FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 41190

FusionGeneSummary for USP6NL_FAM107B

check button Fusion gene summary
Fusion gene informationFusion gene name: USP6NL_FAM107B
Fusion gene ID: 41190
HgeneTgene
Gene symbol

USP6NL

FAM107B

Gene ID

9712

83641

Gene nameUSP6 N-terminal likefamily with sequence similarity 107 member B
SynonymsRNTRE|TRE2NL|USP6NL-IT1C10orf45|HITS
Cytomap

10p14

10p13

Type of geneprotein-codingprotein-coding
DescriptionUSP6 N-terminal-like proteinrelated to the N-terminus of treprotein FAM107BFAM107B/CDNF fusionheat shock-inducible tumor small protein
Modification date2018052320180519
UniProtAcc

Q92738

Q9H098

Ensembl transtripts involved in fusion geneENST00000609104, ENST00000277575, 
ENST00000379237, ENST00000443016, 
ENST00000609853, 
ENST00000181796, 
ENST00000378470, ENST00000468747, 
ENST00000378467, ENST00000378465, 
ENST00000378458, ENST00000478076, 
ENST00000378462, ENST00000496330, 
ENST00000479731, ENST00000471815, 
Fusion gene scores* DoF score17 X 12 X 9=18369 X 7 X 6=378
# samples 189
** MAII scorelog2(18/1836*10)=-3.35049724708413
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/378*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: USP6NL [Title/Abstract] AND FAM107B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneUSP6NL

GO:0043547

positive regulation of GTPase activity

17562788


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-44-6145-01AUSP6NLchr10

11560534

-FAM107Bchr10

14709690

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000609104ENST00000181796USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000609104ENST00000378470USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000609104ENST00000468747USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000609104ENST00000378467USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000609104ENST00000378465USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000609104ENST00000378458USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000609104ENST00000478076USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000609104ENST00000378462USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000609104ENST00000496330USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000609104ENST00000479731USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000609104ENST00000471815USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
In-frameENST00000277575ENST00000181796USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000277575ENST00000378470USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000277575ENST00000468747USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000277575ENST00000378467USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000277575ENST00000378465USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000277575ENST00000378458USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000277575ENST00000478076USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000277575ENST00000378462USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000277575ENST00000496330USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000277575ENST00000479731USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000277575ENST00000471815USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
In-frameENST00000379237ENST00000181796USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000379237ENST00000378470USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000379237ENST00000468747USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000379237ENST00000378467USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000379237ENST00000378465USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000379237ENST00000378458USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000379237ENST00000478076USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000379237ENST00000378462USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000379237ENST00000496330USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000379237ENST00000479731USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
5CDS-intronENST00000379237ENST00000471815USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-3CDSENST00000443016ENST00000181796USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000443016ENST00000378470USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000443016ENST00000468747USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000443016ENST00000378467USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000443016ENST00000378465USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000443016ENST00000378458USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000443016ENST00000478076USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000443016ENST00000378462USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000443016ENST00000496330USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000443016ENST00000479731USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000443016ENST00000471815USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-3CDSENST00000609853ENST00000181796USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000609853ENST00000378470USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000609853ENST00000468747USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000609853ENST00000378467USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000609853ENST00000378465USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000609853ENST00000378458USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000609853ENST00000478076USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000609853ENST00000378462USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000609853ENST00000496330USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000609853ENST00000479731USP6NLchr10

11560534

-FAM107Bchr10

14709690

-
intron-intronENST00000609853ENST00000471815USP6NLchr10

11560534

-FAM107Bchr10

14709690

-

Top

FusionProtFeatures for USP6NL_FAM107B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
USP6NL

