
TCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGCCGGCGGGCA
CAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACCCGCGTGCCC

>In-frame_BFAR_ENST00000426842_chr16_14749067_+_SPNS1_ENST00000311008_chr16_28994178_+_831nt
ATGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTGGTC
CTGCTCGTCTATCACTGGAGCAGCAGGGAATCTGAACACGACCTCCTGGTCCACAAGGCTGTGGCCAAATGGACGGCGGAAGAAGTTGTC
CTCTGGCTGGAGCAGCTGGGCCCTTGGGCATCTCTTTACAGGGAAAGGTTTTTATCTGAACGAGTAAATGGAAGGTTGCTTTTAACTTTG
ACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGTGTCAAAGCA
TTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGGGCCATCGTG
GCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTGGGTGATGCT
GGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCTCTGCAGTTC
TCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGCCGGCGGGCA
CAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACCCGCGTGCCC

>In-frame_BFAR_ENST00000426842_chr16_14749067_+_SPNS1_ENST00000323081_chr16_28994178_+_831nt
ATGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTGGTC
CTGCTCGTCTATCACTGGAGCAGCAGGGAATCTGAACACGACCTCCTGGTCCACAAGGCTGTGGCCAAATGGACGGCGGAAGAAGTTGTC
CTCTGGCTGGAGCAGCTGGGCCCTTGGGCATCTCTTTACAGGGAAAGGTTTTTATCTGAACGAGTAAATGGAAGGTTGCTTTTAACTTTG
ACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGTGTCAAAGCA
TTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGGGCCATCGTG
GCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTGGGTGATGCT
GGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCTCTGCAGTTC
TCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGCCGGCGGGCA
CAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACCCGCGTGCCC

>In-frame_BFAR_ENST00000426842_chr16_14749067_+_SPNS1_ENST00000334536_chr16_28994178_+_831nt
ATGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTGGTC
CTGCTCGTCTATCACTGGAGCAGCAGGGAATCTGAACACGACCTCCTGGTCCACAAGGCTGTGGCCAAATGGACGGCGGAAGAAGTTGTC
CTCTGGCTGGAGCAGCTGGGCCCTTGGGCATCTCTTTACAGGGAAAGGTTTTTATCTGAACGAGTAAATGGAAGGTTGCTTTTAACTTTG
ACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGTGTCAAAGCA
TTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGGGCCATCGTG
GCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTGGGTGATGCT
GGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCTCTGCAGTTC
TCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGCCGGCGGGCA
CAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACCCGCGTGCCC

>In-frame_BFAR_ENST00000426842_chr16_14749067_+_SPNS1_ENST00000352260_chr16_28994178_+_831nt
ATGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTGGTC
CTGCTCGTCTATCACTGGAGCAGCAGGGAATCTGAACACGACCTCCTGGTCCACAAGGCTGTGGCCAAATGGACGGCGGAAGAAGTTGTC
CTCTGGCTGGAGCAGCTGGGCCCTTGGGCATCTCTTTACAGGGAAAGGTTTTTATCTGAACGAGTAAATGGAAGGTTGCTTTTAACTTTG
ACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGTGTCAAAGCA
TTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGGGCCATCGTG
GCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTGGGTGATGCT
GGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCTCTGCAGTTC
TCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGCCGGCGGGCA
CAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACCCGCGTGCCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_BFAR_ENST00000261658_chr16_14749067_+_SPNS1_ENST00000565975_chr16_28994178_+_1741nt
GTGGCCGCTCTAGGCAGCGGGGAGGTCGCGGGGTTGAGGGGGGTTGTGAAAGGAGAGCGGCCTCTCCTCTATGGTCACGGGGCCGGGGCA
CGCTTCCCCCACTCTGTCTTGTTACTTCCGGTAGCGAAGCCTCTCCCTCTTCCTCTGCTCCCGCGGGGTCTGTGCTGAGAATAATGGCCC
GGTTGGCCCGGGACGAGTGGAATGATTAATGATGTTTTGCAGCAGTTTTCTACGTCTGAAATTTTTTATGTCTCTGGAACCCAGAATTTG
CTAAGAGATGGAGGAACCTCAGAAAAGCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTC
TGTTAGTGAATTTTCTTGCCACTGCTGCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCT
TGCTTTATGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAG
GGATGCCATTGAAAAGTTATTTCCTGATGCCATTAGACTGAGATTTGAAGACATTCAGCAGAATAATGACATAGTCCAAAGTCTTGCAGC
CTTTCAGAAATATGGGAATGATCAGATTCCTTTAGCTCCTAACACAGGCCGAGCGAATCAGCAGATGGGAGGGGGATTCTTTTCCGGTGT
GCTCACAGCTTTAACTGGAGTGGCAGTGGTCCTGCTCGTCTATCACTGGAGCAGCAGGGAATCTGAACACGACCTCCTGGTCCACAAGGC
TGTGGCCAAATGGACGGCGGAAGAAGTTGTCCTCTGGCTGGAGCAGCTGGGCCCTTGGGCATCTCTTTACAGGGAAAGGTTTTTATCTGA
ACGAGTAAATGGAAGGTTGCTTTTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGC
CATCCTCATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGA
GACCCTCCTGTCCATGAACTGGGCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCA
GATCGTGCTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTC
CTTCTTGTCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGC
CATCTTCATTGAGGCCGACCGCCGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGT
GCCCCAGCGGGGCCGCTCCACCCGCGTGCCCGTGGCCAGTGTGCTCATCTGAGAGGCTGCCGCTCACCTACCTGCACATCTGCCACAGCT
GGCCCTGGGCCCACCCCACGAAGGGCCTGGGCCTAACCCCTTGGCCTGGCCCAGCTTCCAGAGGGACCCTGGGCCGTGTGCCAGCTCCCA
GACACTACCTGGGTAGCTCAGGGGAGGAGGTGGGGGTCCAGGAGGGGGATCCCTCTCCACAGGGGCAGCCCCAAGGGCTCGGTGCTATTT

