FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41237

FusionGeneSummary for UST_MYB

check button Fusion gene summary
Fusion gene informationFusion gene name: UST_MYB
Fusion gene ID: 41237
HgeneTgene
Gene symbol

UST

MYB

Gene ID

10090

4602

Gene nameuronyl 2-sulfotransferaseMYB proto-oncogene, transcription factor
Synonyms2OSTCmyb|c-myb|c-myb_CDS|efg
Cytomap

6q25.1

6q23.3

Type of geneprotein-codingprotein-coding
Descriptionuronyl 2-sulfotransferasedermatan/chondroitin sulfate 2-sulfotransferasetranscriptional activator Myboncogene AMVproto-oncogene c-Mybv-myb avian myeloblastosis viral oncogene homolog
Modification date2018052320180527
UniProtAcc

Q9Y2C2

P10242

Ensembl transtripts involved in fusion geneENST00000367463, ENST00000466695, 
ENST00000341911, ENST00000316528, 
ENST00000442647, ENST00000367814, 
ENST00000525369, ENST00000534121, 
ENST00000533624, ENST00000534044, 
ENST00000528774, ENST00000531845, 
ENST00000527615, ENST00000420123, 
Fusion gene scores* DoF score8 X 6 X 4=1927 X 5 X 3=105
# samples 89
** MAII scorelog2(8/192*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/105*10)=-0.222392421336448
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: UST [Title/Abstract] AND MYB [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneMYB

GO:0045944

positive regulation of transcription by RNA polymerase II

10233885|20484083


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-04-1356-01AUSTchr6

149208165

+MYBchr6

135539002

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000367463ENST00000341911USTchr6

149208165

+MYBchr6

135539002

+
In-frameENST00000367463ENST00000316528USTchr6

149208165

+MYBchr6

135539002

+
In-frameENST00000367463ENST00000442647USTchr6

149208165

+MYBchr6

135539002

+
Frame-shitENST00000367463ENST00000367814USTchr6

149208165

+MYBchr6

135539002

+
Frame-shitENST00000367463ENST00000525369USTchr6

149208165

+MYBchr6

135539002

+
In-frameENST00000367463ENST00000534121USTchr6

149208165

+MYBchr6

135539002

+
In-frameENST00000367463ENST00000533624USTchr6

149208165

+MYBchr6

135539002

+
In-frameENST00000367463ENST00000534044USTchr6

149208165

+MYBchr6

135539002

+
In-frameENST00000367463ENST00000528774USTchr6

149208165

+MYBchr6

135539002

+
5CDS-3UTRENST00000367463ENST00000531845USTchr6

149208165

+MYBchr6

135539002

+
5CDS-intronENST00000367463ENST00000527615USTchr6

149208165

+MYBchr6

135539002

+
5CDS-intronENST00000367463ENST00000420123USTchr6

149208165

+MYBchr6

135539002

+
intron-3CDSENST00000466695ENST00000341911USTchr6

149208165

+MYBchr6

135539002

+
intron-3CDSENST00000466695ENST00000316528USTchr6

149208165

+MYBchr6

135539002

+
intron-3CDSENST00000466695ENST00000442647USTchr6

149208165

+MYBchr6

135539002

+
intron-3CDSENST00000466695ENST00000367814USTchr6

149208165

+MYBchr6

135539002

+
intron-3CDSENST00000466695ENST00000525369USTchr6

149208165

+MYBchr6

135539002

+
intron-3CDSENST00000466695ENST00000534121USTchr6

149208165

+MYBchr6

135539002

+
intron-3CDSENST00000466695ENST00000533624USTchr6

149208165

+MYBchr6

135539002

+
intron-3CDSENST00000466695ENST00000534044USTchr6

149208165

+MYBchr6

135539002

+
intron-3CDSENST00000466695ENST00000528774USTchr6

149208165

+MYBchr6

135539002

+
intron-3UTRENST00000466695ENST00000531845USTchr6

149208165

+MYBchr6

135539002

+
intron-intronENST00000466695ENST00000527615USTchr6

149208165

+MYBchr6

135539002

+
intron-intronENST00000466695ENST00000420123USTchr6

149208165

+MYBchr6

135539002

+

Top

FusionProtFeatures for UST_MYB


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
UST

Q9Y2C2

MYB

P10242

Sulfotransferase that catalyzes the transfer of sulfateto the position 2 of uronyl residues. Has mainly activity towardiduronyl residues in dermatan sulfate, and weaker activity towardglucuronyl residues of chondroitin sulfate. Has no activity towarddesulfated N-resulfated heparin.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for UST_MYB