Q92738

FAM107B

Q9H098

Acts as a GTPase-activating protein for RAB5A and RAB43.Involved in receptor trafficking. In complex with EPS8 inhibitsinternalization of EGFR. Involved in retrograde transport from theendocytic pathway to the Golgi apparatus. Involved in thetransport of Shiga toxin from early and recycling endosomes to thetrans-Golgi network. Required for structural integrity of theGolgi complex. {ECO:0000269|PubMed:11099046,ECO:0000269|PubMed:17562788, ECO:0000269|PubMed:17684057}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneFAM107Bchr10:11560534chr10:14709690ENST00000378458-0561_112-183132Coiled coilOntology_term=ECO:0000255
TgeneFAM107Bchr10:11560534chr10:14709690ENST00000378462-0461_112-60132Coiled coilOntology_term=ECO:0000255
TgeneFAM107Bchr10:11560534chr10:14709690ENST00000378465-0461_112-87132Coiled coilOntology_term=ECO:0000255
TgeneFAM107Bchr10:11560534chr10:14709690ENST00000378467-0561_112-101132Coiled coilOntology_term=ECO:0000255
TgeneFAM107Bchr10:11560534chr10:14709690ENST00000378470-0461_112-96132Coiled coilOntology_term=ECO:0000255
TgeneFAM107Bchr10:11560534chr10:14709690ENST00000468747-0461_112-69132Coiled coilOntology_term=ECO:0000255
TgeneFAM107Bchr10:11560534chr10:14709690ENST00000478076-0461_112-74132Coiled coilOntology_term=ECO:0000255
TgeneFAM107Bchr10:11560534chr10:14709690ENST00000479731-0461_112-48132Coiled coilOntology_term=ECO:0000255
TgeneFAM107Bchr10:11560534chr10:14709690ENST00000496330-0561_112-83132Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneUSP6NLchr10:11560534chr10:14709690ENST00000277575-414100_29282846DomainRab-GAP TBC
HgeneUSP6NLchr10:11560534chr10:14709690ENST00000379237-414100_29288852DomainRab-GAP TBC
TgeneFAM107Bchr10:11560534chr10:14709690ENST00000181796-0561_112137307Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for USP6NL_FAM107B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_USP6NL_ENST00000609104_chr10_11560534_-_FAM107B_ENST00000181796_chr10_14709690_-_235aa
MNSDQDVALKLAQERAEIVAKTDRGREGAEIEPWEDADYLVYKVTDRFGFLHEEELPDHNVAVEREEEFREEPKCLELEQKMTSDSPPED
IDHKDSTLITRSIMAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKK

>In-frame_USP6NL_ENST00000277575_chr10_11560534_-_FAM107B_ENST00000181796_chr10_14709690_-_252aa
MRTEAVVNSQGQTDTLTKDSDQDVALKLAQERAEIVAKTDRGREGAEIEPWEDADYLVYKVTDRFGFLHEEELPDHNVAVEREEEFREEP
KCLELEQKMTSDSPPEDIDHKDSTLITRSIMAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKR

>In-frame_USP6NL_ENST00000379237_chr10_11560534_-_FAM107B_ENST00000181796_chr10_14709690_-_258aa
MIQVLQIVKELVTPSRQKAATVKEDSDQDVALKLAQERAEIVAKTDRGREGAEIEPWEDADYLVYKVTDRFGFLHEEELPDHNVAVEREE
EFREEPKCLELEQKMTSDSPPEDIDHKDSTLITRSIMAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_USP6NL_ENST00000609104_chr10_11560534_-_FAM107B_ENST00000181796_chr10_14709690_-_705nt
ATGAATTCAGACCAGGATGTAGCACTCAAACTTGCCCAGGAGCGAGCTGAAATAGTTGCTAAATATGACAGAGGACGAGAAGGTGCAGAG
ATTGAACCTTGGGAAGATGCTGATTACCTTGTTTACAAAGTCACAGATAGATTTGGCTTTTTACATGAGGAGGAGCTCCCAGATCATAAT
GTGGCTGTGGAACGGGAAGAAGAATTTCGAGAAGAACCTAAATGCCTCGAGCTGGAGCAGAAAATGACATCAGACAGCCCACCTGAGGAT
ATTGACCATAAGGACTCATATCTCATTACAAGAAGCATCATGGCCGAGCCAGACTACATAGAAGATGACAATCCTGAACTCATTAGGCCT
CAGAAACTGATCAATCCTGTAAAAACCTCCCGGAACCATCAAGATCTTCACAGAGAACTTCTTATGAATCAAAAAAGGGGTCTTGCTCCT
CAGAACAAACCAGAATTGCAGAAGGTGATGGAAAAAAGAAAACGAGACCAAGTAATAAAGCAGAAGGAAGAAGAAGCACAGAAGAAGAAA
TCTGACTTGGAAATAGAGCTATTAAAACGGCAGCAGAAGTTGGAGCAGCTTGAACTTGAGAAGCAGAAATTGCAAGAAGAGCAAGAAAAT