>In-frame_BFAR_ENST00000261658_chr16_14749067_+_SPNS1_ENST00000311008_chr16_28994178_+_1736nt
GTGGCCGCTCTAGGCAGCGGGGAGGTCGCGGGGTTGAGGGGGGTTGTGAAAGGAGAGCGGCCTCTCCTCTATGGTCACGGGGCCGGGGCA
CGCTTCCCCCACTCTGTCTTGTTACTTCCGGTAGCGAAGCCTCTCCCTCTTCCTCTGCTCCCGCGGGGTCTGTGCTGAGAATAATGGCCC
GGTTGGCCCGGGACGAGTGGAATGATTAATGATGTTTTGCAGCAGTTTTCTACGTCTGAAATTTTTTATGTCTCTGGAACCCAGAATTTG
CTAAGAGATGGAGGAACCTCAGAAAAGCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTC
TGTTAGTGAATTTTCTTGCCACTGCTGCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCT
TGCTTTATGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAG
GGATGCCATTGAAAAGTTATTTCCTGATGCCATTAGACTGAGATTTGAAGACATTCAGCAGAATAATGACATAGTCCAAAGTCTTGCAGC
CTTTCAGAAATATGGGAATGATCAGATTCCTTTAGCTCCTAACACAGGCCGAGCGAATCAGCAGATGGGAGGGGGATTCTTTTCCGGTGT
GCTCACAGCTTTAACTGGAGTGGCAGTGGTCCTGCTCGTCTATCACTGGAGCAGCAGGGAATCTGAACACGACCTCCTGGTCCACAAGGC
TGTGGCCAAATGGACGGCGGAAGAAGTTGTCCTCTGGCTGGAGCAGCTGGGCCCTTGGGCATCTCTTTACAGGGAAAGGTTTTTATCTGA
ACGAGTAAATGGAAGGTTGCTTTTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGC
CATCCTCATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGA
GACCCTCCTGTCCATGAACTGGGCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCA
GATCGTGCTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTC
CTTCTTGTCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGC
CATCTTCATTGAGGCCGACCGCCGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGT
GCCCCAGCGGGGCCGCTCCACCCGCGTGCCCGTGGCCAGTGTGCTCATCTGAGAGGCTGCCGCTCACCTACCTGCACATCTGCCACAGCT
GGCCCTGGGCCCACCCCACGAAGGGCCTGGGCCTAACCCCTTGGCCTGGCCCAGCTTCCAGAGGGACCCTGGGCCGTGTGCCAGCTCCCA
GACACTACCTGGGTAGCTCAGGGGAGGAGGTGGGGGTCCAGGAGGGGGATCCCTCTCCACAGGGGCAGCCCCAAGGGCTCGGTGCTATTT