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000316528_chr6_135539002_+_136aa
MKKKQQHPGGGADPWPHGAPMGGAPPGLGSWKRRVPLLPFLRFSLRDYGFCMATLLVFCLGSLLYQLSGGPPRFLLDLRQYLGNSTYLDD

>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000442647_chr6_135539002_+_136aa
MKKKQQHPGGGADPWPHGAPMGGAPPGLGSWKRRVPLLPFLRFSLRDYGFCMATLLVFCLGSLLYQLSGGPPRFLLDLRQYLGNSTYLDD

>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000534121_chr6_135539002_+_136aa
MKKKQQHPGGGADPWPHGAPMGGAPPGLGSWKRRVPLLPFLRFSLRDYGFCMATLLVFCLGSLLYQLSGGPPRFLLDLRQYLGNSTYLDD

>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000533624_chr6_135539002_+_136aa
MKKKQQHPGGGADPWPHGAPMGGAPPGLGSWKRRVPLLPFLRFSLRDYGFCMATLLVFCLGSLLYQLSGGPPRFLLDLRQYLGNSTYLDD

>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000534044_chr6_135539002_+_136aa
MKKKQQHPGGGADPWPHGAPMGGAPPGLGSWKRRVPLLPFLRFSLRDYGFCMATLLVFCLGSLLYQLSGGPPRFLLDLRQYLGNSTYLDD

>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000528774_chr6_135539002_+_136aa
MKKKQQHPGGGADPWPHGAPMGGAPPGLGSWKRRVPLLPFLRFSLRDYGFCMATLLVFCLGSLLYQLSGGPPRFLLDLRQYLGNSTYLDD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000316528_chr6_135539002_+_408nt
ATGAAGAAGAAGCAGCAGCATCCCGGCGGCGGCGCGGATCCCTGGCCCCATGGGGCCCCTATGGGGGGCGCCCCTCCGGGCCTGGGCAGC
TGGAAGCGTCGGGTGCCCCTGCTGCCTTTCCTGCGCTTCTCCCTCCGGGACTACGGCTTCTGCATGGCCACCCTGCTGGTCTTCTGCCTG
GGCTCCCTCCTCTATCAGCTCAGCGGGGGACCCCCTCGCTTCCTGCTCGACCTGCGGCAGTACTTGGGAAATTCCACTTACTTGGATGAC
CATGGACCACCTCCTAGTAAGCCTTGTAGCAGTACCTGGGAACCTGCATCCTGTGGAAAGATGGAGGAGCAGATGACATCTTCCAGTCAA

>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000442647_chr6_135539002_+_408nt
ATGAAGAAGAAGCAGCAGCATCCCGGCGGCGGCGCGGATCCCTGGCCCCATGGGGCCCCTATGGGGGGCGCCCCTCCGGGCCTGGGCAGC
TGGAAGCGTCGGGTGCCCCTGCTGCCTTTCCTGCGCTTCTCCCTCCGGGACTACGGCTTCTGCATGGCCACCCTGCTGGTCTTCTGCCTG
GGCTCCCTCCTCTATCAGCTCAGCGGGGGACCCCCTCGCTTCCTGCTCGACCTGCGGCAGTACTTGGGAAATTCCACTTACTTGGATGAC
CATGGACCACCTCCTAGTAAGCCTTGTAGCAGTACCTGGGAACCTGCATCCTGTGGAAAGATGGAGGAGCAGATGACATCTTCCAGTCAA