>In-frame_USP6NL_ENST00000277575_chr10_11560534_-_FAM107B_ENST00000181796_chr10_14709690_-_756nt
ATGAGGACTGAAGCTGTTGTTAATTCCCAAGGCCAGACTGATTATCTCACAAAGGATTCAGACCAGGATGTAGCACTCAAACTTGCCCAG
GAGCGAGCTGAAATAGTTGCTAAATATGACAGAGGACGAGAAGGTGCAGAGATTGAACCTTGGGAAGATGCTGATTACCTTGTTTACAAA
GTCACAGATAGATTTGGCTTTTTACATGAGGAGGAGCTCCCAGATCATAATGTGGCTGTGGAACGGGAAGAAGAATTTCGAGAAGAACCT
AAATGCCTCGAGCTGGAGCAGAAAATGACATCAGACAGCCCACCTGAGGATATTGACCATAAGGACTCATATCTCATTACAAGAAGCATC
ATGGCCGAGCCAGACTACATAGAAGATGACAATCCTGAACTCATTAGGCCTCAGAAACTGATCAATCCTGTAAAAACCTCCCGGAACCAT
CAAGATCTTCACAGAGAACTTCTTATGAATCAAAAAAGGGGTCTTGCTCCTCAGAACAAACCAGAATTGCAGAAGGTGATGGAAAAAAGA
AAACGAGACCAAGTAATAAAGCAGAAGGAAGAAGAAGCACAGAAGAAGAAATCTGACTTGGAAATAGAGCTATTAAAACGGCAGCAGAAG
TTGGAGCAGCTTGAACTTGAGAAGCAGAAATTGCAAGAAGAGCAAGAAAATGCCCCCGAGTTTGTGAAGGTGAAAGGCAATCTCAGGAGA