>In-frame_BFAR_ENST00000261658_chr16_14749067_+_SPNS1_ENST00000323081_chr16_28994178_+_1736nt
GTGGCCGCTCTAGGCAGCGGGGAGGTCGCGGGGTTGAGGGGGGTTGTGAAAGGAGAGCGGCCTCTCCTCTATGGTCACGGGGCCGGGGCA
CGCTTCCCCCACTCTGTCTTGTTACTTCCGGTAGCGAAGCCTCTCCCTCTTCCTCTGCTCCCGCGGGGTCTGTGCTGAGAATAATGGCCC
GGTTGGCCCGGGACGAGTGGAATGATTAATGATGTTTTGCAGCAGTTTTCTACGTCTGAAATTTTTTATGTCTCTGGAACCCAGAATTTG
CTAAGAGATGGAGGAACCTCAGAAAAGCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTC
TGTTAGTGAATTTTCTTGCCACTGCTGCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCT
TGCTTTATGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAG
GGATGCCATTGAAAAGTTATTTCCTGATGCCATTAGACTGAGATTTGAAGACATTCAGCAGAATAATGACATAGTCCAAAGTCTTGCAGC
CTTTCAGAAATATGGGAATGATCAGATTCCTTTAGCTCCTAACACAGGCCGAGCGAATCAGCAGATGGGAGGGGGATTCTTTTCCGGTGT
GCTCACAGCTTTAACTGGAGTGGCAGTGGTCCTGCTCGTCTATCACTGGAGCAGCAGGGAATCTGAACACGACCTCCTGGTCCACAAGGC
TGTGGCCAAATGGACGGCGGAAGAAGTTGTCCTCTGGCTGGAGCAGCTGGGCCCTTGGGCATCTCTTTACAGGGAAAGGTTTTTATCTGA
ACGAGTAAATGGAAGGTTGCTTTTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGC
CATCCTCATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGA
GACCCTCCTGTCCATGAACTGGGCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCA
GATCGTGCTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTC
CTTCTTGTCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGC
CATCTTCATTGAGGCCGACCGCCGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGT
GCCCCAGCGGGGCCGCTCCACCCGCGTGCCCGTGGCCAGTGTGCTCATCTGAGAGGCTGCCGCTCACCTACCTGCACATCTGCCACAGCT
GGCCCTGGGCCCACCCCACGAAGGGCCTGGGCCTAACCCCTTGGCCTGGCCCAGCTTCCAGAGGGACCCTGGGCCGTGTGCCAGCTCCCA
GACACTACCTGGGTAGCTCAGGGGAGGAGGTGGGGGTCCAGGAGGGGGATCCCTCTCCACAGGGGCAGCCCCAAGGGCTCGGTGCTATTT

>In-frame_BFAR_ENST00000261658_chr16_14749067_+_SPNS1_ENST00000334536_chr16_28994178_+_1737nt
GTGGCCGCTCTAGGCAGCGGGGAGGTCGCGGGGTTGAGGGGGGTTGTGAAAGGAGAGCGGCCTCTCCTCTATGGTCACGGGGCCGGGGCA
CGCTTCCCCCACTCTGTCTTGTTACTTCCGGTAGCGAAGCCTCTCCCTCTTCCTCTGCTCCCGCGGGGTCTGTGCTGAGAATAATGGCCC
GGTTGGCCCGGGACGAGTGGAATGATTAATGATGTTTTGCAGCAGTTTTCTACGTCTGAAATTTTTTATGTCTCTGGAACCCAGAATTTG
CTAAGAGATGGAGGAACCTCAGAAAAGCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTC
TGTTAGTGAATTTTCTTGCCACTGCTGCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCT
TGCTTTATGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAG
GGATGCCATTGAAAAGTTATTTCCTGATGCCATTAGACTGAGATTTGAAGACATTCAGCAGAATAATGACATAGTCCAAAGTCTTGCAGC
CTTTCAGAAATATGGGAATGATCAGATTCCTTTAGCTCCTAACACAGGCCGAGCGAATCAGCAGATGGGAGGGGGATTCTTTTCCGGTGT
GCTCACAGCTTTAACTGGAGTGGCAGTGGTCCTGCTCGTCTATCACTGGAGCAGCAGGGAATCTGAACACGACCTCCTGGTCCACAAGGC
TGTGGCCAAATGGACGGCGGAAGAAGTTGTCCTCTGGCTGGAGCAGCTGGGCCCTTGGGCATCTCTTTACAGGGAAAGGTTTTTATCTGA
ACGAGTAAATGGAAGGTTGCTTTTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGC
CATCCTCATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGA
GACCCTCCTGTCCATGAACTGGGCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCA
GATCGTGCTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTC
CTTCTTGTCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGC
CATCTTCATTGAGGCCGACCGCCGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGT
GCCCCAGCGGGGCCGCTCCACCCGCGTGCCCGTGGCCAGTGTGCTCATCTGAGAGGCTGCCGCTCACCTACCTGCACATCTGCCACAGCT
GGCCCTGGGCCCACCCCACGAAGGGCCTGGGCCTAACCCCTTGGCCTGGCCCAGCTTCCAGAGGGACCCTGGGCCGTGTGCCAGCTCCCA
GACACTACCTGGGTAGCTCAGGGGAGGAGGTGGGGGTCCAGGAGGGGGATCCCTCTCCACAGGGGCAGCCCCAAGGGCTCGGTGCTATTT