>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000534121_chr6_135539002_+_408nt
ATGAAGAAGAAGCAGCAGCATCCCGGCGGCGGCGCGGATCCCTGGCCCCATGGGGCCCCTATGGGGGGCGCCCCTCCGGGCCTGGGCAGC
TGGAAGCGTCGGGTGCCCCTGCTGCCTTTCCTGCGCTTCTCCCTCCGGGACTACGGCTTCTGCATGGCCACCCTGCTGGTCTTCTGCCTG
GGCTCCCTCCTCTATCAGCTCAGCGGGGGACCCCCTCGCTTCCTGCTCGACCTGCGGCAGTACTTGGGAAATTCCACTTACTTGGATGAC
CATGGACCACCTCCTAGTAAGCCTTGTAGCAGTACCTGGGAACCTGCATCCTGTGGAAAGATGGAGGAGCAGATGACATCTTCCAGTCAA

>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000533624_chr6_135539002_+_408nt
ATGAAGAAGAAGCAGCAGCATCCCGGCGGCGGCGCGGATCCCTGGCCCCATGGGGCCCCTATGGGGGGCGCCCCTCCGGGCCTGGGCAGC
TGGAAGCGTCGGGTGCCCCTGCTGCCTTTCCTGCGCTTCTCCCTCCGGGACTACGGCTTCTGCATGGCCACCCTGCTGGTCTTCTGCCTG
GGCTCCCTCCTCTATCAGCTCAGCGGGGGACCCCCTCGCTTCCTGCTCGACCTGCGGCAGTACTTGGGAAATTCCACTTACTTGGATGAC
CATGGACCACCTCCTAGTAAGCCTTGTAGCAGTACCTGGGAACCTGCATCCTGTGGAAAGATGGAGGAGCAGATGACATCTTCCAGTCAA

>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000534044_chr6_135539002_+_408nt
ATGAAGAAGAAGCAGCAGCATCCCGGCGGCGGCGCGGATCCCTGGCCCCATGGGGCCCCTATGGGGGGCGCCCCTCCGGGCCTGGGCAGC
TGGAAGCGTCGGGTGCCCCTGCTGCCTTTCCTGCGCTTCTCCCTCCGGGACTACGGCTTCTGCATGGCCACCCTGCTGGTCTTCTGCCTG
GGCTCCCTCCTCTATCAGCTCAGCGGGGGACCCCCTCGCTTCCTGCTCGACCTGCGGCAGTACTTGGGAAATTCCACTTACTTGGATGAC
CATGGACCACCTCCTAGTAAGCCTTGTAGCAGTACCTGGGAACCTGCATCCTGTGGAAAGATGGAGGAGCAGATGACATCTTCCAGTCAA