>In-frame_USP6NL_ENST00000379237_chr10_11560534_-_FAM107B_ENST00000181796_chr10_14709690_-_774nt
ATGATTCAAGTCTTGCAGATTGTAAAGGAGCTGGTGACACCATCAAGGCAAAAAGCAGCCACAGTGAAGGAAGATTCAGACCAGGATGTA
GCACTCAAACTTGCCCAGGAGCGAGCTGAAATAGTTGCTAAATATGACAGAGGACGAGAAGGTGCAGAGATTGAACCTTGGGAAGATGCT
GATTACCTTGTTTACAAAGTCACAGATAGATTTGGCTTTTTACATGAGGAGGAGCTCCCAGATCATAATGTGGCTGTGGAACGGGAAGAA
GAATTTCGAGAAGAACCTAAATGCCTCGAGCTGGAGCAGAAAATGACATCAGACAGCCCACCTGAGGATATTGACCATAAGGACTCATAT
CTCATTACAAGAAGCATCATGGCCGAGCCAGACTACATAGAAGATGACAATCCTGAACTCATTAGGCCTCAGAAACTGATCAATCCTGTA
AAAACCTCCCGGAACCATCAAGATCTTCACAGAGAACTTCTTATGAATCAAAAAAGGGGTCTTGCTCCTCAGAACAAACCAGAATTGCAG
AAGGTGATGGAAAAAAGAAAACGAGACCAAGTAATAAAGCAGAAGGAAGAAGAAGCACAGAAGAAGAAATCTGACTTGGAAATAGAGCTA
TTAAAACGGCAGCAGAAGTTGGAGCAGCTTGAACTTGAGAAGCAGAAATTGCAAGAAGAGCAAGAAAATGCCCCCGAGTTTGTGAAGGTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_USP6NL_ENST00000609104_chr10_11560534_-_FAM107B_ENST00000181796_chr10_14709690_-_3730nt
CGGCCGCTGCGGTGACGGTTGGCGGCGGCCGGTGAGGCGGGCGGGGCCGGAGGCGCGGAGGCGGGGTCCCGGGCGAGCCGCCCTGGGAGG
CGGGGGCCGTTTCCATAGCGGCGGCAGGAGGTGTCGCGCCGGGGAACTTCCTGGTTCCCGGGCTCGGCTTCGCCGGGATCCTCTTGGAAG
GGAAACAATGGGGCGGAGGGCACTGCGGTAGCCGCCGCCGCCGCCGCGCCGCGCCGCGCCGGATCTGCTCGGCCGCCCGGGACCGCCAGC
TCTGTCCGCTGCCCACAGCCTAGCAGTCGGGACCGTACTGAGGACATGTATTCCTCTGAGAAACCTTGGACAGCAGATTTTGGTTTAATA
TCTGATTGGGACAACATTCAGACCCATTTCCAGTCATGAATTCAGACCAGGATGTAGCACTCAAACTTGCCCAGGAGCGAGCTGAAATAG
TTGCTAAATATGACAGAGGACGAGAAGGTGCAGAGATTGAACCTTGGGAAGATGCTGATTACCTTGTTTACAAAGTCACAGATAGATTTG
GCTTTTTACATGAGGAGGAGCTCCCAGATCATAATGTGGCTGTGGAACGGGAAGAAGAATTTCGAGAAGAACCTAAATGCCTCGAGCTGG
AGCAGAAAATGACATCAGACAGCCCACCTGAGGATATTGACCATAAGGACTCATATCTCATTACAAGAAGCATCATGGCCGAGCCAGACT
ACATAGAAGATGACAATCCTGAACTCATTAGGCCTCAGAAACTGATCAATCCTGTAAAAACCTCCCGGAACCATCAAGATCTTCACAGAG
AACTTCTTATGAATCAAAAAAGGGGTCTTGCTCCTCAGAACAAACCAGAATTGCAGAAGGTGATGGAAAAAAGAAAACGAGACCAAGTAA
TAAAGCAGAAGGAAGAAGAAGCACAGAAGAAGAAATCTGACTTGGAAATAGAGCTATTAAAACGGCAGCAGAAGTTGGAGCAGCTTGAAC
TTGAGAAGCAGAAATTGCAAGAAGAGCAAGAAAATGCCCCCGAGTTTGTGAAGGTGAAAGGCAATCTCAGGAGAACAGGCCAAGAAGTCG
CCCAAGCCCAGGAGTCCTAGGCTGAGGCTGCACCAAGACCTCGTGTGTCACCCCACAGAGCTGTCTGTGGGTGCCTTCTCAATCTCAGGG
CAAAAGCCCCTGGAGAATATTTCAGCCAGCAGAGAATTTTGACTTGCAGTAGGATTTGGTTTGATTTTCCTACGATCTGGGTGGATGCCT
TGCCTGTGACAGTTGCAGTTCCTATTCGCCAAATGAAGGGCAGTGCCCCGCACGTAAGTTGGAATGATGGACCTGTGTTCAGAGACTTAA