>In-frame_BFAR_ENST00000261658_chr16_14749067_+_SPNS1_ENST00000352260_chr16_28994178_+_1736nt
GTGGCCGCTCTAGGCAGCGGGGAGGTCGCGGGGTTGAGGGGGGTTGTGAAAGGAGAGCGGCCTCTCCTCTATGGTCACGGGGCCGGGGCA
CGCTTCCCCCACTCTGTCTTGTTACTTCCGGTAGCGAAGCCTCTCCCTCTTCCTCTGCTCCCGCGGGGTCTGTGCTGAGAATAATGGCCC
GGTTGGCCCGGGACGAGTGGAATGATTAATGATGTTTTGCAGCAGTTTTCTACGTCTGAAATTTTTTATGTCTCTGGAACCCAGAATTTG
CTAAGAGATGGAGGAACCTCAGAAAAGCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTC
TGTTAGTGAATTTTCTTGCCACTGCTGCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCT
TGCTTTATGGTGGGCATCTTCAAAGAAAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAG
GGATGCCATTGAAAAGTTATTTCCTGATGCCATTAGACTGAGATTTGAAGACATTCAGCAGAATAATGACATAGTCCAAAGTCTTGCAGC
CTTTCAGAAATATGGGAATGATCAGATTCCTTTAGCTCCTAACACAGGCCGAGCGAATCAGCAGATGGGAGGGGGATTCTTTTCCGGTGT
GCTCACAGCTTTAACTGGAGTGGCAGTGGTCCTGCTCGTCTATCACTGGAGCAGCAGGGAATCTGAACACGACCTCCTGGTCCACAAGGC
TGTGGCCAAATGGACGGCGGAAGAAGTTGTCCTCTGGCTGGAGCAGCTGGGCCCTTGGGCATCTCTTTACAGGGAAAGGTTTTTATCTGA
ACGAGTAAATGGAAGGTTGCTTTTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGC
CATCCTCATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGA
GACCCTCCTGTCCATGAACTGGGCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCA
GATCGTGCTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTC
CTTCTTGTCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGC
CATCTTCATTGAGGCCGACCGCCGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGT
GCCCCAGCGGGGCCGCTCCACCCGCGTGCCCGTGGCCAGTGTGCTCATCTGAGAGGCTGCCGCTCACCTACCTGCACATCTGCCACAGCT
GGCCCTGGGCCCACCCCACGAAGGGCCTGGGCCTAACCCCTTGGCCTGGCCCAGCTTCCAGAGGGACCCTGGGCCGTGTGCCAGCTCCCA
GACACTACCTGGGTAGCTCAGGGGAGGAGGTGGGGGTCCAGGAGGGGGATCCCTCTCCACAGGGGCAGCCCCAAGGGCTCGGTGCTATTT