>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000528774_chr6_135539002_+_408nt
ATGAAGAAGAAGCAGCAGCATCCCGGCGGCGGCGCGGATCCCTGGCCCCATGGGGCCCCTATGGGGGGCGCCCCTCCGGGCCTGGGCAGC
TGGAAGCGTCGGGTGCCCCTGCTGCCTTTCCTGCGCTTCTCCCTCCGGGACTACGGCTTCTGCATGGCCACCCTGCTGGTCTTCTGCCTG
GGCTCCCTCCTCTATCAGCTCAGCGGGGGACCCCCTCGCTTCCTGCTCGACCTGCGGCAGTACTTGGGAAATTCCACTTACTTGGATGAC
CATGGACCACCTCCTAGTAAGCCTTGTAGCAGTACCTGGGAACCTGCATCCTGTGGAAAGATGGAGGAGCAGATGACATCTTCCAGTCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000316528_chr6_135539002_+_1702nt
CGGCCCTCCCCATGTGCAGCCGGCCAGCCGGGCTCTCCTCCTCGCGGCGGATGGGTGACCTTTTCCTGGCACGGGCAGGCTGTGGGAGGC
AGCGGAGCAGGCGATGAAGAAGAAGCAGCAGCATCCCGGCGGCGGCGCGGATCCCTGGCCCCATGGGGCCCCTATGGGGGGCGCCCCTCC
GGGCCTGGGCAGCTGGAAGCGTCGGGTGCCCCTGCTGCCTTTCCTGCGCTTCTCCCTCCGGGACTACGGCTTCTGCATGGCCACCCTGCT
GGTCTTCTGCCTGGGCTCCCTCCTCTATCAGCTCAGCGGGGGACCCCCTCGCTTCCTGCTCGACCTGCGGCAGTACTTGGGAAATTCCAC
TTACTTGGATGACCATGGACCACCTCCTAGTAAGCCTTGTAGCAGTACCTGGGAACCTGCATCCTGTGGAAAGATGGAGGAGCAGATGAC
ATCTTCCAGTCAAGCTCGTAAATACGTGAATGCATTCTCAGCCCGGACGCTGGTCATGTGAGACATTTCCAGAAAAGCATTATGGTTTTC
AGAACACTTCAAGTTGACTTGGGATATATCATTCCTCAACATGAAACTTTTCATGAATGGGAGAAGAACCTATTTTTGTTGTGGTACAAC
AGTTGAGAGCAGCACCAAGTGCATTTAGTTGAATGAAGTCTTCTTGGATTTCACCCAACTAAAAGGATTTTTAAAAATAAATAACAGTCT
TACCTAAATTATTAGGTAATGAATTGTAGCCAGTTGTTAATATCTTAATGCAGATTTTTTTAAAAAAAACATAAAATGATTTATCTGTAT
TTTAAAGGATCCAACAGATCAGTATTTTTTCCTGTGATGGGTTTTTTGAAATTTGACACATTAAAAGGTACTCCAGTATTTCACTTTTCT
CGATCACTAAACATATGCATATATTTTTAAAAATCAGTAAAAGCATTACTCTAAGTGTAGACTTAATACCATGTGACATTTAATCCAGAT
TGTAAATGCTCATTTATGGTTAATGACATTGAAGGTACATTTATTGTACCAAACCATTTTATGAGTTTTCTGTTAGCTTGCTTTAAAAAT
TATTACTGTAAGAAATAGTTTTATAAAAAATTATATTTTTATTCAGTAATTTAATTTTGTAAATGCCAAATGAAAAACGTTTTTTGCTGC
TATGGTCTTAGCCTGTAGACATGCTGCTAGTATCAGAGGGGCAGTAGAGCTTGGACAGAAAGAAAAGAAACTTGGTGTTAGGTAATTGAC
TATGCACTAGTATTTCAGACTTTTTAATTTTATATATATATACATTTTTTTTCCTTCTGCAATACATTTGAAAACTTGTTTGGGAGACTC
TGCATTTTTTATTGTGGTTTTTTTGTTATTGTTGGTTTATACAAGCATGCGTTGCACTTCTTTTTTGGGAGATGTGTGTTGTTGATGTTC
TATGTTTTGTTTTGAGTGTAGCCTGACTGTTTTATAATTTGGGAGTTCTGCATTTGATCCGCATCCCCTGTGGTTTCTAAGTGTATGGTC
TCAGAACTGTTGCATGGATCCTGTGTTTGCAACTGGGGAGACAGAAACTGTGGTTGATAGCCAGTCACTGCCTTAAGAACATTTGATGCA