CAGAACCAACAAGCAAAACAAGTGAGAACAGGAAAAAGGAAGAGGACACTGGAATCAATTCTTGAGAGTTGCACTACTTGGTTTTTCTTC
CATTCCAAGTTTCGTGGGACCCAGAGCCTTTTTTCTTTTAAAAGCTAAAAAACAAGTGTTTAATTCCTCTTTTTGTTATCTGTTAGATAA
TTGAGATCACCTAGAAATGCGTTTAATCTGTTCACTCACTGTAAATTTTGAGGACCCAGAATTGTCTTGTTTAATTTATACTTTCACCCC
TGTTGCAGTTAACACCAGAGAAGGAACGTGAATGTCGAGCACAGCCACTACCCTTGTTGGCACTTAATTTAGAAATAGGGTGAGAAGTTT
AAAAGCCCATCTTGATTTTATTTTCATTCCTTTTGGTTCTCTGTGTAATAATAGCAGGCTACATAGTGACATTCCAGTTCCAAGAAGGTA
CATCCTGTCCATTCATTAATTGCTTTGATTACTAGGAGGGTTTCTGTTCAGTTTTGTTTTTAAATGTCTTGCTGATCTAGTTCTTTCAGA
TGGAATAACCTTCCAGTCCCTTAGAGAGTGGAACTAGTCCATATAACCCAGCTTCAGTAGCAAAAGTAGAAGCCGCCACATCTTTTCATT
TCTCCAAGAGGAGAGTGGGGAAGGTTCCCATGACCAGCTGGGCAGTCAGGATTTCTCTAGGCATTCTAATGTGAAATAAGTGTAGACTGC
TGTCAAGGAGGCTTCATCAGAAGATGTATAGCATTTGAATGTCTAATGATAATGCATATCATTAGAATCCAAGCTTTGAAAATTTCTGAT
TAATGCTCATGTATTTCTTTATCTTTGTTTTTCCTTGTGAAGAAAGACTTTCACCACTGTCTGAGTGATGATGCTGTTGATAAGGATGAT
GTCGATGACTACTATATTGCATCTCTCAGGAACAGCTGATGGGAAGGGAGGGGCTGCTGAGTTCCCTTGTTCTAGCTAGCAGCACGCTCC
TCAGAGAGGGGGCCGAGTTACAGACAGCAGCCGCATTCTCATGCAAAATTAGTTTTAAACTGCTAGTGTGGGCATCGGTACCTTTTGCCT
GGGTGATACCGAAGAATTGTTGAGGATTTAGTATGCTCCGTAGAGACAGTTCAGCCAGTCATTTCTGCATTGGAGAGACTTCTCATACTT
TCTTTGAAGACTCATAGAAAGCTGGATCTAGAGCTTTTGAATCCTTAATTAGCACAGTAGAAATTAGCTTTCTATGGGAATGCTTTAGTG
TTAGCAGTTGACAATTAGGCCCATATTCAATCTGAATGGGAACAAAAGTAAATGCAATGATAATATACTGCTAGTTAGAGAAACATGTTA
GTTGATTATACCTGAAATGGATTATTTATCTCATCAGCAAGTATTATTTGAATAAAATGAGAAATGCTTAAGAAAAATTGTTGCTCTACA
GTAATTTGGTTTCGAAGAATGGAATGGTAACTATTTTTTCCCATCGTTCTTTTGAGAGAAGGAAGTGTGATGACTGATGATCTTGAAAAG
CCCATTTCTGATTGCACGTTGACTGGAATTCTTTCTTTGTGTCTGTGGACTAGCGATGCTGTTTGTAAAATGAAGATTCGGGACTGGCTC
ATATCTTTTTATCTAACTAGATGTCAGATCTTGAAATCTGTATTCTCGAAGCAATTCTGCCACTTGATCGTATTCACAGGGGCCCTGGTA
GGCTCCTTTAGAAGGACCATTTCTGTTCCTAGAGCTTAACTAGAATTCATTCTTCACTGAAAAAAAAAAAAGTTACTTAAGAAAGCATTT
CTTTCCTAATCTCACTCAAATCTGCAGAATTATTTGTAATTAGTAATACAAAATCTGGCCAAAAGGAGACTTGTAAATAGCGTAAAGTGG
TGTCTTATGCTAAACGGTGGAATGTATAGGCAGAGAAGCTCTTTGAAGTTGTCAGATGAGCTGGGCTCACAAGCCTGATTCAAACAGGCT
GTCGGTCTCCTCTCACCCCTTAATACTGTGCAGCCCAAACTCCTAGGACTCTTGAACATCTGAGCAGTTTTGTGCTTTGAGCCACTTTTT
GACAAAAATGGCTCCATTTTTCCACAGCGTGGTTTTCTTAAAATAGTTTAATGTTTTATAGTCTCATAGTAGTAGTGTTGCTTTCTAAGC
TATAACAGTCGACTTTATTCTTCTACTCTGAAAAATCTTGACTTGTTTGAGTGTATATAATATATATAAAGGGAGCCTTAATGGATTGGT
TTTCATAATTTAATATTTTTTGTATTTGCTCTTGTATAATTGTTTTTAACGGAAAGTATTAAAGAATTGAGGGTGGAATTCTTAGAACCA