>In-frame_BFAR_ENST00000563971_chr16_14749067_+_SPNS1_ENST00000565975_chr16_28994178_+_1250nt
TCCGGTAGCGAAGCCTCTCCCTCTTCCTCTGCTCCCGCGGGGTCTGTGCTGAGAATAATGGCCCGGTTGGCCCGGGACGAGTGGAATGAT
TAATGATGTTTTGCAGCAGTTTTCTACGTCTGAAATTTTTTATGTCTCTGGAACCCAGAATTTGCTAAGAGATGGAGGAACCTCAGAAAA
GCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGTGAATTTTCTTGCCACTGCT
GCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTATGGTGGGCATCTTCAAAGA
AAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTTGCTTTTAACTTTGACAGAGGAAG
AATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGA
AGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGGGCCATCGTGGCCGACATTC
TGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCT
ACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGC
TCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGCCGGCGGGCACAGCTGCACG
TGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACCCGCGTGCCCGTGGCCAGTG
TGCTCATCTGAGAGGCTGCCGCTCACCTACCTGCACATCTGCCACAGCTGGCCCTGGGCCCACCCCACGAAGGGCCTGGGCCTAACCCCT
TGGCCTGGCCCAGCTTCCAGAGGGACCCTGGGCCGTGTGCCAGCTCCCAGACACTACCTGGGTAGCTCAGGGGAGGAGGTGGGGGTCCAG

>In-frame_BFAR_ENST00000563971_chr16_14749067_+_SPNS1_ENST00000311008_chr16_28994178_+_1245nt
TCCGGTAGCGAAGCCTCTCCCTCTTCCTCTGCTCCCGCGGGGTCTGTGCTGAGAATAATGGCCCGGTTGGCCCGGGACGAGTGGAATGAT
TAATGATGTTTTGCAGCAGTTTTCTACGTCTGAAATTTTTTATGTCTCTGGAACCCAGAATTTGCTAAGAGATGGAGGAACCTCAGAAAA
GCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGTGAATTTTCTTGCCACTGCT
GCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTATGGTGGGCATCTTCAAAGA
AAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTTGCTTTTAACTTTGACAGAGGAAG
AATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGA
AGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGGGCCATCGTGGCCGACATTC
TGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCT
ACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGC
TCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGCCGGCGGGCACAGCTGCACG
TGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACCCGCGTGCCCGTGGCCAGTG
TGCTCATCTGAGAGGCTGCCGCTCACCTACCTGCACATCTGCCACAGCTGGCCCTGGGCCCACCCCACGAAGGGCCTGGGCCTAACCCCT
TGGCCTGGCCCAGCTTCCAGAGGGACCCTGGGCCGTGTGCCAGCTCCCAGACACTACCTGGGTAGCTCAGGGGAGGAGGTGGGGGTCCAG

>In-frame_BFAR_ENST00000563971_chr16_14749067_+_SPNS1_ENST00000323081_chr16_28994178_+_1245nt
TCCGGTAGCGAAGCCTCTCCCTCTTCCTCTGCTCCCGCGGGGTCTGTGCTGAGAATAATGGCCCGGTTGGCCCGGGACGAGTGGAATGAT
TAATGATGTTTTGCAGCAGTTTTCTACGTCTGAAATTTTTTATGTCTCTGGAACCCAGAATTTGCTAAGAGATGGAGGAACCTCAGAAAA
GCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGTGAATTTTCTTGCCACTGCT
GCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTATGGTGGGCATCTTCAAAGA
AAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTTGCTTTTAACTTTGACAGAGGAAG
AATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGA
AGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGGGCCATCGTGGCCGACATTC
TGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCT
ACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGC
TCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGCCGGCGGGCACAGCTGCACG
TGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACCCGCGTGCCCGTGGCCAGTG
TGCTCATCTGAGAGGCTGCCGCTCACCTACCTGCACATCTGCCACAGCTGGCCCTGGGCCCACCCCACGAAGGGCCTGGGCCTAACCCCT
TGGCCTGGCCCAGCTTCCAGAGGGACCCTGGGCCGTGTGCCAGCTCCCAGACACTACCTGGGTAGCTCAGGGGAGGAGGTGGGGGTCCAG