>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000442647_chr6_135539002_+_1702nt
CGGCCCTCCCCATGTGCAGCCGGCCAGCCGGGCTCTCCTCCTCGCGGCGGATGGGTGACCTTTTCCTGGCACGGGCAGGCTGTGGGAGGC
AGCGGAGCAGGCGATGAAGAAGAAGCAGCAGCATCCCGGCGGCGGCGCGGATCCCTGGCCCCATGGGGCCCCTATGGGGGGCGCCCCTCC
GGGCCTGGGCAGCTGGAAGCGTCGGGTGCCCCTGCTGCCTTTCCTGCGCTTCTCCCTCCGGGACTACGGCTTCTGCATGGCCACCCTGCT
GGTCTTCTGCCTGGGCTCCCTCCTCTATCAGCTCAGCGGGGGACCCCCTCGCTTCCTGCTCGACCTGCGGCAGTACTTGGGAAATTCCAC
TTACTTGGATGACCATGGACCACCTCCTAGTAAGCCTTGTAGCAGTACCTGGGAACCTGCATCCTGTGGAAAGATGGAGGAGCAGATGAC
ATCTTCCAGTCAAGCTCGTAAATACGTGAATGCATTCTCAGCCCGGACGCTGGTCATGTGAGACATTTCCAGAAAAGCATTATGGTTTTC
AGAACACTTCAAGTTGACTTGGGATATATCATTCCTCAACATGAAACTTTTCATGAATGGGAGAAGAACCTATTTTTGTTGTGGTACAAC
AGTTGAGAGCAGCACCAAGTGCATTTAGTTGAATGAAGTCTTCTTGGATTTCACCCAACTAAAAGGATTTTTAAAAATAAATAACAGTCT
TACCTAAATTATTAGGTAATGAATTGTAGCCAGTTGTTAATATCTTAATGCAGATTTTTTTAAAAAAAACATAAAATGATTTATCTGTAT
TTTAAAGGATCCAACAGATCAGTATTTTTTCCTGTGATGGGTTTTTTGAAATTTGACACATTAAAAGGTACTCCAGTATTTCACTTTTCT
CGATCACTAAACATATGCATATATTTTTAAAAATCAGTAAAAGCATTACTCTAAGTGTAGACTTAATACCATGTGACATTTAATCCAGAT
TGTAAATGCTCATTTATGGTTAATGACATTGAAGGTACATTTATTGTACCAAACCATTTTATGAGTTTTCTGTTAGCTTGCTTTAAAAAT
TATTACTGTAAGAAATAGTTTTATAAAAAATTATATTTTTATTCAGTAATTTAATTTTGTAAATGCCAAATGAAAAACGTTTTTTGCTGC
TATGGTCTTAGCCTGTAGACATGCTGCTAGTATCAGAGGGGCAGTAGAGCTTGGACAGAAAGAAAAGAAACTTGGTGTTAGGTAATTGAC
TATGCACTAGTATTTCAGACTTTTTAATTTTATATATATATACATTTTTTTTCCTTCTGCAATACATTTGAAAACTTGTTTGGGAGACTC
TGCATTTTTTATTGTGGTTTTTTTGTTATTGTTGGTTTATACAAGCATGCGTTGCACTTCTTTTTTGGGAGATGTGTGTTGTTGATGTTC
TATGTTTTGTTTTGAGTGTAGCCTGACTGTTTTATAATTTGGGAGTTCTGCATTTGATCCGCATCCCCTGTGGTTTCTAAGTGTATGGTC
TCAGAACTGTTGCATGGATCCTGTGTTTGCAACTGGGGAGACAGAAACTGTGGTTGATAGCCAGTCACTGCCTTAAGAACATTTGATGCA

>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000534121_chr6_135539002_+_511nt
CGGCCCTCCCCATGTGCAGCCGGCCAGCCGGGCTCTCCTCCTCGCGGCGGATGGGTGACCTTTTCCTGGCACGGGCAGGCTGTGGGAGGC
AGCGGAGCAGGCGATGAAGAAGAAGCAGCAGCATCCCGGCGGCGGCGCGGATCCCTGGCCCCATGGGGCCCCTATGGGGGGCGCCCCTCC
GGGCCTGGGCAGCTGGAAGCGTCGGGTGCCCCTGCTGCCTTTCCTGCGCTTCTCCCTCCGGGACTACGGCTTCTGCATGGCCACCCTGCT
GGTCTTCTGCCTGGGCTCCCTCCTCTATCAGCTCAGCGGGGGACCCCCTCGCTTCCTGCTCGACCTGCGGCAGTACTTGGGAAATTCCAC
TTACTTGGATGACCATGGACCACCTCCTAGTAAGCCTTGTAGCAGTACCTGGGAACCTGCATCCTGTGGAAAGATGGAGGAGCAGATGAC

>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000533624_chr6_135539002_+_511nt
CGGCCCTCCCCATGTGCAGCCGGCCAGCCGGGCTCTCCTCCTCGCGGCGGATGGGTGACCTTTTCCTGGCACGGGCAGGCTGTGGGAGGC
AGCGGAGCAGGCGATGAAGAAGAAGCAGCAGCATCCCGGCGGCGGCGCGGATCCCTGGCCCCATGGGGCCCCTATGGGGGGCGCCCCTCC
GGGCCTGGGCAGCTGGAAGCGTCGGGTGCCCCTGCTGCCTTTCCTGCGCTTCTCCCTCCGGGACTACGGCTTCTGCATGGCCACCCTGCT
GGTCTTCTGCCTGGGCTCCCTCCTCTATCAGCTCAGCGGGGGACCCCCTCGCTTCCTGCTCGACCTGCGGCAGTACTTGGGAAATTCCAC
TTACTTGGATGACCATGGACCACCTCCTAGTAAGCCTTGTAGCAGTACCTGGGAACCTGCATCCTGTGGAAAGATGGAGGAGCAGATGAC

>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000534044_chr6_135539002_+_511nt
CGGCCCTCCCCATGTGCAGCCGGCCAGCCGGGCTCTCCTCCTCGCGGCGGATGGGTGACCTTTTCCTGGCACGGGCAGGCTGTGGGAGGC
AGCGGAGCAGGCGATGAAGAAGAAGCAGCAGCATCCCGGCGGCGGCGCGGATCCCTGGCCCCATGGGGCCCCTATGGGGGGCGCCCCTCC
GGGCCTGGGCAGCTGGAAGCGTCGGGTGCCCCTGCTGCCTTTCCTGCGCTTCTCCCTCCGGGACTACGGCTTCTGCATGGCCACCCTGCT
GGTCTTCTGCCTGGGCTCCCTCCTCTATCAGCTCAGCGGGGGACCCCCTCGCTTCCTGCTCGACCTGCGGCAGTACTTGGGAAATTCCAC
TTACTTGGATGACCATGGACCACCTCCTAGTAAGCCTTGTAGCAGTACCTGGGAACCTGCATCCTGTGGAAAGATGGAGGAGCAGATGAC

>In-frame_UST_ENST00000367463_chr6_149208165_+_MYB_ENST00000528774_chr6_135539002_+_511nt
CGGCCCTCCCCATGTGCAGCCGGCCAGCCGGGCTCTCCTCCTCGCGGCGGATGGGTGACCTTTTCCTGGCACGGGCAGGCTGTGGGAGGC
AGCGGAGCAGGCGATGAAGAAGAAGCAGCAGCATCCCGGCGGCGGCGCGGATCCCTGGCCCCATGGGGCCCCTATGGGGGGCGCCCCTCC
GGGCCTGGGCAGCTGGAAGCGTCGGGTGCCCCTGCTGCCTTTCCTGCGCTTCTCCCTCCGGGACTACGGCTTCTGCATGGCCACCCTGCT
GGTCTTCTGCCTGGGCTCCCTCCTCTATCAGCTCAGCGGGGGACCCCCTCGCTTCCTGCTCGACCTGCGGCAGTACTTGGGAAATTCCAC
TTACTTGGATGACCATGGACCACCTCCTAGTAAGCCTTGTAGCAGTACCTGGGAACCTGCATCCTGTGGAAAGATGGAGGAGCAGATGAC


Top

FusionGenePPI for UST_MYB


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
USTELAVL1, CUL3, MRAP2, SLC27A6, INHBE, PPT2, CANX, DCAKD, PON2, GLG1, GOLIM4, XYLT2, MAN1A1, JAG2, OCIAD1, LDLR, IMPAD1, ERO1LB, OMA1MYBPML, SMARCA2, CREBBP, NCL, CEBPB, CEBPE, MAF, SND1, PAX5, FBXW7, ZMYND11, KMT2A, WDR5, RBBP5, ASH2L, MEN1, NLK, HIPK2, HLF, SP100, PARP1, EP300, TRIM28, SKI, SIN3A, NCOR1, UBE2I, CHD3, KAT2B, RPL4, LEF1, KAT5, GATA3, STAT5A, TRAF6, FBXW5, DDB1, CUL4A, PIAS1, RBX1, SUMO1, SUMO2, CCND3, MYOZ2, PPM1K, ERC2, UPF2, KAT2A, HSPA8


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for UST_MYB


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for UST_MYB


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneUSTC0014175Endometriosis1CTD_human
TgeneMYBC0010606Adenoid Cystic Carcinoma2CTD_human
TgeneMYBC0017638Glioma2CTD_human
TgeneMYBC0004096Asthma1CTD_human
TgeneMYBC1961099Precursor T-Cell Lymphoblastic Leukemia-Lymphoma1CTD_human