>In-frame_USP6NL_ENST00000277575_chr10_11560534_-_FAM107B_ENST00000181796_chr10_14709690_-_3429nt
ACTATAAAATAATAATGAAATCTTGGAATAGATAAGTTACTCTATGAGGACTGAAGCTGTTGTTAATTCCCAAGGCCAGACTGATTATCT
CACAAAGGATTCAGACCAGGATGTAGCACTCAAACTTGCCCAGGAGCGAGCTGAAATAGTTGCTAAATATGACAGAGGACGAGAAGGTGC
AGAGATTGAACCTTGGGAAGATGCTGATTACCTTGTTTACAAAGTCACAGATAGATTTGGCTTTTTACATGAGGAGGAGCTCCCAGATCA
TAATGTGGCTGTGGAACGGGAAGAAGAATTTCGAGAAGAACCTAAATGCCTCGAGCTGGAGCAGAAAATGACATCAGACAGCCCACCTGA
GGATATTGACCATAAGGACTCATATCTCATTACAAGAAGCATCATGGCCGAGCCAGACTACATAGAAGATGACAATCCTGAACTCATTAG
GCCTCAGAAACTGATCAATCCTGTAAAAACCTCCCGGAACCATCAAGATCTTCACAGAGAACTTCTTATGAATCAAAAAAGGGGTCTTGC
TCCTCAGAACAAACCAGAATTGCAGAAGGTGATGGAAAAAAGAAAACGAGACCAAGTAATAAAGCAGAAGGAAGAAGAAGCACAGAAGAA
GAAATCTGACTTGGAAATAGAGCTATTAAAACGGCAGCAGAAGTTGGAGCAGCTTGAACTTGAGAAGCAGAAATTGCAAGAAGAGCAAGA
AAATGCCCCCGAGTTTGTGAAGGTGAAAGGCAATCTCAGGAGAACAGGCCAAGAAGTCGCCCAAGCCCAGGAGTCCTAGGCTGAGGCTGC
ACCAAGACCTCGTGTGTCACCCCACAGAGCTGTCTGTGGGTGCCTTCTCAATCTCAGGGCAAAAGCCCCTGGAGAATATTTCAGCCAGCA
GAGAATTTTGACTTGCAGTAGGATTTGGTTTGATTTTCCTACGATCTGGGTGGATGCCTTGCCTGTGACAGTTGCAGTTCCTATTCGCCA
AATGAAGGGCAGTGCCCCGCACGTAAGTTGGAATGATGGACCTGTGTTCAGAGACTTAACAGAACCAACAAGCAAAACAAGTGAGAACAG
GAAAAAGGAAGAGGACACTGGAATCAATTCTTGAGAGTTGCACTACTTGGTTTTTCTTCCATTCCAAGTTTCGTGGGACCCAGAGCCTTT
TTTCTTTTAAAAGCTAAAAAACAAGTGTTTAATTCCTCTTTTTGTTATCTGTTAGATAATTGAGATCACCTAGAAATGCGTTTAATCTGT
TCACTCACTGTAAATTTTGAGGACCCAGAATTGTCTTGTTTAATTTATACTTTCACCCCTGTTGCAGTTAACACCAGAGAAGGAACGTGA
ATGTCGAGCACAGCCACTACCCTTGTTGGCACTTAATTTAGAAATAGGGTGAGAAGTTTAAAAGCCCATCTTGATTTTATTTTCATTCCT
TTTGGTTCTCTGTGTAATAATAGCAGGCTACATAGTGACATTCCAGTTCCAAGAAGGTACATCCTGTCCATTCATTAATTGCTTTGATTA
CTAGGAGGGTTTCTGTTCAGTTTTGTTTTTAAATGTCTTGCTGATCTAGTTCTTTCAGATGGAATAACCTTCCAGTCCCTTAGAGAGTGG
AACTAGTCCATATAACCCAGCTTCAGTAGCAAAAGTAGAAGCCGCCACATCTTTTCATTTCTCCAAGAGGAGAGTGGGGAAGGTTCCCAT
GACCAGCTGGGCAGTCAGGATTTCTCTAGGCATTCTAATGTGAAATAAGTGTAGACTGCTGTCAAGGAGGCTTCATCAGAAGATGTATAG
CATTTGAATGTCTAATGATAATGCATATCATTAGAATCCAAGCTTTGAAAATTTCTGATTAATGCTCATGTATTTCTTTATCTTTGTTTT
TCCTTGTGAAGAAAGACTTTCACCACTGTCTGAGTGATGATGCTGTTGATAAGGATGATGTCGATGACTACTATATTGCATCTCTCAGGA
ACAGCTGATGGGAAGGGAGGGGCTGCTGAGTTCCCTTGTTCTAGCTAGCAGCACGCTCCTCAGAGAGGGGGCCGAGTTACAGACAGCAGC
CGCATTCTCATGCAAAATTAGTTTTAAACTGCTAGTGTGGGCATCGGTACCTTTTGCCTGGGTGATACCGAAGAATTGTTGAGGATTTAG
TATGCTCCGTAGAGACAGTTCAGCCAGTCATTTCTGCATTGGAGAGACTTCTCATACTTTCTTTGAAGACTCATAGAAAGCTGGATCTAG
AGCTTTTGAATCCTTAATTAGCACAGTAGAAATTAGCTTTCTATGGGAATGCTTTAGTGTTAGCAGTTGACAATTAGGCCCATATTCAAT
CTGAATGGGAACAAAAGTAAATGCAATGATAATATACTGCTAGTTAGAGAAACATGTTAGTTGATTATACCTGAAATGGATTATTTATCT
CATCAGCAAGTATTATTTGAATAAAATGAGAAATGCTTAAGAAAAATTGTTGCTCTACAGTAATTTGGTTTCGAAGAATGGAATGGTAAC
TATTTTTTCCCATCGTTCTTTTGAGAGAAGGAAGTGTGATGACTGATGATCTTGAAAAGCCCATTTCTGATTGCACGTTGACTGGAATTC
TTTCTTTGTGTCTGTGGACTAGCGATGCTGTTTGTAAAATGAAGATTCGGGACTGGCTCATATCTTTTTATCTAACTAGATGTCAGATCT
TGAAATCTGTATTCTCGAAGCAATTCTGCCACTTGATCGTATTCACAGGGGCCCTGGTAGGCTCCTTTAGAAGGACCATTTCTGTTCCTA
GAGCTTAACTAGAATTCATTCTTCACTGAAAAAAAAAAAAGTTACTTAAGAAAGCATTTCTTTCCTAATCTCACTCAAATCTGCAGAATT
ATTTGTAATTAGTAATACAAAATCTGGCCAAAAGGAGACTTGTAAATAGCGTAAAGTGGTGTCTTATGCTAAACGGTGGAATGTATAGGC
AGAGAAGCTCTTTGAAGTTGTCAGATGAGCTGGGCTCACAAGCCTGATTCAAACAGGCTGTCGGTCTCCTCTCACCCCTTAATACTGTGC
AGCCCAAACTCCTAGGACTCTTGAACATCTGAGCAGTTTTGTGCTTTGAGCCACTTTTTGACAAAAATGGCTCCATTTTTCCACAGCGTG
GTTTTCTTAAAATAGTTTAATGTTTTATAGTCTCATAGTAGTAGTGTTGCTTTCTAAGCTATAACAGTCGACTTTATTCTTCTACTCTGA
AAAATCTTGACTTGTTTGAGTGTATATAATATATATAAAGGGAGCCTTAATGGATTGGTTTTCATAATTTAATATTTTTTGTATTTGCTC
TTGTATAATTGTTTTTAACGGAAAGTATTAAAGAATTGAGGGTGGAATTCTTAGAACCAAAGTTATTCTTAATAAAAATCACCACATGCT