>In-frame_BFAR_ENST00000563971_chr16_14749067_+_SPNS1_ENST00000334536_chr16_28994178_+_1246nt
TCCGGTAGCGAAGCCTCTCCCTCTTCCTCTGCTCCCGCGGGGTCTGTGCTGAGAATAATGGCCCGGTTGGCCCGGGACGAGTGGAATGAT
TAATGATGTTTTGCAGCAGTTTTCTACGTCTGAAATTTTTTATGTCTCTGGAACCCAGAATTTGCTAAGAGATGGAGGAACCTCAGAAAA
GCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGTGAATTTTCTTGCCACTGCT
GCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTATGGTGGGCATCTTCAAAGA
AAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTTGCTTTTAACTTTGACAGAGGAAG
AATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGA
AGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGGGCCATCGTGGCCGACATTC
TGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCT
ACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGC
TCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGCCGGCGGGCACAGCTGCACG
TGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACCCGCGTGCCCGTGGCCAGTG
TGCTCATCTGAGAGGCTGCCGCTCACCTACCTGCACATCTGCCACAGCTGGCCCTGGGCCCACCCCACGAAGGGCCTGGGCCTAACCCCT
TGGCCTGGCCCAGCTTCCAGAGGGACCCTGGGCCGTGTGCCAGCTCCCAGACACTACCTGGGTAGCTCAGGGGAGGAGGTGGGGGTCCAG

>In-frame_BFAR_ENST00000563971_chr16_14749067_+_SPNS1_ENST00000352260_chr16_28994178_+_1245nt
TCCGGTAGCGAAGCCTCTCCCTCTTCCTCTGCTCCCGCGGGGTCTGTGCTGAGAATAATGGCCCGGTTGGCCCGGGACGAGTGGAATGAT
TAATGATGTTTTGCAGCAGTTTTCTACGTCTGAAATTTTTTATGTCTCTGGAACCCAGAATTTGCTAAGAGATGGAGGAACCTCAGAAAA
GCTATGTGAACACAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGTGAATTTTCTTGCCACTGCT
GCTACGACATCCTGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTATGGTGGGCATCTTCAAAGA
AAACAGAATGTCCAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTTGCTTTTAACTTTGACAGAGGAAG
AATTTTCCAAGACGCCCTATACCATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGA
AGCCCCCCCAGAATCTCTGGGAATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGGGCCATCGTGGCCGACATTC
TGCTGTACGTGGTGATCCCTACCCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCT
ACCTCATTGGCCTGATCTCTGACCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGC
TCTGCGCGTTTGTTGGGGCACTGGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGCCGGCGGGCACAGCTGCACG
TGCAGGGCCTGCTGCACGAAGCAGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACCCGCGTGCCCGTGGCCAGTG
TGCTCATCTGAGAGGCTGCCGCTCACCTACCTGCACATCTGCCACAGCTGGCCCTGGGCCCACCCCACGAAGGGCCTGGGCCTAACCCCT
TGGCCTGGCCCAGCTTCCAGAGGGACCCTGGGCCGTGTGCCAGCTCCCAGACACTACCTGGGTAGCTCAGGGGAGGAGGTGGGGGTCCAG

>In-frame_BFAR_ENST00000426842_chr16_14749067_+_SPNS1_ENST00000565975_chr16_28994178_+_1318nt
GCAGCAGTTTTCTACGTCTGAAATTTTTTATGTCTCTGGAACCCAGAATTTGCTAAGAGATGGAGGAACCTCAGAAAAGCTATGTGAACA
CAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGTGAATTTTCTTGCCACTGCTGCTACGACATCC
TGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTATGGTGGGCATCTTCAAAGAAAACAGAATGTC
CAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTGGTCCTGCTCGTCTATCACTGGAGCAGCAGGGAATC
TGAACACGACCTCCTGGTCCACAAGGCTGTGGCCAAATGGACGGCGGAAGAAGTTGTCCTCTGGCTGGAGCAGCTGGGCCCTTGGGCATC
TCTTTACAGGGAAAGGTTTTTATCTGAACGAGTAAATGGAAGGTTGCTTTTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATAC
CATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGA
ATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGGGCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTAC
CCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGA
CCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACT
GGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGCCGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGC
AGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACCCGCGTGCCCGTGGCCAGTGTGCTCATCTGAGAGGCTGCCGC
TCACCTACCTGCACATCTGCCACAGCTGGCCCTGGGCCCACCCCACGAAGGGCCTGGGCCTAACCCCTTGGCCTGGCCCAGCTTCCAGAG
GGACCCTGGGCCGTGTGCCAGCTCCCAGACACTACCTGGGTAGCTCAGGGGAGGAGGTGGGGGTCCAGGAGGGGGATCCCTCTCCACAGG

>In-frame_BFAR_ENST00000426842_chr16_14749067_+_SPNS1_ENST00000311008_chr16_28994178_+_1313nt
GCAGCAGTTTTCTACGTCTGAAATTTTTTATGTCTCTGGAACCCAGAATTTGCTAAGAGATGGAGGAACCTCAGAAAAGCTATGTGAACA
CAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGTGAATTTTCTTGCCACTGCTGCTACGACATCC
TGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTATGGTGGGCATCTTCAAAGAAAACAGAATGTC
CAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTGGTCCTGCTCGTCTATCACTGGAGCAGCAGGGAATC
TGAACACGACCTCCTGGTCCACAAGGCTGTGGCCAAATGGACGGCGGAAGAAGTTGTCCTCTGGCTGGAGCAGCTGGGCCCTTGGGCATC
TCTTTACAGGGAAAGGTTTTTATCTGAACGAGTAAATGGAAGGTTGCTTTTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATAC
CATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGA
ATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGGGCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTAC
CCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGA
CCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACT
GGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGCCGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGC
AGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACCCGCGTGCCCGTGGCCAGTGTGCTCATCTGAGAGGCTGCCGC
TCACCTACCTGCACATCTGCCACAGCTGGCCCTGGGCCCACCCCACGAAGGGCCTGGGCCTAACCCCTTGGCCTGGCCCAGCTTCCAGAG
GGACCCTGGGCCGTGTGCCAGCTCCCAGACACTACCTGGGTAGCTCAGGGGAGGAGGTGGGGGTCCAGGAGGGGGATCCCTCTCCACAGG

>In-frame_BFAR_ENST00000426842_chr16_14749067_+_SPNS1_ENST00000323081_chr16_28994178_+_1313nt
GCAGCAGTTTTCTACGTCTGAAATTTTTTATGTCTCTGGAACCCAGAATTTGCTAAGAGATGGAGGAACCTCAGAAAAGCTATGTGAACA
CAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGTGAATTTTCTTGCCACTGCTGCTACGACATCC
TGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTATGGTGGGCATCTTCAAAGAAAACAGAATGTC
CAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTGGTCCTGCTCGTCTATCACTGGAGCAGCAGGGAATC
TGAACACGACCTCCTGGTCCACAAGGCTGTGGCCAAATGGACGGCGGAAGAAGTTGTCCTCTGGCTGGAGCAGCTGGGCCCTTGGGCATC
TCTTTACAGGGAAAGGTTTTTATCTGAACGAGTAAATGGAAGGTTGCTTTTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATAC
CATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGA
ATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGGGCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTAC
CCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGA
CCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACT
GGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGCCGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGC
AGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACCCGCGTGCCCGTGGCCAGTGTGCTCATCTGAGAGGCTGCCGC
TCACCTACCTGCACATCTGCCACAGCTGGCCCTGGGCCCACCCCACGAAGGGCCTGGGCCTAACCCCTTGGCCTGGCCCAGCTTCCAGAG
GGACCCTGGGCCGTGTGCCAGCTCCCAGACACTACCTGGGTAGCTCAGGGGAGGAGGTGGGGGTCCAGGAGGGGGATCCCTCTCCACAGG

>In-frame_BFAR_ENST00000426842_chr16_14749067_+_SPNS1_ENST00000334536_chr16_28994178_+_1314nt
GCAGCAGTTTTCTACGTCTGAAATTTTTTATGTCTCTGGAACCCAGAATTTGCTAAGAGATGGAGGAACCTCAGAAAAGCTATGTGAACA
CAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGTGAATTTTCTTGCCACTGCTGCTACGACATCC
TGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTATGGTGGGCATCTTCAAAGAAAACAGAATGTC
CAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTGGTCCTGCTCGTCTATCACTGGAGCAGCAGGGAATC
TGAACACGACCTCCTGGTCCACAAGGCTGTGGCCAAATGGACGGCGGAAGAAGTTGTCCTCTGGCTGGAGCAGCTGGGCCCTTGGGCATC
TCTTTACAGGGAAAGGTTTTTATCTGAACGAGTAAATGGAAGGTTGCTTTTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATAC
CATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGA
ATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGGGCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTAC
CCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGA
CCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACT
GGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGCCGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGC
AGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACCCGCGTGCCCGTGGCCAGTGTGCTCATCTGAGAGGCTGCCGC
TCACCTACCTGCACATCTGCCACAGCTGGCCCTGGGCCCACCCCACGAAGGGCCTGGGCCTAACCCCTTGGCCTGGCCCAGCTTCCAGAG
GGACCCTGGGCCGTGTGCCAGCTCCCAGACACTACCTGGGTAGCTCAGGGGAGGAGGTGGGGGTCCAGGAGGGGGATCCCTCTCCACAGG