>In-frame_USP6NL_ENST00000379237_chr10_11560534_-_FAM107B_ENST00000181796_chr10_14709690_-_3463nt
GATGAAACCTGTTGGATTTCTAGAGGAAGCAGCTGGAGTCTTTGGCTTGTTAACTAGCAATGATTCAAGTCTTGCAGATTGTAAAGGAGC
TGGTGACACCATCAAGGCAAAAAGCAGCCACAGTGAAGGAAGATTCAGACCAGGATGTAGCACTCAAACTTGCCCAGGAGCGAGCTGAAA
TAGTTGCTAAATATGACAGAGGACGAGAAGGTGCAGAGATTGAACCTTGGGAAGATGCTGATTACCTTGTTTACAAAGTCACAGATAGAT
TTGGCTTTTTACATGAGGAGGAGCTCCCAGATCATAATGTGGCTGTGGAACGGGAAGAAGAATTTCGAGAAGAACCTAAATGCCTCGAGC
TGGAGCAGAAAATGACATCAGACAGCCCACCTGAGGATATTGACCATAAGGACTCATATCTCATTACAAGAAGCATCATGGCCGAGCCAG
ACTACATAGAAGATGACAATCCTGAACTCATTAGGCCTCAGAAACTGATCAATCCTGTAAAAACCTCCCGGAACCATCAAGATCTTCACA
GAGAACTTCTTATGAATCAAAAAAGGGGTCTTGCTCCTCAGAACAAACCAGAATTGCAGAAGGTGATGGAAAAAAGAAAACGAGACCAAG
TAATAAAGCAGAAGGAAGAAGAAGCACAGAAGAAGAAATCTGACTTGGAAATAGAGCTATTAAAACGGCAGCAGAAGTTGGAGCAGCTTG
AACTTGAGAAGCAGAAATTGCAAGAAGAGCAAGAAAATGCCCCCGAGTTTGTGAAGGTGAAAGGCAATCTCAGGAGAACAGGCCAAGAAG
TCGCCCAAGCCCAGGAGTCCTAGGCTGAGGCTGCACCAAGACCTCGTGTGTCACCCCACAGAGCTGTCTGTGGGTGCCTTCTCAATCTCA
GGGCAAAAGCCCCTGGAGAATATTTCAGCCAGCAGAGAATTTTGACTTGCAGTAGGATTTGGTTTGATTTTCCTACGATCTGGGTGGATG
CCTTGCCTGTGACAGTTGCAGTTCCTATTCGCCAAATGAAGGGCAGTGCCCCGCACGTAAGTTGGAATGATGGACCTGTGTTCAGAGACT
TAACAGAACCAACAAGCAAAACAAGTGAGAACAGGAAAAAGGAAGAGGACACTGGAATCAATTCTTGAGAGTTGCACTACTTGGTTTTTC
TTCCATTCCAAGTTTCGTGGGACCCAGAGCCTTTTTTCTTTTAAAAGCTAAAAAACAAGTGTTTAATTCCTCTTTTTGTTATCTGTTAGA
TAATTGAGATCACCTAGAAATGCGTTTAATCTGTTCACTCACTGTAAATTTTGAGGACCCAGAATTGTCTTGTTTAATTTATACTTTCAC
CCCTGTTGCAGTTAACACCAGAGAAGGAACGTGAATGTCGAGCACAGCCACTACCCTTGTTGGCACTTAATTTAGAAATAGGGTGAGAAG
TTTAAAAGCCCATCTTGATTTTATTTTCATTCCTTTTGGTTCTCTGTGTAATAATAGCAGGCTACATAGTGACATTCCAGTTCCAAGAAG
GTACATCCTGTCCATTCATTAATTGCTTTGATTACTAGGAGGGTTTCTGTTCAGTTTTGTTTTTAAATGTCTTGCTGATCTAGTTCTTTC
AGATGGAATAACCTTCCAGTCCCTTAGAGAGTGGAACTAGTCCATATAACCCAGCTTCAGTAGCAAAAGTAGAAGCCGCCACATCTTTTC
ATTTCTCCAAGAGGAGAGTGGGGAAGGTTCCCATGACCAGCTGGGCAGTCAGGATTTCTCTAGGCATTCTAATGTGAAATAAGTGTAGAC
TGCTGTCAAGGAGGCTTCATCAGAAGATGTATAGCATTTGAATGTCTAATGATAATGCATATCATTAGAATCCAAGCTTTGAAAATTTCT
GATTAATGCTCATGTATTTCTTTATCTTTGTTTTTCCTTGTGAAGAAAGACTTTCACCACTGTCTGAGTGATGATGCTGTTGATAAGGAT
GATGTCGATGACTACTATATTGCATCTCTCAGGAACAGCTGATGGGAAGGGAGGGGCTGCTGAGTTCCCTTGTTCTAGCTAGCAGCACGC
TCCTCAGAGAGGGGGCCGAGTTACAGACAGCAGCCGCATTCTCATGCAAAATTAGTTTTAAACTGCTAGTGTGGGCATCGGTACCTTTTG
CCTGGGTGATACCGAAGAATTGTTGAGGATTTAGTATGCTCCGTAGAGACAGTTCAGCCAGTCATTTCTGCATTGGAGAGACTTCTCATA
CTTTCTTTGAAGACTCATAGAAAGCTGGATCTAGAGCTTTTGAATCCTTAATTAGCACAGTAGAAATTAGCTTTCTATGGGAATGCTTTA
GTGTTAGCAGTTGACAATTAGGCCCATATTCAATCTGAATGGGAACAAAAGTAAATGCAATGATAATATACTGCTAGTTAGAGAAACATG
TTAGTTGATTATACCTGAAATGGATTATTTATCTCATCAGCAAGTATTATTTGAATAAAATGAGAAATGCTTAAGAAAAATTGTTGCTCT
ACAGTAATTTGGTTTCGAAGAATGGAATGGTAACTATTTTTTCCCATCGTTCTTTTGAGAGAAGGAAGTGTGATGACTGATGATCTTGAA
AAGCCCATTTCTGATTGCACGTTGACTGGAATTCTTTCTTTGTGTCTGTGGACTAGCGATGCTGTTTGTAAAATGAAGATTCGGGACTGG
CTCATATCTTTTTATCTAACTAGATGTCAGATCTTGAAATCTGTATTCTCGAAGCAATTCTGCCACTTGATCGTATTCACAGGGGCCCTG
GTAGGCTCCTTTAGAAGGACCATTTCTGTTCCTAGAGCTTAACTAGAATTCATTCTTCACTGAAAAAAAAAAAAGTTACTTAAGAAAGCA
TTTCTTTCCTAATCTCACTCAAATCTGCAGAATTATTTGTAATTAGTAATACAAAATCTGGCCAAAAGGAGACTTGTAAATAGCGTAAAG
TGGTGTCTTATGCTAAACGGTGGAATGTATAGGCAGAGAAGCTCTTTGAAGTTGTCAGATGAGCTGGGCTCACAAGCCTGATTCAAACAG
GCTGTCGGTCTCCTCTCACCCCTTAATACTGTGCAGCCCAAACTCCTAGGACTCTTGAACATCTGAGCAGTTTTGTGCTTTGAGCCACTT
TTTGACAAAAATGGCTCCATTTTTCCACAGCGTGGTTTTCTTAAAATAGTTTAATGTTTTATAGTCTCATAGTAGTAGTGTTGCTTTCTA
AGCTATAACAGTCGACTTTATTCTTCTACTCTGAAAAATCTTGACTTGTTTGAGTGTATATAATATATATAAAGGGAGCCTTAATGGATT
GGTTTTCATAATTTAATATTTTTTGTATTTGCTCTTGTATAATTGTTTTTAACGGAAAGTATTAAAGAATTGAGGGTGGAATTCTTAGAA


Top

FusionGenePPI for USP6NL_FAM107B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
USP6NLACTN4, GRB2, APP, WWOX, SHMT2, NXF1, TMEM17, CCNA2, COMT, ANAPC15, UBE2S, CDH1FAM107BELAVL1, BAG3, U2AF2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for USP6NL_FAM107B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for USP6NL_FAM107B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneUSP6NLC0025202melanoma1CTD_human