>In-frame_BFAR_ENST00000426842_chr16_14749067_+_SPNS1_ENST00000352260_chr16_28994178_+_1313nt
GCAGCAGTTTTCTACGTCTGAAATTTTTTATGTCTCTGGAACCCAGAATTTGCTAAGAGATGGAGGAACCTCAGAAAAGCTATGTGAACA
CAATGGACCTTGAGAGAGATGAACCTCTCAAAAGCACCGGCCCTCAGATTTCTGTTAGTGAATTTTCTTGCCACTGCTGCTACGACATCC
TGGTTAACCCCACCACCTTGAACTGTGGGCACAGCTTCTGCCGTCACTGCCTTGCTTTATGGTGGGCATCTTCAAAGAAAACAGAATGTC
CAGAATGCAGAGAAAAATGGGAAGGTTTCCCCAAAGTCAGTATTCTCCTCAGGTGGTCCTGCTCGTCTATCACTGGAGCAGCAGGGAATC
TGAACACGACCTCCTGGTCCACAAGGCTGTGGCCAAATGGACGGCGGAAGAAGTTGTCCTCTGGCTGGAGCAGCTGGGCCCTTGGGCATC
TCTTTACAGGGAAAGGTTTTTATCTGAACGAGTAAATGGAAGGTTGCTTTTAACTTTGACAGAGGAAGAATTTTCCAAGACGCCCTATAC
CATAGAAAACAGCAGCCACAGGAGAGCCATCCTCATGGAGCTAGAACGTGTCAAAGCATTAGGCGTGAAGCCCCCCCAGAATCTCTGGGA
ATATAAGATTTTCATCTTCATTGGAGAGACCCTCCTGTCCATGAACTGGGCCATCGTGGCCGACATTCTGCTGTACGTGGTGATCCCTAC
CCGACGCTCCACCGCCGAGGCCTTCCAGATCGTGCTGTCCCACCTGCTGGGTGATGCTGGGAGCCCCTACCTCATTGGCCTGATCTCTGA
CCGCCTGCGCCGGAACTGGCCCCCCTCCTTCTTGTCCGAGTTCCGGGCTCTGCAGTTCTCGCTCATGCTCTGCGCGTTTGTTGGGGCACT
GGGCGGCGCAGCCTTCCTGGGCACCGCCATCTTCATTGAGGCCGACCGCCGGCGGGCACAGCTGCACGTGCAGGGCCTGCTGCACGAAGC
AGGGTCCACAGACGACCGGATTGTGGTGCCCCAGCGGGGCCGCTCCACCCGCGTGCCCGTGGCCAGTGTGCTCATCTGAGAGGCTGCCGC
TCACCTACCTGCACATCTGCCACAGCTGGCCCTGGGCCCACCCCACGAAGGGCCTGGGCCTAACCCCTTGGCCTGGCCCAGCTTCCAGAG
GGACCCTGGGCCGTGTGCCAGCTCCCAGACACTACCTGGGTAGCTCAGGGGAGGAGGTGGGGGTCCAGGAGGGGGATCCCTCTCCACAGG


Top

FusionGenePPI for BFAR_SPNS1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BFARUBE2U, UBE2K, UBE2D1, UBE2D2, UBE2D3, UBE2D4, UBE2W, UBC, TMBIM6, BCL2, BCL2L1, CASP8, CASP10, HIP1, IFT57, BCAP31, NGFR, UBE2N, UNKSPNS1BCL2, BCL2L1, NLRX1, UNC93B1, CLN5, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BFAR_SPNS1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for BFAR_SPNS1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource