FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 4110

FusionGeneSummary for BDP1_FAM172A

check button Fusion gene summary
Fusion gene informationFusion gene name: BDP1_FAM172A
Fusion gene ID: 4110
HgeneTgene
Gene symbol

BDP1

FAM172A

Gene ID

55814

83989

Gene nameB double prime 1, subunit of RNA polymerase III transcription initiation factor IIIBfamily with sequence similarity 172 member A
SynonymsHSA238520|TAF3B1|TFC5|TFIIIB''|TFIIIB150|TFIIIB90|TFNRC5orf21
Cytomap

5q13.2

5q15

Type of geneprotein-codingprotein-coding
Descriptiontranscription factor TFIIIB component B'' homologRNA polymerase III transcription initiation factor B''TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3B subunit 1transcription factor IIIB 150transcription factor-like nuclear protein FAM172A
Modification date2018052320180523
UniProtAcc

A6H8Y1

Q8WUF8

Ensembl transtripts involved in fusion geneENST00000358731, ENST00000380675, 
ENST00000395965, ENST00000505869, 
ENST00000509739, ENST00000509163, 
ENST00000504768, 
Fusion gene scores* DoF score4 X 5 X 3=604 X 4 X 3=48
# samples 64
** MAII scorelog2(6/60*10)=0log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: BDP1 [Title/Abstract] AND FAM172A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLIHCTCGA-DD-AADB-01ABDP1chr5

70828254

+FAM172Achr5

93217394

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000358731ENST00000395965BDP1chr5

70828254

+FAM172Achr5

93217394

-
In-frameENST00000358731ENST00000505869BDP1chr5

70828254

+FAM172Achr5

93217394

-
In-frameENST00000358731ENST00000509739BDP1chr5

70828254

+FAM172Achr5

93217394

-
In-frameENST00000358731ENST00000509163BDP1chr5

70828254

+FAM172Achr5

93217394

-
5CDS-intronENST00000358731ENST00000504768BDP1chr5

70828254

+FAM172Achr5

93217394

-
In-frameENST00000380675ENST00000395965BDP1chr5

70828254

+FAM172Achr5

93217394

-
In-frameENST00000380675ENST00000505869BDP1chr5

70828254

+FAM172Achr5

93217394

-
In-frameENST00000380675ENST00000509739BDP1chr5

70828254

+FAM172Achr5

93217394

-
In-frameENST00000380675ENST00000509163BDP1chr5

70828254

+FAM172Achr5

93217394

-
5CDS-intronENST00000380675ENST00000504768BDP1chr5

70828254

+FAM172Achr5

93217394

-

Top

FusionProtFeatures for BDP1_FAM172A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
BDP1

A6H8Y1

FAM172A

Q8WUF8


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBDP1chr5:70828254chr5:93217394ENST00000358731+26391078_110319642625Coiled coilOntology_term=ECO:0000255
HgeneBDP1chr5:70828254chr5:93217394ENST00000358731+26391223_128419642625Coiled coilOntology_term=ECO:0000255
HgeneBDP1chr5:70828254chr5:93217394ENST00000358731+2639144_17719642625Coiled coilOntology_term=ECO:0000255
HgeneBDP1chr5:70828254chr5:93217394ENST00000358731+263984_11919642625Compositional biasNote=Ser-rich
HgeneBDP1chr5:70828254chr5:93217394ENST00000358731+2639295_34519642625DomainNote=Myb-like
HgeneBDP1chr5:70828254chr5:93217394ENST00000358731+2639355_47019642625RegionNote=Required for phosphorylation by CSNK2A1
HgeneBDP1chr5:70828254chr5:93217394ENST00000358731+2639823_132719642625RegionNote=9 X 55 AA repeats of G-R-R-X-I-S-P-X-E-N-G-X-E-E-V-K-P-X-X-E-M-E-T-D-L-K-X-T-G-R-E-X-X-X-R-E-K-T-X-E-X-X-D-A-X-E-E-I-D-X-D-L-E-E-T
HgeneBDP1chr5:70828254chr5:93217394ENST00000358731+26391041_109419642625RepeatNote=5
HgeneBDP1chr5:70828254chr5:93217394ENST00000358731+26391095_114819642625RepeatNote=6
HgeneBDP1chr5:70828254chr5:93217394ENST00000358731+26391149_120319642625RepeatNote=7
HgeneBDP1chr5:70828254chr5:93217394ENST00000358731+26391204_125719642625RepeatNote=8%3B approximate
HgeneBDP1chr5:70828254chr5:93217394ENST00000358731+26391258_132719642625RepeatNote=9%3B approximate
HgeneBDP1chr5:70828254chr5:93217394ENST00000358731+2639823_87719642625RepeatNote=1%3B approximate
HgeneBDP1chr5:70828254chr5:93217394ENST00000358731+2639878_93219642625RepeatNote=2
HgeneBDP1chr5:70828254chr5:93217394ENST00000358731+2639933_98719642625RepeatNote=3
HgeneBDP1chr5:70828254chr5:93217394ENST00000358731+2639988_104019642625RepeatNote=4
TgeneFAM172Achr5:70828254chr5:93217394ENST00000395965-511413_416189417MotifPrevents secretion from ER
TgeneFAM172Achr5:70828254chr5:93217394ENST00000505869-39413_41679307MotifPrevents secretion from ER
TgeneFAM172Achr5:70828254chr5:93217394ENST00000509163-410413_416143371MotifPrevents secretion from ER

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBDP1chr5:70828254chr5:93217394ENST00000380675+26381078_11031011360Coiled coilOntology_term=ECO:0000255
HgeneBDP1chr5:70828254chr5:93217394ENST00000380675+26381223_12841011360Coiled coilOntology_term=ECO:0000255
HgeneBDP1chr5:70828254chr5:93217394ENST00000380675+2638144_1771011360Coiled coilOntology_term=ECO:0000255
HgeneBDP1chr5:70828254chr5:93217394ENST00000380675+263884_1191011360Compositional biasNote=Ser-rich
HgeneBDP1chr5:70828254chr5:93217394ENST00000380675+2638295_3451011360DomainNote=Myb-like
HgeneBDP1chr5:70828254chr5:93217394ENST00000380675+2638355_4701011360RegionNote=Required for phosphorylation by CSNK2A1
HgeneBDP1chr5:70828254chr5:93217394ENST00000380675+2638823_13271011360RegionNote=9 X 55 AA repeats of G-R-R-X-I-S-P-X-E-N-G-X-E-E-V-K-P-X-X-E-M-E-T-D-L-K-X-T-G-R-E-X-X-X-R-E-K-T-X-E-X-X-D-A-X-E-E-I-D-X-D-L-E-E-T
HgeneBDP1chr5:70828254chr5:93217394ENST00000380675+26381041_10941011360RepeatNote=5
HgeneBDP1chr5:70828254chr5:93217394ENST00000380675+26381095_11481011360RepeatNote=6
HgeneBDP1chr5:70828254chr5:93217394ENST00000380675+26381149_12031011360RepeatNote=7
HgeneBDP1chr5:70828254chr5:93217394ENST00000380675+26381204_12571011360RepeatNote=8%3B approximate
HgeneBDP1chr5:70828254chr5:93217394ENST00000380675+26381258_13271011360RepeatNote=9%3B approximate
HgeneBDP1chr5:70828254chr5:93217394ENST00000380675+2638823_8771011360RepeatNote=1%3B approximate
HgeneBDP1chr5:70828254chr5:93217394ENST00000380675+2638878_9321011360RepeatNote=2
HgeneBDP1chr5:70828254chr5:93217394ENST00000380675+2638933_9871011360RepeatNote=3
HgeneBDP1chr5:70828254chr5:93217394ENST00000380675+2638988_10401011360RepeatNote=4


Top

FusionGeneSequence for BDP1_FAM172A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_BDP1_ENST00000358731_chr5_70828254_+_FAM172A_ENST00000395965_chr5_93217394_-_2192aa
MFRRARLSVKPNVRPGVGARGSTASNPQRGRESPRPPDPATDSASKPAEPTDVPTVDFGGAEPQEKAPRSSTEKTGGDNDVEESSRSSST
VSQRRKRISSTSSLVKSSVSVPSESHPLSTINQEAPQPTATSTKEKQPCSDRYRIYKAQKLREMLKEELRKEKKQWKNKTAINESQRPPD
RSKMTMRDFITTLPDNNPMTSSLEQEKKTEKPSTPVQTREQEGKSTPNAEDNEMEEETDDGPLLVPRVKVAEDGSIILDEESLTVEVLRT
KGPCVVEENDPIFERGSTTTYSSFRKNTYSKPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKREEKTNGWRIDKAFQEKR
PFDFDFFAHLLQKVLAEEEKRKQKSVKNHSLKEKKSTKPRKNVKVKKVACEGVNNDPDESMSSRISDTERSQKDAQTVEEESLTLSREDA
EQVALEVDLNQKKRRRKKQDGANELGVNNLLENATVQAGPSKGEKHKNKCQAIRPELKEGECSKEQMLSCTQNIDGIVGFASTEKVEKRT
DPILSLSNQQDATSVATESSESSTSDLPSFEVGIRALCEVNNAEGSCIEERNVDLKNNSLEIDQTENVKPMLRGRFQRPKPNLSRAGKKS
VLSQGKTESESKNSHSKTSVEKNHVEKDKMNTLDILRMETTERENPEAETVSVLGEKNCLQEGSQLKALRPVQVRGRLQKPKPNAGKAAE
RKEILISQEEIGANVEKNENESCADRDTPQHMEDQSRKDFEEEDVILQPEKNDSFQNVQPDEPKVLNECLSVQENNKANKLNQVPILRTR
FQKPKPNIGRGTGRREISSKEEVLEKILVSGEMAAALRETVRLDTSPKEMVPAEINTKEMQSDLKETGRRAISPREKILDVIDDTIEMET
GLKAMGREICLREKTPEVIDATEEIDKDLEEAGRREISPQKNGPEEVKPLGEVETDLKATGNESSPREKTPEVTDATEEIDKNLEETGRR
KISPRENGPEEVKPVDEMETDLNATGRESSPREKTPEVIDATEEIDLEETEREVSPQENGLEEVKPLGEMETDLKATGRDSFPRGKTPEV
IDAIEEIEIDLEETEREISPQENGLEEVKPLGEMQTDLKATGREISPREKTPEVIDATEEIDKDLEETGRREISPEENGPEEVKPVDEME
TDLKTTGREGSSREKTREVIDAAEVIETDLEETEREISPQENGPEEVKPVGKMETDLKEIREEISQREKVLAEFSAIREKEIDLKETGKR
DIPIMEKVSGKMAVVEEMEADLKETGKENFRERGSEEICVTEEKVAELKQTGKTDISPRENELEETSTSRQTDTHLMQSGSNDFSAVPSL
DIQNISSEVLSMMHTPVEEKRNSEKEVSSHFSHFKISSQTHESDKTEVQGIQSPDVPEQFSDINLSKSLPQEQKPLEIKPAPFVRSRFKR
PKPNLARAALKRETTESEKTITEKKSETKKMETIVMQENNEQTDTLPSQHDEASLMISREKDTLGHRNEEAVILPCTQTERNLSPSNSCE
PKEESQSAPVQKNDSVVSVGTNNVNTFQQEMKESVIQTARQVRGRLQRPRPNIRKTGQRQIVDKGEAKGIIKEGRTILPKDETEKKVLTV
SNSQIETEIEVPSSAVPEHRMTENQSQVVLVENLHVNKTNETIRHENKPTVPSSAQMTRRKFQKAKPNLGRAHSKKEEPVLEKVTTDQSK
EGKPEDHLLQKGASNTQLLLKEKAELLTSLEVSARKDCVGSKESALAKIDAELEEVGPSRRVGEETVGDNSPSSVVEEQTLNKLTSCPQP
LNETSYSKIALDGKTTISSTSETERNRGERRSHKKFKPNVTRGRGSKRVRGKTSKKEPRASKAMLVTLRASQEEDDDADDFESDTEEEST
HLAPEEVNKAPVFVPVGLRSPEPVSAQIEETMEELEITVNVPDVGCIAVVEHELPNTDVTTEEMKQEENLSVPFEGTGVIVLNPNENTIE
VEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFTEKTRNPQREKEMMQLTIRENGSPEEHAITVWDHFIAQAAAENVFFVAHSTG
GLAFVELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSI

>In-frame_BDP1_ENST00000358731_chr5_70828254_+_FAM172A_ENST00000505869_chr5_93217394_-_2192aa
MFRRARLSVKPNVRPGVGARGSTASNPQRGRESPRPPDPATDSASKPAEPTDVPTVDFGGAEPQEKAPRSSTEKTGGDNDVEESSRSSST
VSQRRKRISSTSSLVKSSVSVPSESHPLSTINQEAPQPTATSTKEKQPCSDRYRIYKAQKLREMLKEELRKEKKQWKNKTAINESQRPPD
RSKMTMRDFITTLPDNNPMTSSLEQEKKTEKPSTPVQTREQEGKSTPNAEDNEMEEETDDGPLLVPRVKVAEDGSIILDEESLTVEVLRT
KGPCVVEENDPIFERGSTTTYSSFRKNTYSKPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKREEKTNGWRIDKAFQEKR
PFDFDFFAHLLQKVLAEEEKRKQKSVKNHSLKEKKSTKPRKNVKVKKVACEGVNNDPDESMSSRISDTERSQKDAQTVEEESLTLSREDA
EQVALEVDLNQKKRRRKKQDGANELGVNNLLENATVQAGPSKGEKHKNKCQAIRPELKEGECSKEQMLSCTQNIDGIVGFASTEKVEKRT
DPILSLSNQQDATSVATESSESSTSDLPSFEVGIRALCEVNNAEGSCIEERNVDLKNNSLEIDQTENVKPMLRGRFQRPKPNLSRAGKKS
VLSQGKTESESKNSHSKTSVEKNHVEKDKMNTLDILRMETTERENPEAETVSVLGEKNCLQEGSQLKALRPVQVRGRLQKPKPNAGKAAE
RKEILISQEEIGANVEKNENESCADRDTPQHMEDQSRKDFEEEDVILQPEKNDSFQNVQPDEPKVLNECLSVQENNKANKLNQVPILRTR
FQKPKPNIGRGTGRREISSKEEVLEKILVSGEMAAALRETVRLDTSPKEMVPAEINTKEMQSDLKETGRRAISPREKILDVIDDTIEMET
GLKAMGREICLREKTPEVIDATEEIDKDLEEAGRREISPQKNGPEEVKPLGEVETDLKATGNESSPREKTPEVTDATEEIDKNLEETGRR
KISPRENGPEEVKPVDEMETDLNATGRESSPREKTPEVIDATEEIDLEETEREVSPQENGLEEVKPLGEMETDLKATGRDSFPRGKTPEV
IDAIEEIEIDLEETEREISPQENGLEEVKPLGEMQTDLKATGREISPREKTPEVIDATEEIDKDLEETGRREISPEENGPEEVKPVDEME
TDLKTTGREGSSREKTREVIDAAEVIETDLEETEREISPQENGPEEVKPVGKMETDLKEIREEISQREKVLAEFSAIREKEIDLKETGKR
DIPIMEKVSGKMAVVEEMEADLKETGKENFRERGSEEICVTEEKVAELKQTGKTDISPRENELEETSTSRQTDTHLMQSGSNDFSAVPSL
DIQNISSEVLSMMHTPVEEKRNSEKEVSSHFSHFKISSQTHESDKTEVQGIQSPDVPEQFSDINLSKSLPQEQKPLEIKPAPFVRSRFKR
PKPNLARAALKRETTESEKTITEKKSETKKMETIVMQENNEQTDTLPSQHDEASLMISREKDTLGHRNEEAVILPCTQTERNLSPSNSCE
PKEESQSAPVQKNDSVVSVGTNNVNTFQQEMKESVIQTARQVRGRLQRPRPNIRKTGQRQIVDKGEAKGIIKEGRTILPKDETEKKVLTV
SNSQIETEIEVPSSAVPEHRMTENQSQVVLVENLHVNKTNETIRHENKPTVPSSAQMTRRKFQKAKPNLGRAHSKKEEPVLEKVTTDQSK
EGKPEDHLLQKGASNTQLLLKEKAELLTSLEVSARKDCVGSKESALAKIDAELEEVGPSRRVGEETVGDNSPSSVVEEQTLNKLTSCPQP
LNETSYSKIALDGKTTISSTSETERNRGERRSHKKFKPNVTRGRGSKRVRGKTSKKEPRASKAMLVTLRASQEEDDDADDFESDTEEEST
HLAPEEVNKAPVFVPVGLRSPEPVSAQIEETMEELEITVNVPDVGCIAVVEHELPNTDVTTEEMKQEENLSVPFEGTGVIVLNPNENTIE
VEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFTEKTRNPQREKEMMQLTIRENGSPEEHAITVWDHFIAQAAAENVFFVAHSTG
GLAFVELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSI

>In-frame_BDP1_ENST00000358731_chr5_70828254_+_FAM172A_ENST00000509739_chr5_93217394_-_2192aa
MFRRARLSVKPNVRPGVGARGSTASNPQRGRESPRPPDPATDSASKPAEPTDVPTVDFGGAEPQEKAPRSSTEKTGGDNDVEESSRSSST
VSQRRKRISSTSSLVKSSVSVPSESHPLSTINQEAPQPTATSTKEKQPCSDRYRIYKAQKLREMLKEELRKEKKQWKNKTAINESQRPPD
RSKMTMRDFITTLPDNNPMTSSLEQEKKTEKPSTPVQTREQEGKSTPNAEDNEMEEETDDGPLLVPRVKVAEDGSIILDEESLTVEVLRT
KGPCVVEENDPIFERGSTTTYSSFRKNTYSKPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKREEKTNGWRIDKAFQEKR
PFDFDFFAHLLQKVLAEEEKRKQKSVKNHSLKEKKSTKPRKNVKVKKVACEGVNNDPDESMSSRISDTERSQKDAQTVEEESLTLSREDA
EQVALEVDLNQKKRRRKKQDGANELGVNNLLENATVQAGPSKGEKHKNKCQAIRPELKEGECSKEQMLSCTQNIDGIVGFASTEKVEKRT
DPILSLSNQQDATSVATESSESSTSDLPSFEVGIRALCEVNNAEGSCIEERNVDLKNNSLEIDQTENVKPMLRGRFQRPKPNLSRAGKKS
VLSQGKTESESKNSHSKTSVEKNHVEKDKMNTLDILRMETTERENPEAETVSVLGEKNCLQEGSQLKALRPVQVRGRLQKPKPNAGKAAE
RKEILISQEEIGANVEKNENESCADRDTPQHMEDQSRKDFEEEDVILQPEKNDSFQNVQPDEPKVLNECLSVQENNKANKLNQVPILRTR
FQKPKPNIGRGTGRREISSKEEVLEKILVSGEMAAALRETVRLDTSPKEMVPAEINTKEMQSDLKETGRRAISPREKILDVIDDTIEMET
GLKAMGREICLREKTPEVIDATEEIDKDLEEAGRREISPQKNGPEEVKPLGEVETDLKATGNESSPREKTPEVTDATEEIDKNLEETGRR
KISPRENGPEEVKPVDEMETDLNATGRESSPREKTPEVIDATEEIDLEETEREVSPQENGLEEVKPLGEMETDLKATGRDSFPRGKTPEV
IDAIEEIEIDLEETEREISPQENGLEEVKPLGEMQTDLKATGREISPREKTPEVIDATEEIDKDLEETGRREISPEENGPEEVKPVDEME
TDLKTTGREGSSREKTREVIDAAEVIETDLEETEREISPQENGPEEVKPVGKMETDLKEIREEISQREKVLAEFSAIREKEIDLKETGKR
DIPIMEKVSGKMAVVEEMEADLKETGKENFRERGSEEICVTEEKVAELKQTGKTDISPRENELEETSTSRQTDTHLMQSGSNDFSAVPSL
DIQNISSEVLSMMHTPVEEKRNSEKEVSSHFSHFKISSQTHESDKTEVQGIQSPDVPEQFSDINLSKSLPQEQKPLEIKPAPFVRSRFKR
PKPNLARAALKRETTESEKTITEKKSETKKMETIVMQENNEQTDTLPSQHDEASLMISREKDTLGHRNEEAVILPCTQTERNLSPSNSCE
PKEESQSAPVQKNDSVVSVGTNNVNTFQQEMKESVIQTARQVRGRLQRPRPNIRKTGQRQIVDKGEAKGIIKEGRTILPKDETEKKVLTV
SNSQIETEIEVPSSAVPEHRMTENQSQVVLVENLHVNKTNETIRHENKPTVPSSAQMTRRKFQKAKPNLGRAHSKKEEPVLEKVTTDQSK
EGKPEDHLLQKGASNTQLLLKEKAELLTSLEVSARKDCVGSKESALAKIDAELEEVGPSRRVGEETVGDNSPSSVVEEQTLNKLTSCPQP
LNETSYSKIALDGKTTISSTSETERNRGERRSHKKFKPNVTRGRGSKRVRGKTSKKEPRASKAMLVTLRASQEEDDDADDFESDTEEEST
HLAPEEVNKAPVFVPVGLRSPEPVSAQIEETMEELEITVNVPDVGCIAVVEHELPNTDVTTEEMKQEENLSVPFEGTGVIVLNPNENTIE
VEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFTEKTRNPQREKEMMQLTIRENGSPEEHAITVWDHFIAQAAAENVFFVAHSTG
GLAFVELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSI

>In-frame_BDP1_ENST00000358731_chr5_70828254_+_FAM172A_ENST00000509163_chr5_93217394_-_2192aa
MFRRARLSVKPNVRPGVGARGSTASNPQRGRESPRPPDPATDSASKPAEPTDVPTVDFGGAEPQEKAPRSSTEKTGGDNDVEESSRSSST
VSQRRKRISSTSSLVKSSVSVPSESHPLSTINQEAPQPTATSTKEKQPCSDRYRIYKAQKLREMLKEELRKEKKQWKNKTAINESQRPPD
RSKMTMRDFITTLPDNNPMTSSLEQEKKTEKPSTPVQTREQEGKSTPNAEDNEMEEETDDGPLLVPRVKVAEDGSIILDEESLTVEVLRT
KGPCVVEENDPIFERGSTTTYSSFRKNTYSKPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKREEKTNGWRIDKAFQEKR
PFDFDFFAHLLQKVLAEEEKRKQKSVKNHSLKEKKSTKPRKNVKVKKVACEGVNNDPDESMSSRISDTERSQKDAQTVEEESLTLSREDA
EQVALEVDLNQKKRRRKKQDGANELGVNNLLENATVQAGPSKGEKHKNKCQAIRPELKEGECSKEQMLSCTQNIDGIVGFASTEKVEKRT
DPILSLSNQQDATSVATESSESSTSDLPSFEVGIRALCEVNNAEGSCIEERNVDLKNNSLEIDQTENVKPMLRGRFQRPKPNLSRAGKKS
VLSQGKTESESKNSHSKTSVEKNHVEKDKMNTLDILRMETTERENPEAETVSVLGEKNCLQEGSQLKALRPVQVRGRLQKPKPNAGKAAE
RKEILISQEEIGANVEKNENESCADRDTPQHMEDQSRKDFEEEDVILQPEKNDSFQNVQPDEPKVLNECLSVQENNKANKLNQVPILRTR
FQKPKPNIGRGTGRREISSKEEVLEKILVSGEMAAALRETVRLDTSPKEMVPAEINTKEMQSDLKETGRRAISPREKILDVIDDTIEMET
GLKAMGREICLREKTPEVIDATEEIDKDLEEAGRREISPQKNGPEEVKPLGEVETDLKATGNESSPREKTPEVTDATEEIDKNLEETGRR
KISPRENGPEEVKPVDEMETDLNATGRESSPREKTPEVIDATEEIDLEETEREVSPQENGLEEVKPLGEMETDLKATGRDSFPRGKTPEV
IDAIEEIEIDLEETEREISPQENGLEEVKPLGEMQTDLKATGREISPREKTPEVIDATEEIDKDLEETGRREISPEENGPEEVKPVDEME
TDLKTTGREGSSREKTREVIDAAEVIETDLEETEREISPQENGPEEVKPVGKMETDLKEIREEISQREKVLAEFSAIREKEIDLKETGKR
DIPIMEKVSGKMAVVEEMEADLKETGKENFRERGSEEICVTEEKVAELKQTGKTDISPRENELEETSTSRQTDTHLMQSGSNDFSAVPSL
DIQNISSEVLSMMHTPVEEKRNSEKEVSSHFSHFKISSQTHESDKTEVQGIQSPDVPEQFSDINLSKSLPQEQKPLEIKPAPFVRSRFKR
PKPNLARAALKRETTESEKTITEKKSETKKMETIVMQENNEQTDTLPSQHDEASLMISREKDTLGHRNEEAVILPCTQTERNLSPSNSCE
PKEESQSAPVQKNDSVVSVGTNNVNTFQQEMKESVIQTARQVRGRLQRPRPNIRKTGQRQIVDKGEAKGIIKEGRTILPKDETEKKVLTV
SNSQIETEIEVPSSAVPEHRMTENQSQVVLVENLHVNKTNETIRHENKPTVPSSAQMTRRKFQKAKPNLGRAHSKKEEPVLEKVTTDQSK
EGKPEDHLLQKGASNTQLLLKEKAELLTSLEVSARKDCVGSKESALAKIDAELEEVGPSRRVGEETVGDNSPSSVVEEQTLNKLTSCPQP
LNETSYSKIALDGKTTISSTSETERNRGERRSHKKFKPNVTRGRGSKRVRGKTSKKEPRASKAMLVTLRASQEEDDDADDFESDTEEEST
HLAPEEVNKAPVFVPVGLRSPEPVSAQIEETMEELEITVNVPDVGCIAVVEHELPNTDVTTEEMKQEENLSVPFEGTGVIVLNPNENTIE
VEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFTEKTRNPQREKEMMQLTIRENGSPEEHAITVWDHFIAQAAAENVFFVAHSTG
GLAFVELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSI

>In-frame_BDP1_ENST00000380675_chr5_70828254_+_FAM172A_ENST00000395965_chr5_93217394_-_329aa
MLVTLRASQEEDDDADDFESDTEEESTHLAPEEVNKAPVFVPVGLRSPEPVSAQIEETMEELEITVNVPDVGCIAVVEHELPNTDVTTEE
MKQEENLSVPFEGTGVIVLNPNENTIEVEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFTEKTRNPQREKEMMQLTIRENGSPE
EHAITVWDHFIAQAAAENVFFVAHSTGGLAFVELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVE

>In-frame_BDP1_ENST00000380675_chr5_70828254_+_FAM172A_ENST00000505869_chr5_93217394_-_329aa
MLVTLRASQEEDDDADDFESDTEEESTHLAPEEVNKAPVFVPVGLRSPEPVSAQIEETMEELEITVNVPDVGCIAVVEHELPNTDVTTEE
MKQEENLSVPFEGTGVIVLNPNENTIEVEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFTEKTRNPQREKEMMQLTIRENGSPE
EHAITVWDHFIAQAAAENVFFVAHSTGGLAFVELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVE

>In-frame_BDP1_ENST00000380675_chr5_70828254_+_FAM172A_ENST00000509739_chr5_93217394_-_329aa
MLVTLRASQEEDDDADDFESDTEEESTHLAPEEVNKAPVFVPVGLRSPEPVSAQIEETMEELEITVNVPDVGCIAVVEHELPNTDVTTEE
MKQEENLSVPFEGTGVIVLNPNENTIEVEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFTEKTRNPQREKEMMQLTIRENGSPE
EHAITVWDHFIAQAAAENVFFVAHSTGGLAFVELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVE

>In-frame_BDP1_ENST00000380675_chr5_70828254_+_FAM172A_ENST00000509163_chr5_93217394_-_329aa
MLVTLRASQEEDDDADDFESDTEEESTHLAPEEVNKAPVFVPVGLRSPEPVSAQIEETMEELEITVNVPDVGCIAVVEHELPNTDVTTEE
MKQEENLSVPFEGTGVIVLNPNENTIEVEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFTEKTRNPQREKEMMQLTIRENGSPE
EHAITVWDHFIAQAAAENVFFVAHSTGGLAFVELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_BDP1_ENST00000358731_chr5_70828254_+_FAM172A_ENST00000395965_chr5_93217394_-_6576nt
ATGTTCCGCAGGGCACGCCTTAGCGTGAAGCCGAATGTCAGGCCTGGTGTAGGCGCCAGGGGCTCCACAGCTTCCAATCCCCAGCGTGGA
CGGGAGTCTCCCAGGCCGCCGGATCCTGCCACGGACTCTGCTTCCAAGCCCGCGGAGCCCACAGATGTGCCCACAGTCGATTTCGGTGGA
GCGGAGCCCCAAGAAAAGGCTCCTAGGAGCAGTACTGAAAAGACTGGTGGTGACAATGATGTTGAAGAATCCAGTAGATCTTCCTCTACT
GTTTCACAGAGAAGAAAGCGAATATCAAGTACTTCTAGCCTGGTTAAGTCTAGTGTCAGTGTTCCTTCAGAATCTCATCCCTTATCTACA
ATTAATCAAGAGGCTCCACAGCCAACTGCCACTTCAACAAAAGAGAAACAGCCATGCTCAGACAGATACCGAATATACAAAGCCCAGAAA
CTGAGGGAAATGTTAAAAGAAGAATTGAGAAAAGAGAAGAAACAATGGAAAAACAAATATGCTATAAATGAAAGTCAGAGGCCACCAGAT
CGTTCAAAAATGACTATGAGAGACTTCATATATTATCTACCAGATAATAATCCAATGACTTCTTCACTGGAACAAGAAAAGAAAACTGAA
AAGCCATCGACTCCAGTCCAGACAAGAGAGCAAGAAGGTAAGAGTACTCCTAATGCTGAAGATAATGAAATGGAAGAAGAGACAGATGAT
GGGCCATTACTGGTTCCTCGAGTAAAAGTGGCAGAAGATGGTTCCATTATTTTGGATGAAGAAAGTTTAACTGTAGAAGTTTTAAGAACA
AAAGGCCCTTGTGTTGTTGAAGAAAATGACCCCATATTTGAGCGCGGTTCTACAACTACATACTCCAGCTTTAGGAAAAACTATTACTCT
AAACCATGGTCAAATAAAGAAACAGATATGTTTTTTTTAGCCATCAGCATGGTAGGAACTGACTTTTCTATGATCGGACAACTTTTTCCT
CACAGAGCAAGGATAGAAATTAAGAATAAATTTAAACGGGAAGAGAAAACAAATGGATGGAGAATAGACAAAGCATTCCAGGAAAAGCGC
CCTTTTGACTTCGATTTTTTTGCTCATTTGCTTCAGAAAGTTCTTGCTGAAGAAGAGAAAAGAAAACAAAAATCTGTTAAAAATCACAGT
TTAAAGGAGAAGAAATCCACCAAACCACGGAAAAATGTAAAAGTGAAAAAAGTTGCCTGTGAAGGAGTGAATAATGATCCAGATGAGTCT
ATGAGTTCTAGAATTTCAGACACGGAAAGATCTCAGAAGGATGCTCAGACAGTTGAAGAAGAGTCTCTGACCTTATCAAGGGAGGATGCA
GAGCAGGTTGCATTAGAAGTAGACCTAAATCAAAAGAAAAGAAGGAGGAAGAAGCAAGATGGAGCTAATGAACTGGGAGTAAACAATCTT
TTAGAAAATGCCACTGTTCAGGCGGGTCCTTCTAAAGGAGAAAAACACAAGAATAAATGTCAGGCTATAAGGCCTGAGCTAAAGGAAGGT
GAATGCAGTAAGGAGCAGATGCTTTCCTGCACACAAAACATAGATGGCATTGTGGGTTTTGCCTCCACTGAAAAAGTTGAGAAAAGAACT
GACCCCATCCTTTCATTAAGTAATCAACAAGATGCCACATCAGTAGCAACTGAGTCTTCAGAATCAAGCACTTCAGATTTGCCTTCATTC
GAAGTTGGAATTAGAGCATTGTGTGAGGTGAATAATGCTGAGGGTAGTTGTATAGAAGAAAGAAATGTTGACCTAAAAAATAATTCACTG
GAAATTGATCAAACAGAAAATGTTAAACCAATGTTGAGAGGTCGCTTCCAAAGACCTAAACCCAATTTGTCAAGGGCTGGGAAGAAATCA
GTTCTTTCACAAGGCAAAACAGAGTCAGAGAGCAAGAATTCACATTCAAAAACTTCAGTTGAAAAGAACCACGTGGAAAAAGATAAAATG
AATACATTGGACATTTTGAGAATGGAGACTACAGAGAGAGAGAATCCAGAAGCTGAAACTGTATCTGTTTTGGGTGAAAAAAATTGTCTG
CAGGAAGGGAGTCAACTAAAGGCTTTAAGACCTGTACAAGTGAGGGGCCGATTGCAAAAGCCAAAGCCAAATGCAGGTAAAGCTGCTGAA
AGAAAAGAAATTCTCATATCACAGGAAGAAATTGGGGCCAATGTAGAGAAGAATGAAAATGAATCCTGTGCTGATAGAGATACTCCTCAA
CACATGGAAGATCAATCGCGTAAAGATTTTGAAGAGGAAGATGTCATATTACAGCCTGAGAAAAATGATTCTTTTCAAAATGTGCAGCCA
GATGAGCCCAAGGTTCTTAATGAATGTCTAAGCGTTCAAGAGAATAATAAGGCAAATAAACTTAACCAAGTCCCAATTCTAAGGACTCGA
TTTCAGAAACCAAAGCCAAATATAGGAAGAGGAACTGGAAGGAGAGAAATTTCCTCAAAGGAAGAGGTACTAGAGAAGATTCTTGTCTCT
GGGGAAATGGCGGCAGCATTGAGAGAAACTGTAAGACTAGACACCTCACCAAAGGAGATGGTACCAGCAGAGATTAATACTAAAGAAATG
CAGTCAGATTTAAAAGAAACTGGAAGAAGAGCCATTTCTCCCAGGGAGAAGATTCTAGATGTGATTGATGACACCATAGAAATGGAGACA
GGTCTGAAAGCAATGGGAAGAGAGATTTGTCTAAGGGAGAAGACGCCAGAGGTGATTGATGCCACTGAGGAAATAGACAAAGATTTGGAA
GAAGCTGGAAGAAGAGAAATATCCCCACAGAAAAATGGCCCAGAGGAGGTTAAGCCTCTAGGTGAAGTGGAGACAGATTTGAAAGCAACT
GGAAATGAGAGTTCCCCAAGGGAGAAGACACCAGAGGTGACTGATGCCACTGAGGAAATAGACAAAAATTTGGAAGAAACTGGAAGAAGA
AAAATATCCCCAAGGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGATTTGAACGCAACTGGAAGAGAGAGTTCT
CCAAGGGAGAAGACACCAGAGGTGATTGATGCTACTGAGGAAATAGATTTGGAAGAAACTGAAAGAGAAGTATCCCCACAGGAAAATGGA
CTAGAGGAGGTCAAGCCTCTAGGTGAAATGGAGACGGATTTGAAAGCAACTGGAAGAGACAGTTTCCCAAGGGGGAAGACACCAGAGGTG
ATTGATGCCATTGAGGAAATAGAGATAGATTTGGAAGAAACTGAAAGAGAAATATCCCCACAGGAAAATGGCCTAGAGGAGGTTAAGCCT
CTAGGTGAAATGCAAACAGATTTGAAAGCAACCGGAAGGGAGATTTCCCCAAGGGAGAAGACACCAGAGGTGATTGATGCCACTGAGGAA
ATAGACAAAGATCTGGAAGAAACTGGAAGAAGAGAAATATCCCCAGAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAG
ACAGACTTGAAAACAACTGGAAGAGAGGGTTCCTCAAGGGAGAAGACACGAGAGGTGATTGATGCTGCTGAGGTAATAGAGACAGATTTG
GAAGAAACTGAAAGAGAAATATCGCCACAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGGTAAAATGGAGACAGATTTGAAAGAAATT
AGAGAAGAAATTTCCCAAAGGGAAAAGGTGCTAGCAGAGTTCAGTGCTATAAGGGAAAAGGAGATTGATTTGAAAGAAACTGGAAAAAGA
GACATTCCCATCATGGAGAAAGTATCAGGAAAGATGGCTGTTGTTGAAGAAATGGAGGCAGATTTGAAAGAAACTGGAAAAGAAAATTTT
AGAGAGAGAGGATCTGAAGAGATCTGTGTTACTGAGGAAAAGGTGGCAGAATTGAAACAAACTGGAAAAACAGACATTTCTCCAAGGGAA
AACGAGCTAGAGGAGACCAGTACCTCAAGACAAACTGACACACATTTAATGCAGAGCGGTAGCAATGACTTCAGTGCTGTGCCTTCACTA
GATATTCAGAACATTAGCAGTGAAGTACTGTCGATGATGCATACACCTGTAGAAGAAAAAAGAAATTCTGAAAAAGAAGTATCAAGTCAC
TTCAGTCATTTCAAGATTTCTTCACAGACTCATGAATCTGATAAAACAGAAGTCCAGGGGATTCAATCTCCAGATGTTCCAGAGCAGTTT
TCAGATATTAATTTAAGCAAATCTCTTCCTCAAGAACAGAAGCCACTTGAAATTAAACCAGCACCTTTTGTGAGGAGCCGATTCAAAAGA
CCAAAACCAAACTTAGCAAGAGCAGCTTTGAAGAGAGAGACTACAGAATCAGAAAAATATATATATGAGAAGAAATCAGAAACCAAGAAA
ATGGAGACTATTGTGATGCAAGAAAATAATGAACAAACTGATACTCTCCCTTCTCAACATGATGAAGCTTCCCTAATGATATCAAGAGAA
AAAGACACATTAGGTCACAGGAATGAGGAGGCTGTGATATTGCCATGTACACAGACTGAAAGGAACCTTTCACCTTCAAATTCTTGTGAA
CCTAAAGAGGAGTCTCAGTCAGCACCAGTCCAGAAAAATGACTCAGTTGTTTCTGTGGGGACTAATAATGTAAACACTTTCCAGCAAGAA
ATGAAGGAAAGTGTTATCCAAACTGCTCGACAAGTAAGGGGCCGACTTCAGAGACCGAGACCAAATATAAGAAAGACAGGACAGAGGCAA
ATAGTAGACAAAGGTGAAGCCAAAGGCATAATTAAGGAAGGAAGAACGATATTACCAAAAGATGAAACTGAAAAGAAAGTCTTAACTGTG
TCAAATTCTCAAATTGAAACTGAAATTGAAGTTCCATCGTCCGCAGTTCCAGAACACAGAATGTATGAAAATCAAAGTCAGGTGGTTCTT
GTAGAAAACCTTCATGTTAACAAAACAAATGAAACAATCAGACATGAAAATAAACCGTATGTTCCTAGTTCAGCACAAATGACAAGAAGG
AAATTCCAAAAGGCTAAGCCAAATTTGGGAAGAGCACACAGTAAGAAAGAGGAACCAGTTTTAGAAAAAGTCACAACAGATCAGAGCAAG
GAAGGCAAGCCAGAAGATCATTTGCTGCAGAAAGGAGCTTCCAACACCCAGCTCCTTCTAAAAGAAAAAGCTGAGCTTCTGACATCTCTG
GAGGTTTCAGCAAGAAAAGATTGTGTAGGTTCCAAAGAGTCTGCTTTGGCAAAAATAGATGCGGAATTAGAAGAAGTTGGACCATCAAGA
AGGGTTGGAGAGGAAACTGTAGGAGATAATTCACCATCTTCAGTTGTTGAAGAGCAATATCTCAATAAACTAACAAGCTGTCCACAACCG
TTAAACGAAACAAGTTACTCTAAAATTGCCCTGGATGGGAAAACAACTATCTCTTCTACATCTGAGTATGAGAGAAATCGTGGTGAAAGG
AGAAGTCATAAAAAGTTCAAACCAAATGTCACCAGAGGTCGTGGATCAAAACGAGTTCGGGGTAAGACCTCTAAGAAGGAACCTAGAGCT
TCCAAGGCCATGCTGGTGACTCTTCGGGCTTCCCAGGAAGAAGATGATGATGCTGACGATTTTGAGTCTGACTATGAGGAAGAAAGCTAT
CATCTTGCTCCCGAAGAAGTAAACAAAGCTCCAGTATTTGTACCTGTTGGTCTCAGATCTCCTGAACCTGTTTCTGCTCAGATTGAGGAA
ACAATGGAAGAGCTTGAAATAACTGTGAATGTCCCAGATGTAGGATGCATAGCTGTTGTTGAACATGAGCTACCAAACACAGATGTGACT
ACTGAAGAAATGAAACAAGAAGAAAATTTGAGTGTACCGTTTGAAGGATATGGAGTAATAGTACTAAATCCCAATGAAAACTATATTGAA
GTAGAAAAGCCGAAGATACACGTACAGTCATCATCTGATAGTTCAGATGAACCAGCAGAAAAACGGGAAAGAAAAGATAAAGTTTCTAAA
GAAACAAAGAAGCGACGTGATTTCTATGAGAAGTATCGTAACCCCCAAAGAGAAAAAGAAATGATGCAATTGTATATCAGAGAAAATGGT
TCTCCTGAAGAACATGCAATCTATGTTTGGGATCATTTCATAGCTCAGGCTGCTGCTGAGAATGTGTTTTTCGTTGCTCACAGCTATGGA
GGACTTGCTTTTGTTGAACTGATGATTCAACGAGAAGCCGATGTAAAAAATAAGGTAACTGCTGTGGCATTGACAGACTCTGTTCACAAT
GTGTGGCATCAAGAAGCTGGCAAAACGATTCGAGAATGGATGAGAGAGAACTGTTGTAATTGGGTCTCTAGCTCAGAACCATTAGACACA
TCAGTGGAGTCCATGCTACCTGATTGCCCCCGGGTCTCAGCAGGCACCGACCGTCACGAGCTAACTTCCTGGAAGAGCTTTCCGTCTATT
TTCAAATTCTTTACCGAAGCCTCAGAGGCCAAGACCAGCTCCCTGAAGCCGGCTGTGACGCGCCGCTCCCACCGCATCAAGCACGAAGAG

>In-frame_BDP1_ENST00000358731_chr5_70828254_+_FAM172A_ENST00000505869_chr5_93217394_-_6576nt
ATGTTCCGCAGGGCACGCCTTAGCGTGAAGCCGAATGTCAGGCCTGGTGTAGGCGCCAGGGGCTCCACAGCTTCCAATCCCCAGCGTGGA
CGGGAGTCTCCCAGGCCGCCGGATCCTGCCACGGACTCTGCTTCCAAGCCCGCGGAGCCCACAGATGTGCCCACAGTCGATTTCGGTGGA
GCGGAGCCCCAAGAAAAGGCTCCTAGGAGCAGTACTGAAAAGACTGGTGGTGACAATGATGTTGAAGAATCCAGTAGATCTTCCTCTACT
GTTTCACAGAGAAGAAAGCGAATATCAAGTACTTCTAGCCTGGTTAAGTCTAGTGTCAGTGTTCCTTCAGAATCTCATCCCTTATCTACA
ATTAATCAAGAGGCTCCACAGCCAACTGCCACTTCAACAAAAGAGAAACAGCCATGCTCAGACAGATACCGAATATACAAAGCCCAGAAA
CTGAGGGAAATGTTAAAAGAAGAATTGAGAAAAGAGAAGAAACAATGGAAAAACAAATATGCTATAAATGAAAGTCAGAGGCCACCAGAT
CGTTCAAAAATGACTATGAGAGACTTCATATATTATCTACCAGATAATAATCCAATGACTTCTTCACTGGAACAAGAAAAGAAAACTGAA
AAGCCATCGACTCCAGTCCAGACAAGAGAGCAAGAAGGTAAGAGTACTCCTAATGCTGAAGATAATGAAATGGAAGAAGAGACAGATGAT
GGGCCATTACTGGTTCCTCGAGTAAAAGTGGCAGAAGATGGTTCCATTATTTTGGATGAAGAAAGTTTAACTGTAGAAGTTTTAAGAACA
AAAGGCCCTTGTGTTGTTGAAGAAAATGACCCCATATTTGAGCGCGGTTCTACAACTACATACTCCAGCTTTAGGAAAAACTATTACTCT
AAACCATGGTCAAATAAAGAAACAGATATGTTTTTTTTAGCCATCAGCATGGTAGGAACTGACTTTTCTATGATCGGACAACTTTTTCCT
CACAGAGCAAGGATAGAAATTAAGAATAAATTTAAACGGGAAGAGAAAACAAATGGATGGAGAATAGACAAAGCATTCCAGGAAAAGCGC
CCTTTTGACTTCGATTTTTTTGCTCATTTGCTTCAGAAAGTTCTTGCTGAAGAAGAGAAAAGAAAACAAAAATCTGTTAAAAATCACAGT
TTAAAGGAGAAGAAATCCACCAAACCACGGAAAAATGTAAAAGTGAAAAAAGTTGCCTGTGAAGGAGTGAATAATGATCCAGATGAGTCT
ATGAGTTCTAGAATTTCAGACACGGAAAGATCTCAGAAGGATGCTCAGACAGTTGAAGAAGAGTCTCTGACCTTATCAAGGGAGGATGCA
GAGCAGGTTGCATTAGAAGTAGACCTAAATCAAAAGAAAAGAAGGAGGAAGAAGCAAGATGGAGCTAATGAACTGGGAGTAAACAATCTT
TTAGAAAATGCCACTGTTCAGGCGGGTCCTTCTAAAGGAGAAAAACACAAGAATAAATGTCAGGCTATAAGGCCTGAGCTAAAGGAAGGT
GAATGCAGTAAGGAGCAGATGCTTTCCTGCACACAAAACATAGATGGCATTGTGGGTTTTGCCTCCACTGAAAAAGTTGAGAAAAGAACT
GACCCCATCCTTTCATTAAGTAATCAACAAGATGCCACATCAGTAGCAACTGAGTCTTCAGAATCAAGCACTTCAGATTTGCCTTCATTC
GAAGTTGGAATTAGAGCATTGTGTGAGGTGAATAATGCTGAGGGTAGTTGTATAGAAGAAAGAAATGTTGACCTAAAAAATAATTCACTG
GAAATTGATCAAACAGAAAATGTTAAACCAATGTTGAGAGGTCGCTTCCAAAGACCTAAACCCAATTTGTCAAGGGCTGGGAAGAAATCA
GTTCTTTCACAAGGCAAAACAGAGTCAGAGAGCAAGAATTCACATTCAAAAACTTCAGTTGAAAAGAACCACGTGGAAAAAGATAAAATG
AATACATTGGACATTTTGAGAATGGAGACTACAGAGAGAGAGAATCCAGAAGCTGAAACTGTATCTGTTTTGGGTGAAAAAAATTGTCTG
CAGGAAGGGAGTCAACTAAAGGCTTTAAGACCTGTACAAGTGAGGGGCCGATTGCAAAAGCCAAAGCCAAATGCAGGTAAAGCTGCTGAA
AGAAAAGAAATTCTCATATCACAGGAAGAAATTGGGGCCAATGTAGAGAAGAATGAAAATGAATCCTGTGCTGATAGAGATACTCCTCAA
CACATGGAAGATCAATCGCGTAAAGATTTTGAAGAGGAAGATGTCATATTACAGCCTGAGAAAAATGATTCTTTTCAAAATGTGCAGCCA
GATGAGCCCAAGGTTCTTAATGAATGTCTAAGCGTTCAAGAGAATAATAAGGCAAATAAACTTAACCAAGTCCCAATTCTAAGGACTCGA
TTTCAGAAACCAAAGCCAAATATAGGAAGAGGAACTGGAAGGAGAGAAATTTCCTCAAAGGAAGAGGTACTAGAGAAGATTCTTGTCTCT
GGGGAAATGGCGGCAGCATTGAGAGAAACTGTAAGACTAGACACCTCACCAAAGGAGATGGTACCAGCAGAGATTAATACTAAAGAAATG
CAGTCAGATTTAAAAGAAACTGGAAGAAGAGCCATTTCTCCCAGGGAGAAGATTCTAGATGTGATTGATGACACCATAGAAATGGAGACA
GGTCTGAAAGCAATGGGAAGAGAGATTTGTCTAAGGGAGAAGACGCCAGAGGTGATTGATGCCACTGAGGAAATAGACAAAGATTTGGAA
GAAGCTGGAAGAAGAGAAATATCCCCACAGAAAAATGGCCCAGAGGAGGTTAAGCCTCTAGGTGAAGTGGAGACAGATTTGAAAGCAACT
GGAAATGAGAGTTCCCCAAGGGAGAAGACACCAGAGGTGACTGATGCCACTGAGGAAATAGACAAAAATTTGGAAGAAACTGGAAGAAGA
AAAATATCCCCAAGGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGATTTGAACGCAACTGGAAGAGAGAGTTCT
CCAAGGGAGAAGACACCAGAGGTGATTGATGCTACTGAGGAAATAGATTTGGAAGAAACTGAAAGAGAAGTATCCCCACAGGAAAATGGA
CTAGAGGAGGTCAAGCCTCTAGGTGAAATGGAGACGGATTTGAAAGCAACTGGAAGAGACAGTTTCCCAAGGGGGAAGACACCAGAGGTG
ATTGATGCCATTGAGGAAATAGAGATAGATTTGGAAGAAACTGAAAGAGAAATATCCCCACAGGAAAATGGCCTAGAGGAGGTTAAGCCT
CTAGGTGAAATGCAAACAGATTTGAAAGCAACCGGAAGGGAGATTTCCCCAAGGGAGAAGACACCAGAGGTGATTGATGCCACTGAGGAA
ATAGACAAAGATCTGGAAGAAACTGGAAGAAGAGAAATATCCCCAGAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAG
ACAGACTTGAAAACAACTGGAAGAGAGGGTTCCTCAAGGGAGAAGACACGAGAGGTGATTGATGCTGCTGAGGTAATAGAGACAGATTTG
GAAGAAACTGAAAGAGAAATATCGCCACAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGGTAAAATGGAGACAGATTTGAAAGAAATT
AGAGAAGAAATTTCCCAAAGGGAAAAGGTGCTAGCAGAGTTCAGTGCTATAAGGGAAAAGGAGATTGATTTGAAAGAAACTGGAAAAAGA
GACATTCCCATCATGGAGAAAGTATCAGGAAAGATGGCTGTTGTTGAAGAAATGGAGGCAGATTTGAAAGAAACTGGAAAAGAAAATTTT
AGAGAGAGAGGATCTGAAGAGATCTGTGTTACTGAGGAAAAGGTGGCAGAATTGAAACAAACTGGAAAAACAGACATTTCTCCAAGGGAA
AACGAGCTAGAGGAGACCAGTACCTCAAGACAAACTGACACACATTTAATGCAGAGCGGTAGCAATGACTTCAGTGCTGTGCCTTCACTA
GATATTCAGAACATTAGCAGTGAAGTACTGTCGATGATGCATACACCTGTAGAAGAAAAAAGAAATTCTGAAAAAGAAGTATCAAGTCAC
TTCAGTCATTTCAAGATTTCTTCACAGACTCATGAATCTGATAAAACAGAAGTCCAGGGGATTCAATCTCCAGATGTTCCAGAGCAGTTT
TCAGATATTAATTTAAGCAAATCTCTTCCTCAAGAACAGAAGCCACTTGAAATTAAACCAGCACCTTTTGTGAGGAGCCGATTCAAAAGA
CCAAAACCAAACTTAGCAAGAGCAGCTTTGAAGAGAGAGACTACAGAATCAGAAAAATATATATATGAGAAGAAATCAGAAACCAAGAAA
ATGGAGACTATTGTGATGCAAGAAAATAATGAACAAACTGATACTCTCCCTTCTCAACATGATGAAGCTTCCCTAATGATATCAAGAGAA
AAAGACACATTAGGTCACAGGAATGAGGAGGCTGTGATATTGCCATGTACACAGACTGAAAGGAACCTTTCACCTTCAAATTCTTGTGAA
CCTAAAGAGGAGTCTCAGTCAGCACCAGTCCAGAAAAATGACTCAGTTGTTTCTGTGGGGACTAATAATGTAAACACTTTCCAGCAAGAA
ATGAAGGAAAGTGTTATCCAAACTGCTCGACAAGTAAGGGGCCGACTTCAGAGACCGAGACCAAATATAAGAAAGACAGGACAGAGGCAA
ATAGTAGACAAAGGTGAAGCCAAAGGCATAATTAAGGAAGGAAGAACGATATTACCAAAAGATGAAACTGAAAAGAAAGTCTTAACTGTG
TCAAATTCTCAAATTGAAACTGAAATTGAAGTTCCATCGTCCGCAGTTCCAGAACACAGAATGTATGAAAATCAAAGTCAGGTGGTTCTT
GTAGAAAACCTTCATGTTAACAAAACAAATGAAACAATCAGACATGAAAATAAACCGTATGTTCCTAGTTCAGCACAAATGACAAGAAGG
AAATTCCAAAAGGCTAAGCCAAATTTGGGAAGAGCACACAGTAAGAAAGAGGAACCAGTTTTAGAAAAAGTCACAACAGATCAGAGCAAG
GAAGGCAAGCCAGAAGATCATTTGCTGCAGAAAGGAGCTTCCAACACCCAGCTCCTTCTAAAAGAAAAAGCTGAGCTTCTGACATCTCTG
GAGGTTTCAGCAAGAAAAGATTGTGTAGGTTCCAAAGAGTCTGCTTTGGCAAAAATAGATGCGGAATTAGAAGAAGTTGGACCATCAAGA
AGGGTTGGAGAGGAAACTGTAGGAGATAATTCACCATCTTCAGTTGTTGAAGAGCAATATCTCAATAAACTAACAAGCTGTCCACAACCG
TTAAACGAAACAAGTTACTCTAAAATTGCCCTGGATGGGAAAACAACTATCTCTTCTACATCTGAGTATGAGAGAAATCGTGGTGAAAGG
AGAAGTCATAAAAAGTTCAAACCAAATGTCACCAGAGGTCGTGGATCAAAACGAGTTCGGGGTAAGACCTCTAAGAAGGAACCTAGAGCT
TCCAAGGCCATGCTGGTGACTCTTCGGGCTTCCCAGGAAGAAGATGATGATGCTGACGATTTTGAGTCTGACTATGAGGAAGAAAGCTAT
CATCTTGCTCCCGAAGAAGTAAACAAAGCTCCAGTATTTGTACCTGTTGGTCTCAGATCTCCTGAACCTGTTTCTGCTCAGATTGAGGAA
ACAATGGAAGAGCTTGAAATAACTGTGAATGTCCCAGATGTAGGATGCATAGCTGTTGTTGAACATGAGCTACCAAACACAGATGTGACT
ACTGAAGAAATGAAACAAGAAGAAAATTTGAGTGTACCGTTTGAAGGATATGGAGTAATAGTACTAAATCCCAATGAAAACTATATTGAA
GTAGAAAAGCCGAAGATACACGTACAGTCATCATCTGATAGTTCAGATGAACCAGCAGAAAAACGGGAAAGAAAAGATAAAGTTTCTAAA
GAAACAAAGAAGCGACGTGATTTCTATGAGAAGTATCGTAACCCCCAAAGAGAAAAAGAAATGATGCAATTGTATATCAGAGAAAATGGT
TCTCCTGAAGAACATGCAATCTATGTTTGGGATCATTTCATAGCTCAGGCTGCTGCTGAGAATGTGTTTTTCGTTGCTCACAGCTATGGA
GGACTTGCTTTTGTTGAACTGATGATTCAACGAGAAGCCGATGTAAAAAATAAGGTAACTGCTGTGGCATTGACAGACTCTGTTCACAAT
GTGTGGCATCAAGAAGCTGGCAAAACGATTCGAGAATGGATGAGAGAGAACTGTTGTAATTGGGTCTCTAGCTCAGAACCATTAGACACA
TCAGTGGAGTCCATGCTACCTGATTGCCCCCGGGTCTCAGCAGGCACCGACCGTCACGAGCTAACTTCCTGGAAGAGCTTTCCGTCTATT
TTCAAATTCTTTACCGAAGCCTCAGAGGCCAAGACCAGCTCCCTGAAGCCGGCTGTGACGCGCCGCTCCCACCGCATCAAGCACGAAGAG

>In-frame_BDP1_ENST00000358731_chr5_70828254_+_FAM172A_ENST00000509739_chr5_93217394_-_6576nt
ATGTTCCGCAGGGCACGCCTTAGCGTGAAGCCGAATGTCAGGCCTGGTGTAGGCGCCAGGGGCTCCACAGCTTCCAATCCCCAGCGTGGA
CGGGAGTCTCCCAGGCCGCCGGATCCTGCCACGGACTCTGCTTCCAAGCCCGCGGAGCCCACAGATGTGCCCACAGTCGATTTCGGTGGA
GCGGAGCCCCAAGAAAAGGCTCCTAGGAGCAGTACTGAAAAGACTGGTGGTGACAATGATGTTGAAGAATCCAGTAGATCTTCCTCTACT
GTTTCACAGAGAAGAAAGCGAATATCAAGTACTTCTAGCCTGGTTAAGTCTAGTGTCAGTGTTCCTTCAGAATCTCATCCCTTATCTACA
ATTAATCAAGAGGCTCCACAGCCAACTGCCACTTCAACAAAAGAGAAACAGCCATGCTCAGACAGATACCGAATATACAAAGCCCAGAAA
CTGAGGGAAATGTTAAAAGAAGAATTGAGAAAAGAGAAGAAACAATGGAAAAACAAATATGCTATAAATGAAAGTCAGAGGCCACCAGAT
CGTTCAAAAATGACTATGAGAGACTTCATATATTATCTACCAGATAATAATCCAATGACTTCTTCACTGGAACAAGAAAAGAAAACTGAA
AAGCCATCGACTCCAGTCCAGACAAGAGAGCAAGAAGGTAAGAGTACTCCTAATGCTGAAGATAATGAAATGGAAGAAGAGACAGATGAT
GGGCCATTACTGGTTCCTCGAGTAAAAGTGGCAGAAGATGGTTCCATTATTTTGGATGAAGAAAGTTTAACTGTAGAAGTTTTAAGAACA
AAAGGCCCTTGTGTTGTTGAAGAAAATGACCCCATATTTGAGCGCGGTTCTACAACTACATACTCCAGCTTTAGGAAAAACTATTACTCT
AAACCATGGTCAAATAAAGAAACAGATATGTTTTTTTTAGCCATCAGCATGGTAGGAACTGACTTTTCTATGATCGGACAACTTTTTCCT
CACAGAGCAAGGATAGAAATTAAGAATAAATTTAAACGGGAAGAGAAAACAAATGGATGGAGAATAGACAAAGCATTCCAGGAAAAGCGC
CCTTTTGACTTCGATTTTTTTGCTCATTTGCTTCAGAAAGTTCTTGCTGAAGAAGAGAAAAGAAAACAAAAATCTGTTAAAAATCACAGT
TTAAAGGAGAAGAAATCCACCAAACCACGGAAAAATGTAAAAGTGAAAAAAGTTGCCTGTGAAGGAGTGAATAATGATCCAGATGAGTCT
ATGAGTTCTAGAATTTCAGACACGGAAAGATCTCAGAAGGATGCTCAGACAGTTGAAGAAGAGTCTCTGACCTTATCAAGGGAGGATGCA
GAGCAGGTTGCATTAGAAGTAGACCTAAATCAAAAGAAAAGAAGGAGGAAGAAGCAAGATGGAGCTAATGAACTGGGAGTAAACAATCTT
TTAGAAAATGCCACTGTTCAGGCGGGTCCTTCTAAAGGAGAAAAACACAAGAATAAATGTCAGGCTATAAGGCCTGAGCTAAAGGAAGGT
GAATGCAGTAAGGAGCAGATGCTTTCCTGCACACAAAACATAGATGGCATTGTGGGTTTTGCCTCCACTGAAAAAGTTGAGAAAAGAACT
GACCCCATCCTTTCATTAAGTAATCAACAAGATGCCACATCAGTAGCAACTGAGTCTTCAGAATCAAGCACTTCAGATTTGCCTTCATTC
GAAGTTGGAATTAGAGCATTGTGTGAGGTGAATAATGCTGAGGGTAGTTGTATAGAAGAAAGAAATGTTGACCTAAAAAATAATTCACTG
GAAATTGATCAAACAGAAAATGTTAAACCAATGTTGAGAGGTCGCTTCCAAAGACCTAAACCCAATTTGTCAAGGGCTGGGAAGAAATCA
GTTCTTTCACAAGGCAAAACAGAGTCAGAGAGCAAGAATTCACATTCAAAAACTTCAGTTGAAAAGAACCACGTGGAAAAAGATAAAATG
AATACATTGGACATTTTGAGAATGGAGACTACAGAGAGAGAGAATCCAGAAGCTGAAACTGTATCTGTTTTGGGTGAAAAAAATTGTCTG
CAGGAAGGGAGTCAACTAAAGGCTTTAAGACCTGTACAAGTGAGGGGCCGATTGCAAAAGCCAAAGCCAAATGCAGGTAAAGCTGCTGAA
AGAAAAGAAATTCTCATATCACAGGAAGAAATTGGGGCCAATGTAGAGAAGAATGAAAATGAATCCTGTGCTGATAGAGATACTCCTCAA
CACATGGAAGATCAATCGCGTAAAGATTTTGAAGAGGAAGATGTCATATTACAGCCTGAGAAAAATGATTCTTTTCAAAATGTGCAGCCA
GATGAGCCCAAGGTTCTTAATGAATGTCTAAGCGTTCAAGAGAATAATAAGGCAAATAAACTTAACCAAGTCCCAATTCTAAGGACTCGA
TTTCAGAAACCAAAGCCAAATATAGGAAGAGGAACTGGAAGGAGAGAAATTTCCTCAAAGGAAGAGGTACTAGAGAAGATTCTTGTCTCT
GGGGAAATGGCGGCAGCATTGAGAGAAACTGTAAGACTAGACACCTCACCAAAGGAGATGGTACCAGCAGAGATTAATACTAAAGAAATG
CAGTCAGATTTAAAAGAAACTGGAAGAAGAGCCATTTCTCCCAGGGAGAAGATTCTAGATGTGATTGATGACACCATAGAAATGGAGACA
GGTCTGAAAGCAATGGGAAGAGAGATTTGTCTAAGGGAGAAGACGCCAGAGGTGATTGATGCCACTGAGGAAATAGACAAAGATTTGGAA
GAAGCTGGAAGAAGAGAAATATCCCCACAGAAAAATGGCCCAGAGGAGGTTAAGCCTCTAGGTGAAGTGGAGACAGATTTGAAAGCAACT
GGAAATGAGAGTTCCCCAAGGGAGAAGACACCAGAGGTGACTGATGCCACTGAGGAAATAGACAAAAATTTGGAAGAAACTGGAAGAAGA
AAAATATCCCCAAGGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGATTTGAACGCAACTGGAAGAGAGAGTTCT
CCAAGGGAGAAGACACCAGAGGTGATTGATGCTACTGAGGAAATAGATTTGGAAGAAACTGAAAGAGAAGTATCCCCACAGGAAAATGGA
CTAGAGGAGGTCAAGCCTCTAGGTGAAATGGAGACGGATTTGAAAGCAACTGGAAGAGACAGTTTCCCAAGGGGGAAGACACCAGAGGTG
ATTGATGCCATTGAGGAAATAGAGATAGATTTGGAAGAAACTGAAAGAGAAATATCCCCACAGGAAAATGGCCTAGAGGAGGTTAAGCCT
CTAGGTGAAATGCAAACAGATTTGAAAGCAACCGGAAGGGAGATTTCCCCAAGGGAGAAGACACCAGAGGTGATTGATGCCACTGAGGAA
ATAGACAAAGATCTGGAAGAAACTGGAAGAAGAGAAATATCCCCAGAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAG
ACAGACTTGAAAACAACTGGAAGAGAGGGTTCCTCAAGGGAGAAGACACGAGAGGTGATTGATGCTGCTGAGGTAATAGAGACAGATTTG
GAAGAAACTGAAAGAGAAATATCGCCACAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGGTAAAATGGAGACAGATTTGAAAGAAATT
AGAGAAGAAATTTCCCAAAGGGAAAAGGTGCTAGCAGAGTTCAGTGCTATAAGGGAAAAGGAGATTGATTTGAAAGAAACTGGAAAAAGA
GACATTCCCATCATGGAGAAAGTATCAGGAAAGATGGCTGTTGTTGAAGAAATGGAGGCAGATTTGAAAGAAACTGGAAAAGAAAATTTT
AGAGAGAGAGGATCTGAAGAGATCTGTGTTACTGAGGAAAAGGTGGCAGAATTGAAACAAACTGGAAAAACAGACATTTCTCCAAGGGAA
AACGAGCTAGAGGAGACCAGTACCTCAAGACAAACTGACACACATTTAATGCAGAGCGGTAGCAATGACTTCAGTGCTGTGCCTTCACTA
GATATTCAGAACATTAGCAGTGAAGTACTGTCGATGATGCATACACCTGTAGAAGAAAAAAGAAATTCTGAAAAAGAAGTATCAAGTCAC
TTCAGTCATTTCAAGATTTCTTCACAGACTCATGAATCTGATAAAACAGAAGTCCAGGGGATTCAATCTCCAGATGTTCCAGAGCAGTTT
TCAGATATTAATTTAAGCAAATCTCTTCCTCAAGAACAGAAGCCACTTGAAATTAAACCAGCACCTTTTGTGAGGAGCCGATTCAAAAGA
CCAAAACCAAACTTAGCAAGAGCAGCTTTGAAGAGAGAGACTACAGAATCAGAAAAATATATATATGAGAAGAAATCAGAAACCAAGAAA
ATGGAGACTATTGTGATGCAAGAAAATAATGAACAAACTGATACTCTCCCTTCTCAACATGATGAAGCTTCCCTAATGATATCAAGAGAA
AAAGACACATTAGGTCACAGGAATGAGGAGGCTGTGATATTGCCATGTACACAGACTGAAAGGAACCTTTCACCTTCAAATTCTTGTGAA
CCTAAAGAGGAGTCTCAGTCAGCACCAGTCCAGAAAAATGACTCAGTTGTTTCTGTGGGGACTAATAATGTAAACACTTTCCAGCAAGAA
ATGAAGGAAAGTGTTATCCAAACTGCTCGACAAGTAAGGGGCCGACTTCAGAGACCGAGACCAAATATAAGAAAGACAGGACAGAGGCAA
ATAGTAGACAAAGGTGAAGCCAAAGGCATAATTAAGGAAGGAAGAACGATATTACCAAAAGATGAAACTGAAAAGAAAGTCTTAACTGTG
TCAAATTCTCAAATTGAAACTGAAATTGAAGTTCCATCGTCCGCAGTTCCAGAACACAGAATGTATGAAAATCAAAGTCAGGTGGTTCTT
GTAGAAAACCTTCATGTTAACAAAACAAATGAAACAATCAGACATGAAAATAAACCGTATGTTCCTAGTTCAGCACAAATGACAAGAAGG
AAATTCCAAAAGGCTAAGCCAAATTTGGGAAGAGCACACAGTAAGAAAGAGGAACCAGTTTTAGAAAAAGTCACAACAGATCAGAGCAAG
GAAGGCAAGCCAGAAGATCATTTGCTGCAGAAAGGAGCTTCCAACACCCAGCTCCTTCTAAAAGAAAAAGCTGAGCTTCTGACATCTCTG
GAGGTTTCAGCAAGAAAAGATTGTGTAGGTTCCAAAGAGTCTGCTTTGGCAAAAATAGATGCGGAATTAGAAGAAGTTGGACCATCAAGA
AGGGTTGGAGAGGAAACTGTAGGAGATAATTCACCATCTTCAGTTGTTGAAGAGCAATATCTCAATAAACTAACAAGCTGTCCACAACCG
TTAAACGAAACAAGTTACTCTAAAATTGCCCTGGATGGGAAAACAACTATCTCTTCTACATCTGAGTATGAGAGAAATCGTGGTGAAAGG
AGAAGTCATAAAAAGTTCAAACCAAATGTCACCAGAGGTCGTGGATCAAAACGAGTTCGGGGTAAGACCTCTAAGAAGGAACCTAGAGCT
TCCAAGGCCATGCTGGTGACTCTTCGGGCTTCCCAGGAAGAAGATGATGATGCTGACGATTTTGAGTCTGACTATGAGGAAGAAAGCTAT
CATCTTGCTCCCGAAGAAGTAAACAAAGCTCCAGTATTTGTACCTGTTGGTCTCAGATCTCCTGAACCTGTTTCTGCTCAGATTGAGGAA
ACAATGGAAGAGCTTGAAATAACTGTGAATGTCCCAGATGTAGGATGCATAGCTGTTGTTGAACATGAGCTACCAAACACAGATGTGACT
ACTGAAGAAATGAAACAAGAAGAAAATTTGAGTGTACCGTTTGAAGGATATGGAGTAATAGTACTAAATCCCAATGAAAACTATATTGAA
GTAGAAAAGCCGAAGATACACGTACAGTCATCATCTGATAGTTCAGATGAACCAGCAGAAAAACGGGAAAGAAAAGATAAAGTTTCTAAA
GAAACAAAGAAGCGACGTGATTTCTATGAGAAGTATCGTAACCCCCAAAGAGAAAAAGAAATGATGCAATTGTATATCAGAGAAAATGGT
TCTCCTGAAGAACATGCAATCTATGTTTGGGATCATTTCATAGCTCAGGCTGCTGCTGAGAATGTGTTTTTCGTTGCTCACAGCTATGGA
GGACTTGCTTTTGTTGAACTGATGATTCAACGAGAAGCCGATGTAAAAAATAAGGTAACTGCTGTGGCATTGACAGACTCTGTTCACAAT
GTGTGGCATCAAGAAGCTGGCAAAACGATTCGAGAATGGATGAGAGAGAACTGTTGTAATTGGGTCTCTAGCTCAGAACCATTAGACACA
TCAGTGGAGTCCATGCTACCTGATTGCCCCCGGGTCTCAGCAGGCACCGACCGTCACGAGCTAACTTCCTGGAAGAGCTTTCCGTCTATT
TTCAAATTCTTTACCGAAGCCTCAGAGGCCAAGACCAGCTCCCTGAAGCCGGCTGTGACGCGCCGCTCCCACCGCATCAAGCACGAAGAG

>In-frame_BDP1_ENST00000358731_chr5_70828254_+_FAM172A_ENST00000509163_chr5_93217394_-_6576nt
ATGTTCCGCAGGGCACGCCTTAGCGTGAAGCCGAATGTCAGGCCTGGTGTAGGCGCCAGGGGCTCCACAGCTTCCAATCCCCAGCGTGGA
CGGGAGTCTCCCAGGCCGCCGGATCCTGCCACGGACTCTGCTTCCAAGCCCGCGGAGCCCACAGATGTGCCCACAGTCGATTTCGGTGGA
GCGGAGCCCCAAGAAAAGGCTCCTAGGAGCAGTACTGAAAAGACTGGTGGTGACAATGATGTTGAAGAATCCAGTAGATCTTCCTCTACT
GTTTCACAGAGAAGAAAGCGAATATCAAGTACTTCTAGCCTGGTTAAGTCTAGTGTCAGTGTTCCTTCAGAATCTCATCCCTTATCTACA
ATTAATCAAGAGGCTCCACAGCCAACTGCCACTTCAACAAAAGAGAAACAGCCATGCTCAGACAGATACCGAATATACAAAGCCCAGAAA
CTGAGGGAAATGTTAAAAGAAGAATTGAGAAAAGAGAAGAAACAATGGAAAAACAAATATGCTATAAATGAAAGTCAGAGGCCACCAGAT
CGTTCAAAAATGACTATGAGAGACTTCATATATTATCTACCAGATAATAATCCAATGACTTCTTCACTGGAACAAGAAAAGAAAACTGAA
AAGCCATCGACTCCAGTCCAGACAAGAGAGCAAGAAGGTAAGAGTACTCCTAATGCTGAAGATAATGAAATGGAAGAAGAGACAGATGAT
GGGCCATTACTGGTTCCTCGAGTAAAAGTGGCAGAAGATGGTTCCATTATTTTGGATGAAGAAAGTTTAACTGTAGAAGTTTTAAGAACA
AAAGGCCCTTGTGTTGTTGAAGAAAATGACCCCATATTTGAGCGCGGTTCTACAACTACATACTCCAGCTTTAGGAAAAACTATTACTCT
AAACCATGGTCAAATAAAGAAACAGATATGTTTTTTTTAGCCATCAGCATGGTAGGAACTGACTTTTCTATGATCGGACAACTTTTTCCT
CACAGAGCAAGGATAGAAATTAAGAATAAATTTAAACGGGAAGAGAAAACAAATGGATGGAGAATAGACAAAGCATTCCAGGAAAAGCGC
CCTTTTGACTTCGATTTTTTTGCTCATTTGCTTCAGAAAGTTCTTGCTGAAGAAGAGAAAAGAAAACAAAAATCTGTTAAAAATCACAGT
TTAAAGGAGAAGAAATCCACCAAACCACGGAAAAATGTAAAAGTGAAAAAAGTTGCCTGTGAAGGAGTGAATAATGATCCAGATGAGTCT
ATGAGTTCTAGAATTTCAGACACGGAAAGATCTCAGAAGGATGCTCAGACAGTTGAAGAAGAGTCTCTGACCTTATCAAGGGAGGATGCA
GAGCAGGTTGCATTAGAAGTAGACCTAAATCAAAAGAAAAGAAGGAGGAAGAAGCAAGATGGAGCTAATGAACTGGGAGTAAACAATCTT
TTAGAAAATGCCACTGTTCAGGCGGGTCCTTCTAAAGGAGAAAAACACAAGAATAAATGTCAGGCTATAAGGCCTGAGCTAAAGGAAGGT
GAATGCAGTAAGGAGCAGATGCTTTCCTGCACACAAAACATAGATGGCATTGTGGGTTTTGCCTCCACTGAAAAAGTTGAGAAAAGAACT
GACCCCATCCTTTCATTAAGTAATCAACAAGATGCCACATCAGTAGCAACTGAGTCTTCAGAATCAAGCACTTCAGATTTGCCTTCATTC
GAAGTTGGAATTAGAGCATTGTGTGAGGTGAATAATGCTGAGGGTAGTTGTATAGAAGAAAGAAATGTTGACCTAAAAAATAATTCACTG
GAAATTGATCAAACAGAAAATGTTAAACCAATGTTGAGAGGTCGCTTCCAAAGACCTAAACCCAATTTGTCAAGGGCTGGGAAGAAATCA
GTTCTTTCACAAGGCAAAACAGAGTCAGAGAGCAAGAATTCACATTCAAAAACTTCAGTTGAAAAGAACCACGTGGAAAAAGATAAAATG
AATACATTGGACATTTTGAGAATGGAGACTACAGAGAGAGAGAATCCAGAAGCTGAAACTGTATCTGTTTTGGGTGAAAAAAATTGTCTG
CAGGAAGGGAGTCAACTAAAGGCTTTAAGACCTGTACAAGTGAGGGGCCGATTGCAAAAGCCAAAGCCAAATGCAGGTAAAGCTGCTGAA
AGAAAAGAAATTCTCATATCACAGGAAGAAATTGGGGCCAATGTAGAGAAGAATGAAAATGAATCCTGTGCTGATAGAGATACTCCTCAA
CACATGGAAGATCAATCGCGTAAAGATTTTGAAGAGGAAGATGTCATATTACAGCCTGAGAAAAATGATTCTTTTCAAAATGTGCAGCCA
GATGAGCCCAAGGTTCTTAATGAATGTCTAAGCGTTCAAGAGAATAATAAGGCAAATAAACTTAACCAAGTCCCAATTCTAAGGACTCGA
TTTCAGAAACCAAAGCCAAATATAGGAAGAGGAACTGGAAGGAGAGAAATTTCCTCAAAGGAAGAGGTACTAGAGAAGATTCTTGTCTCT
GGGGAAATGGCGGCAGCATTGAGAGAAACTGTAAGACTAGACACCTCACCAAAGGAGATGGTACCAGCAGAGATTAATACTAAAGAAATG
CAGTCAGATTTAAAAGAAACTGGAAGAAGAGCCATTTCTCCCAGGGAGAAGATTCTAGATGTGATTGATGACACCATAGAAATGGAGACA
GGTCTGAAAGCAATGGGAAGAGAGATTTGTCTAAGGGAGAAGACGCCAGAGGTGATTGATGCCACTGAGGAAATAGACAAAGATTTGGAA
GAAGCTGGAAGAAGAGAAATATCCCCACAGAAAAATGGCCCAGAGGAGGTTAAGCCTCTAGGTGAAGTGGAGACAGATTTGAAAGCAACT
GGAAATGAGAGTTCCCCAAGGGAGAAGACACCAGAGGTGACTGATGCCACTGAGGAAATAGACAAAAATTTGGAAGAAACTGGAAGAAGA
AAAATATCCCCAAGGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGATTTGAACGCAACTGGAAGAGAGAGTTCT
CCAAGGGAGAAGACACCAGAGGTGATTGATGCTACTGAGGAAATAGATTTGGAAGAAACTGAAAGAGAAGTATCCCCACAGGAAAATGGA
CTAGAGGAGGTCAAGCCTCTAGGTGAAATGGAGACGGATTTGAAAGCAACTGGAAGAGACAGTTTCCCAAGGGGGAAGACACCAGAGGTG
ATTGATGCCATTGAGGAAATAGAGATAGATTTGGAAGAAACTGAAAGAGAAATATCCCCACAGGAAAATGGCCTAGAGGAGGTTAAGCCT
CTAGGTGAAATGCAAACAGATTTGAAAGCAACCGGAAGGGAGATTTCCCCAAGGGAGAAGACACCAGAGGTGATTGATGCCACTGAGGAA
ATAGACAAAGATCTGGAAGAAACTGGAAGAAGAGAAATATCCCCAGAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAG
ACAGACTTGAAAACAACTGGAAGAGAGGGTTCCTCAAGGGAGAAGACACGAGAGGTGATTGATGCTGCTGAGGTAATAGAGACAGATTTG
GAAGAAACTGAAAGAGAAATATCGCCACAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGGTAAAATGGAGACAGATTTGAAAGAAATT
AGAGAAGAAATTTCCCAAAGGGAAAAGGTGCTAGCAGAGTTCAGTGCTATAAGGGAAAAGGAGATTGATTTGAAAGAAACTGGAAAAAGA
GACATTCCCATCATGGAGAAAGTATCAGGAAAGATGGCTGTTGTTGAAGAAATGGAGGCAGATTTGAAAGAAACTGGAAAAGAAAATTTT
AGAGAGAGAGGATCTGAAGAGATCTGTGTTACTGAGGAAAAGGTGGCAGAATTGAAACAAACTGGAAAAACAGACATTTCTCCAAGGGAA
AACGAGCTAGAGGAGACCAGTACCTCAAGACAAACTGACACACATTTAATGCAGAGCGGTAGCAATGACTTCAGTGCTGTGCCTTCACTA
GATATTCAGAACATTAGCAGTGAAGTACTGTCGATGATGCATACACCTGTAGAAGAAAAAAGAAATTCTGAAAAAGAAGTATCAAGTCAC
TTCAGTCATTTCAAGATTTCTTCACAGACTCATGAATCTGATAAAACAGAAGTCCAGGGGATTCAATCTCCAGATGTTCCAGAGCAGTTT
TCAGATATTAATTTAAGCAAATCTCTTCCTCAAGAACAGAAGCCACTTGAAATTAAACCAGCACCTTTTGTGAGGAGCCGATTCAAAAGA
CCAAAACCAAACTTAGCAAGAGCAGCTTTGAAGAGAGAGACTACAGAATCAGAAAAATATATATATGAGAAGAAATCAGAAACCAAGAAA
ATGGAGACTATTGTGATGCAAGAAAATAATGAACAAACTGATACTCTCCCTTCTCAACATGATGAAGCTTCCCTAATGATATCAAGAGAA
AAAGACACATTAGGTCACAGGAATGAGGAGGCTGTGATATTGCCATGTACACAGACTGAAAGGAACCTTTCACCTTCAAATTCTTGTGAA
CCTAAAGAGGAGTCTCAGTCAGCACCAGTCCAGAAAAATGACTCAGTTGTTTCTGTGGGGACTAATAATGTAAACACTTTCCAGCAAGAA
ATGAAGGAAAGTGTTATCCAAACTGCTCGACAAGTAAGGGGCCGACTTCAGAGACCGAGACCAAATATAAGAAAGACAGGACAGAGGCAA
ATAGTAGACAAAGGTGAAGCCAAAGGCATAATTAAGGAAGGAAGAACGATATTACCAAAAGATGAAACTGAAAAGAAAGTCTTAACTGTG
TCAAATTCTCAAATTGAAACTGAAATTGAAGTTCCATCGTCCGCAGTTCCAGAACACAGAATGTATGAAAATCAAAGTCAGGTGGTTCTT
GTAGAAAACCTTCATGTTAACAAAACAAATGAAACAATCAGACATGAAAATAAACCGTATGTTCCTAGTTCAGCACAAATGACAAGAAGG
AAATTCCAAAAGGCTAAGCCAAATTTGGGAAGAGCACACAGTAAGAAAGAGGAACCAGTTTTAGAAAAAGTCACAACAGATCAGAGCAAG
GAAGGCAAGCCAGAAGATCATTTGCTGCAGAAAGGAGCTTCCAACACCCAGCTCCTTCTAAAAGAAAAAGCTGAGCTTCTGACATCTCTG
GAGGTTTCAGCAAGAAAAGATTGTGTAGGTTCCAAAGAGTCTGCTTTGGCAAAAATAGATGCGGAATTAGAAGAAGTTGGACCATCAAGA
AGGGTTGGAGAGGAAACTGTAGGAGATAATTCACCATCTTCAGTTGTTGAAGAGCAATATCTCAATAAACTAACAAGCTGTCCACAACCG
TTAAACGAAACAAGTTACTCTAAAATTGCCCTGGATGGGAAAACAACTATCTCTTCTACATCTGAGTATGAGAGAAATCGTGGTGAAAGG
AGAAGTCATAAAAAGTTCAAACCAAATGTCACCAGAGGTCGTGGATCAAAACGAGTTCGGGGTAAGACCTCTAAGAAGGAACCTAGAGCT
TCCAAGGCCATGCTGGTGACTCTTCGGGCTTCCCAGGAAGAAGATGATGATGCTGACGATTTTGAGTCTGACTATGAGGAAGAAAGCTAT
CATCTTGCTCCCGAAGAAGTAAACAAAGCTCCAGTATTTGTACCTGTTGGTCTCAGATCTCCTGAACCTGTTTCTGCTCAGATTGAGGAA
ACAATGGAAGAGCTTGAAATAACTGTGAATGTCCCAGATGTAGGATGCATAGCTGTTGTTGAACATGAGCTACCAAACACAGATGTGACT
ACTGAAGAAATGAAACAAGAAGAAAATTTGAGTGTACCGTTTGAAGGATATGGAGTAATAGTACTAAATCCCAATGAAAACTATATTGAA
GTAGAAAAGCCGAAGATACACGTACAGTCATCATCTGATAGTTCAGATGAACCAGCAGAAAAACGGGAAAGAAAAGATAAAGTTTCTAAA
GAAACAAAGAAGCGACGTGATTTCTATGAGAAGTATCGTAACCCCCAAAGAGAAAAAGAAATGATGCAATTGTATATCAGAGAAAATGGT
TCTCCTGAAGAACATGCAATCTATGTTTGGGATCATTTCATAGCTCAGGCTGCTGCTGAGAATGTGTTTTTCGTTGCTCACAGCTATGGA
GGACTTGCTTTTGTTGAACTGATGATTCAACGAGAAGCCGATGTAAAAAATAAGGTAACTGCTGTGGCATTGACAGACTCTGTTCACAAT
GTGTGGCATCAAGAAGCTGGCAAAACGATTCGAGAATGGATGAGAGAGAACTGTTGTAATTGGGTCTCTAGCTCAGAACCATTAGACACA
TCAGTGGAGTCCATGCTACCTGATTGCCCCCGGGTCTCAGCAGGCACCGACCGTCACGAGCTAACTTCCTGGAAGAGCTTTCCGTCTATT
TTCAAATTCTTTACCGAAGCCTCAGAGGCCAAGACCAGCTCCCTGAAGCCGGCTGTGACGCGCCGCTCCCACCGCATCAAGCACGAAGAG

>In-frame_BDP1_ENST00000380675_chr5_70828254_+_FAM172A_ENST00000395965_chr5_93217394_-_987nt
ATGCTGGTGACTCTTCGGGCTTCCCAGGAAGAAGATGATGATGCTGACGATTTTGAGTCTGACTATGAGGAAGAAAGCTATCATCTTGCT
CCCGAAGAAGTAAACAAAGCTCCAGTATTTGTACCTGTTGGTCTCAGATCTCCTGAACCTGTTTCTGCTCAGATTGAGGAAACAATGGAA
GAGCTTGAAATAACTGTGAATGTCCCAGATGTAGGATGCATAGCTGTTGTTGAACATGAGCTACCAAACACAGATGTGACTACTGAAGAA
ATGAAACAAGAAGAAAATTTGAGTGTACCGTTTGAAGGATATGGAGTAATAGTACTAAATCCCAATGAAAACTATATTGAAGTAGAAAAG
CCGAAGATACACGTACAGTCATCATCTGATAGTTCAGATGAACCAGCAGAAAAACGGGAAAGAAAAGATAAAGTTTCTAAAGAAACAAAG
AAGCGACGTGATTTCTATGAGAAGTATCGTAACCCCCAAAGAGAAAAAGAAATGATGCAATTGTATATCAGAGAAAATGGTTCTCCTGAA
GAACATGCAATCTATGTTTGGGATCATTTCATAGCTCAGGCTGCTGCTGAGAATGTGTTTTTCGTTGCTCACAGCTATGGAGGACTTGCT
TTTGTTGAACTGATGATTCAACGAGAAGCCGATGTAAAAAATAAGGTAACTGCTGTGGCATTGACAGACTCTGTTCACAATGTGTGGCAT
CAAGAAGCTGGCAAAACGATTCGAGAATGGATGAGAGAGAACTGTTGTAATTGGGTCTCTAGCTCAGAACCATTAGACACATCAGTGGAG
TCCATGCTACCTGATTGCCCCCGGGTCTCAGCAGGCACCGACCGTCACGAGCTAACTTCCTGGAAGAGCTTTCCGTCTATTTTCAAATTC

>In-frame_BDP1_ENST00000380675_chr5_70828254_+_FAM172A_ENST00000505869_chr5_93217394_-_987nt
ATGCTGGTGACTCTTCGGGCTTCCCAGGAAGAAGATGATGATGCTGACGATTTTGAGTCTGACTATGAGGAAGAAAGCTATCATCTTGCT
CCCGAAGAAGTAAACAAAGCTCCAGTATTTGTACCTGTTGGTCTCAGATCTCCTGAACCTGTTTCTGCTCAGATTGAGGAAACAATGGAA
GAGCTTGAAATAACTGTGAATGTCCCAGATGTAGGATGCATAGCTGTTGTTGAACATGAGCTACCAAACACAGATGTGACTACTGAAGAA
ATGAAACAAGAAGAAAATTTGAGTGTACCGTTTGAAGGATATGGAGTAATAGTACTAAATCCCAATGAAAACTATATTGAAGTAGAAAAG
CCGAAGATACACGTACAGTCATCATCTGATAGTTCAGATGAACCAGCAGAAAAACGGGAAAGAAAAGATAAAGTTTCTAAAGAAACAAAG
AAGCGACGTGATTTCTATGAGAAGTATCGTAACCCCCAAAGAGAAAAAGAAATGATGCAATTGTATATCAGAGAAAATGGTTCTCCTGAA
GAACATGCAATCTATGTTTGGGATCATTTCATAGCTCAGGCTGCTGCTGAGAATGTGTTTTTCGTTGCTCACAGCTATGGAGGACTTGCT
TTTGTTGAACTGATGATTCAACGAGAAGCCGATGTAAAAAATAAGGTAACTGCTGTGGCATTGACAGACTCTGTTCACAATGTGTGGCAT
CAAGAAGCTGGCAAAACGATTCGAGAATGGATGAGAGAGAACTGTTGTAATTGGGTCTCTAGCTCAGAACCATTAGACACATCAGTGGAG
TCCATGCTACCTGATTGCCCCCGGGTCTCAGCAGGCACCGACCGTCACGAGCTAACTTCCTGGAAGAGCTTTCCGTCTATTTTCAAATTC

>In-frame_BDP1_ENST00000380675_chr5_70828254_+_FAM172A_ENST00000509739_chr5_93217394_-_987nt
ATGCTGGTGACTCTTCGGGCTTCCCAGGAAGAAGATGATGATGCTGACGATTTTGAGTCTGACTATGAGGAAGAAAGCTATCATCTTGCT
CCCGAAGAAGTAAACAAAGCTCCAGTATTTGTACCTGTTGGTCTCAGATCTCCTGAACCTGTTTCTGCTCAGATTGAGGAAACAATGGAA
GAGCTTGAAATAACTGTGAATGTCCCAGATGTAGGATGCATAGCTGTTGTTGAACATGAGCTACCAAACACAGATGTGACTACTGAAGAA
ATGAAACAAGAAGAAAATTTGAGTGTACCGTTTGAAGGATATGGAGTAATAGTACTAAATCCCAATGAAAACTATATTGAAGTAGAAAAG
CCGAAGATACACGTACAGTCATCATCTGATAGTTCAGATGAACCAGCAGAAAAACGGGAAAGAAAAGATAAAGTTTCTAAAGAAACAAAG
AAGCGACGTGATTTCTATGAGAAGTATCGTAACCCCCAAAGAGAAAAAGAAATGATGCAATTGTATATCAGAGAAAATGGTTCTCCTGAA
GAACATGCAATCTATGTTTGGGATCATTTCATAGCTCAGGCTGCTGCTGAGAATGTGTTTTTCGTTGCTCACAGCTATGGAGGACTTGCT
TTTGTTGAACTGATGATTCAACGAGAAGCCGATGTAAAAAATAAGGTAACTGCTGTGGCATTGACAGACTCTGTTCACAATGTGTGGCAT
CAAGAAGCTGGCAAAACGATTCGAGAATGGATGAGAGAGAACTGTTGTAATTGGGTCTCTAGCTCAGAACCATTAGACACATCAGTGGAG
TCCATGCTACCTGATTGCCCCCGGGTCTCAGCAGGCACCGACCGTCACGAGCTAACTTCCTGGAAGAGCTTTCCGTCTATTTTCAAATTC

>In-frame_BDP1_ENST00000380675_chr5_70828254_+_FAM172A_ENST00000509163_chr5_93217394_-_987nt
ATGCTGGTGACTCTTCGGGCTTCCCAGGAAGAAGATGATGATGCTGACGATTTTGAGTCTGACTATGAGGAAGAAAGCTATCATCTTGCT
CCCGAAGAAGTAAACAAAGCTCCAGTATTTGTACCTGTTGGTCTCAGATCTCCTGAACCTGTTTCTGCTCAGATTGAGGAAACAATGGAA
GAGCTTGAAATAACTGTGAATGTCCCAGATGTAGGATGCATAGCTGTTGTTGAACATGAGCTACCAAACACAGATGTGACTACTGAAGAA
ATGAAACAAGAAGAAAATTTGAGTGTACCGTTTGAAGGATATGGAGTAATAGTACTAAATCCCAATGAAAACTATATTGAAGTAGAAAAG
CCGAAGATACACGTACAGTCATCATCTGATAGTTCAGATGAACCAGCAGAAAAACGGGAAAGAAAAGATAAAGTTTCTAAAGAAACAAAG
AAGCGACGTGATTTCTATGAGAAGTATCGTAACCCCCAAAGAGAAAAAGAAATGATGCAATTGTATATCAGAGAAAATGGTTCTCCTGAA
GAACATGCAATCTATGTTTGGGATCATTTCATAGCTCAGGCTGCTGCTGAGAATGTGTTTTTCGTTGCTCACAGCTATGGAGGACTTGCT
TTTGTTGAACTGATGATTCAACGAGAAGCCGATGTAAAAAATAAGGTAACTGCTGTGGCATTGACAGACTCTGTTCACAATGTGTGGCAT
CAAGAAGCTGGCAAAACGATTCGAGAATGGATGAGAGAGAACTGTTGTAATTGGGTCTCTAGCTCAGAACCATTAGACACATCAGTGGAG
TCCATGCTACCTGATTGCCCCCGGGTCTCAGCAGGCACCGACCGTCACGAGCTAACTTCCTGGAAGAGCTTTCCGTCTATTTTCAAATTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_BDP1_ENST00000358731_chr5_70828254_+_FAM172A_ENST00000395965_chr5_93217394_-_9757nt
AGTTGCGGCGTCCTGTGAGCGCGGGGATGCTGGGAGGAGGGTGAAATTTAGCCATCGGTGTGTGGCAGGGTCATGAAAAAGCGGCGGCGG
CGGGAGAGAGGAGGAGGCGGCGGCGGGGCAGTGAAACTACGGTAGCTGCCCCCTGAGCTGGTGGTGTGGCTTTGTGGGGAGGGCGTAGTT
CCTAATCCCCTTTCCGGGCAGCCGCCGGGGCTCGGGGCTGTGAGCGGCCGTGAGGCTGCCTCCCCGGGCCCCCTGCCTCCGCCATGTTCC
GCAGGGCACGCCTTAGCGTGAAGCCGAATGTCAGGCCTGGTGTAGGCGCCAGGGGCTCCACAGCTTCCAATCCCCAGCGTGGACGGGAGT
CTCCCAGGCCGCCGGATCCTGCCACGGACTCTGCTTCCAAGCCCGCGGAGCCCACAGATGTGCCCACAGTCGATTTCGGTGGAGCGGAGC
CCCAAGAAAAGGCTCCTAGGAGCAGTACTGAAAAGACTGGTGGTGACAATGATGTTGAAGAATCCAGTAGATCTTCCTCTACTGTTTCAC
AGAGAAGAAAGCGAATATCAAGTACTTCTAGCCTGGTTAAGTCTAGTGTCAGTGTTCCTTCAGAATCTCATCCCTTATCTACAATTAATC
AAGAGGCTCCACAGCCAACTGCCACTTCAACAAAAGAGAAACAGCCATGCTCAGACAGATACCGAATATACAAAGCCCAGAAACTGAGGG
AAATGTTAAAAGAAGAATTGAGAAAAGAGAAGAAACAATGGAAAAACAAATATGCTATAAATGAAAGTCAGAGGCCACCAGATCGTTCAA
AAATGACTATGAGAGACTTCATATATTATCTACCAGATAATAATCCAATGACTTCTTCACTGGAACAAGAAAAGAAAACTGAAAAGCCAT
CGACTCCAGTCCAGACAAGAGAGCAAGAAGGTAAGAGTACTCCTAATGCTGAAGATAATGAAATGGAAGAAGAGACAGATGATGGGCCAT
TACTGGTTCCTCGAGTAAAAGTGGCAGAAGATGGTTCCATTATTTTGGATGAAGAAAGTTTAACTGTAGAAGTTTTAAGAACAAAAGGCC
CTTGTGTTGTTGAAGAAAATGACCCCATATTTGAGCGCGGTTCTACAACTACATACTCCAGCTTTAGGAAAAACTATTACTCTAAACCAT
GGTCAAATAAAGAAACAGATATGTTTTTTTTAGCCATCAGCATGGTAGGAACTGACTTTTCTATGATCGGACAACTTTTTCCTCACAGAG
CAAGGATAGAAATTAAGAATAAATTTAAACGGGAAGAGAAAACAAATGGATGGAGAATAGACAAAGCATTCCAGGAAAAGCGCCCTTTTG
ACTTCGATTTTTTTGCTCATTTGCTTCAGAAAGTTCTTGCTGAAGAAGAGAAAAGAAAACAAAAATCTGTTAAAAATCACAGTTTAAAGG
AGAAGAAATCCACCAAACCACGGAAAAATGTAAAAGTGAAAAAAGTTGCCTGTGAAGGAGTGAATAATGATCCAGATGAGTCTATGAGTT
CTAGAATTTCAGACACGGAAAGATCTCAGAAGGATGCTCAGACAGTTGAAGAAGAGTCTCTGACCTTATCAAGGGAGGATGCAGAGCAGG
TTGCATTAGAAGTAGACCTAAATCAAAAGAAAAGAAGGAGGAAGAAGCAAGATGGAGCTAATGAACTGGGAGTAAACAATCTTTTAGAAA
ATGCCACTGTTCAGGCGGGTCCTTCTAAAGGAGAAAAACACAAGAATAAATGTCAGGCTATAAGGCCTGAGCTAAAGGAAGGTGAATGCA
GTAAGGAGCAGATGCTTTCCTGCACACAAAACATAGATGGCATTGTGGGTTTTGCCTCCACTGAAAAAGTTGAGAAAAGAACTGACCCCA
TCCTTTCATTAAGTAATCAACAAGATGCCACATCAGTAGCAACTGAGTCTTCAGAATCAAGCACTTCAGATTTGCCTTCATTCGAAGTTG
GAATTAGAGCATTGTGTGAGGTGAATAATGCTGAGGGTAGTTGTATAGAAGAAAGAAATGTTGACCTAAAAAATAATTCACTGGAAATTG
ATCAAACAGAAAATGTTAAACCAATGTTGAGAGGTCGCTTCCAAAGACCTAAACCCAATTTGTCAAGGGCTGGGAAGAAATCAGTTCTTT
CACAAGGCAAAACAGAGTCAGAGAGCAAGAATTCACATTCAAAAACTTCAGTTGAAAAGAACCACGTGGAAAAAGATAAAATGAATACAT
TGGACATTTTGAGAATGGAGACTACAGAGAGAGAGAATCCAGAAGCTGAAACTGTATCTGTTTTGGGTGAAAAAAATTGTCTGCAGGAAG
GGAGTCAACTAAAGGCTTTAAGACCTGTACAAGTGAGGGGCCGATTGCAAAAGCCAAAGCCAAATGCAGGTAAAGCTGCTGAAAGAAAAG
AAATTCTCATATCACAGGAAGAAATTGGGGCCAATGTAGAGAAGAATGAAAATGAATCCTGTGCTGATAGAGATACTCCTCAACACATGG
AAGATCAATCGCGTAAAGATTTTGAAGAGGAAGATGTCATATTACAGCCTGAGAAAAATGATTCTTTTCAAAATGTGCAGCCAGATGAGC
CCAAGGTTCTTAATGAATGTCTAAGCGTTCAAGAGAATAATAAGGCAAATAAACTTAACCAAGTCCCAATTCTAAGGACTCGATTTCAGA
AACCAAAGCCAAATATAGGAAGAGGAACTGGAAGGAGAGAAATTTCCTCAAAGGAAGAGGTACTAGAGAAGATTCTTGTCTCTGGGGAAA
TGGCGGCAGCATTGAGAGAAACTGTAAGACTAGACACCTCACCAAAGGAGATGGTACCAGCAGAGATTAATACTAAAGAAATGCAGTCAG
ATTTAAAAGAAACTGGAAGAAGAGCCATTTCTCCCAGGGAGAAGATTCTAGATGTGATTGATGACACCATAGAAATGGAGACAGGTCTGA
AAGCAATGGGAAGAGAGATTTGTCTAAGGGAGAAGACGCCAGAGGTGATTGATGCCACTGAGGAAATAGACAAAGATTTGGAAGAAGCTG
GAAGAAGAGAAATATCCCCACAGAAAAATGGCCCAGAGGAGGTTAAGCCTCTAGGTGAAGTGGAGACAGATTTGAAAGCAACTGGAAATG
AGAGTTCCCCAAGGGAGAAGACACCAGAGGTGACTGATGCCACTGAGGAAATAGACAAAAATTTGGAAGAAACTGGAAGAAGAAAAATAT
CCCCAAGGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGATTTGAACGCAACTGGAAGAGAGAGTTCTCCAAGGG
AGAAGACACCAGAGGTGATTGATGCTACTGAGGAAATAGATTTGGAAGAAACTGAAAGAGAAGTATCCCCACAGGAAAATGGACTAGAGG
AGGTCAAGCCTCTAGGTGAAATGGAGACGGATTTGAAAGCAACTGGAAGAGACAGTTTCCCAAGGGGGAAGACACCAGAGGTGATTGATG
CCATTGAGGAAATAGAGATAGATTTGGAAGAAACTGAAAGAGAAATATCCCCACAGGAAAATGGCCTAGAGGAGGTTAAGCCTCTAGGTG
AAATGCAAACAGATTTGAAAGCAACCGGAAGGGAGATTTCCCCAAGGGAGAAGACACCAGAGGTGATTGATGCCACTGAGGAAATAGACA
AAGATCTGGAAGAAACTGGAAGAAGAGAAATATCCCCAGAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGACT
TGAAAACAACTGGAAGAGAGGGTTCCTCAAGGGAGAAGACACGAGAGGTGATTGATGCTGCTGAGGTAATAGAGACAGATTTGGAAGAAA
CTGAAAGAGAAATATCGCCACAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGGTAAAATGGAGACAGATTTGAAAGAAATTAGAGAAG
AAATTTCCCAAAGGGAAAAGGTGCTAGCAGAGTTCAGTGCTATAAGGGAAAAGGAGATTGATTTGAAAGAAACTGGAAAAAGAGACATTC
CCATCATGGAGAAAGTATCAGGAAAGATGGCTGTTGTTGAAGAAATGGAGGCAGATTTGAAAGAAACTGGAAAAGAAAATTTTAGAGAGA
GAGGATCTGAAGAGATCTGTGTTACTGAGGAAAAGGTGGCAGAATTGAAACAAACTGGAAAAACAGACATTTCTCCAAGGGAAAACGAGC
TAGAGGAGACCAGTACCTCAAGACAAACTGACACACATTTAATGCAGAGCGGTAGCAATGACTTCAGTGCTGTGCCTTCACTAGATATTC
AGAACATTAGCAGTGAAGTACTGTCGATGATGCATACACCTGTAGAAGAAAAAAGAAATTCTGAAAAAGAAGTATCAAGTCACTTCAGTC
ATTTCAAGATTTCTTCACAGACTCATGAATCTGATAAAACAGAAGTCCAGGGGATTCAATCTCCAGATGTTCCAGAGCAGTTTTCAGATA
TTAATTTAAGCAAATCTCTTCCTCAAGAACAGAAGCCACTTGAAATTAAACCAGCACCTTTTGTGAGGAGCCGATTCAAAAGACCAAAAC
CAAACTTAGCAAGAGCAGCTTTGAAGAGAGAGACTACAGAATCAGAAAAATATATATATGAGAAGAAATCAGAAACCAAGAAAATGGAGA
CTATTGTGATGCAAGAAAATAATGAACAAACTGATACTCTCCCTTCTCAACATGATGAAGCTTCCCTAATGATATCAAGAGAAAAAGACA
CATTAGGTCACAGGAATGAGGAGGCTGTGATATTGCCATGTACACAGACTGAAAGGAACCTTTCACCTTCAAATTCTTGTGAACCTAAAG
AGGAGTCTCAGTCAGCACCAGTCCAGAAAAATGACTCAGTTGTTTCTGTGGGGACTAATAATGTAAACACTTTCCAGCAAGAAATGAAGG
AAAGTGTTATCCAAACTGCTCGACAAGTAAGGGGCCGACTTCAGAGACCGAGACCAAATATAAGAAAGACAGGACAGAGGCAAATAGTAG
ACAAAGGTGAAGCCAAAGGCATAATTAAGGAAGGAAGAACGATATTACCAAAAGATGAAACTGAAAAGAAAGTCTTAACTGTGTCAAATT
CTCAAATTGAAACTGAAATTGAAGTTCCATCGTCCGCAGTTCCAGAACACAGAATGTATGAAAATCAAAGTCAGGTGGTTCTTGTAGAAA
ACCTTCATGTTAACAAAACAAATGAAACAATCAGACATGAAAATAAACCGTATGTTCCTAGTTCAGCACAAATGACAAGAAGGAAATTCC
AAAAGGCTAAGCCAAATTTGGGAAGAGCACACAGTAAGAAAGAGGAACCAGTTTTAGAAAAAGTCACAACAGATCAGAGCAAGGAAGGCA
AGCCAGAAGATCATTTGCTGCAGAAAGGAGCTTCCAACACCCAGCTCCTTCTAAAAGAAAAAGCTGAGCTTCTGACATCTCTGGAGGTTT
CAGCAAGAAAAGATTGTGTAGGTTCCAAAGAGTCTGCTTTGGCAAAAATAGATGCGGAATTAGAAGAAGTTGGACCATCAAGAAGGGTTG
GAGAGGAAACTGTAGGAGATAATTCACCATCTTCAGTTGTTGAAGAGCAATATCTCAATAAACTAACAAGCTGTCCACAACCGTTAAACG
AAACAAGTTACTCTAAAATTGCCCTGGATGGGAAAACAACTATCTCTTCTACATCTGAGTATGAGAGAAATCGTGGTGAAAGGAGAAGTC
ATAAAAAGTTCAAACCAAATGTCACCAGAGGTCGTGGATCAAAACGAGTTCGGGGTAAGACCTCTAAGAAGGAACCTAGAGCTTCCAAGG
CCATGCTGGTGACTCTTCGGGCTTCCCAGGAAGAAGATGATGATGCTGACGATTTTGAGTCTGACTATGAGGAAGAAAGCTATCATCTTG
CTCCCGAAGAAGTAAACAAAGCTCCAGTATTTGTACCTGTTGGTCTCAGATCTCCTGAACCTGTTTCTGCTCAGATTGAGGAAACAATGG
AAGAGCTTGAAATAACTGTGAATGTCCCAGATGTAGGATGCATAGCTGTTGTTGAACATGAGCTACCAAACACAGATGTGACTACTGAAG
AAATGAAACAAGAAGAAAATTTGAGTGTACCGTTTGAAGGATATGGAGTAATAGTACTAAATCCCAATGAAAACTATATTGAAGTAGAAA
AGCCGAAGATACACGTACAGTCATCATCTGATAGTTCAGATGAACCAGCAGAAAAACGGGAAAGAAAAGATAAAGTTTCTAAAGAAACAA
AGAAGCGACGTGATTTCTATGAGAAGTATCGTAACCCCCAAAGAGAAAAAGAAATGATGCAATTGTATATCAGAGAAAATGGTTCTCCTG
AAGAACATGCAATCTATGTTTGGGATCATTTCATAGCTCAGGCTGCTGCTGAGAATGTGTTTTTCGTTGCTCACAGCTATGGAGGACTTG
CTTTTGTTGAACTGATGATTCAACGAGAAGCCGATGTAAAAAATAAGGTAACTGCTGTGGCATTGACAGACTCTGTTCACAATGTGTGGC
ATCAAGAAGCTGGCAAAACGATTCGAGAATGGATGAGAGAGAACTGTTGTAATTGGGTCTCTAGCTCAGAACCATTAGACACATCAGTGG
AGTCCATGCTACCTGATTGCCCCCGGGTCTCAGCAGGCACCGACCGTCACGAGCTAACTTCCTGGAAGAGCTTTCCGTCTATTTTCAAAT
TCTTTACCGAAGCCTCAGAGGCCAAGACCAGCTCCCTGAAGCCGGCTGTGACGCGCCGCTCCCACCGCATCAAGCACGAAGAGCTGTAAG
AGGAGCGAGCGCGACGGGGGAGGCCGCCCTGGCGCACCCACCCGCACGCCTCCTCACTGCTTGTGTCGAGCGGACTCCCAGCCCCTCATT
AGATTGTTTTCTTCCCAGAGCCCAGGGTCGTGATATATACATCTAAATAGCGTTTTGCATTATTTCTAGATGAGTGCAACTGTCAAAGCA
ATATGGGTTCACTGGTCGTGCTTCCTGCGGGCTGAGCGCGGGCTGAGCGCTGCCAGTCAGCGCTCACATTAAGGCTGACAGCGCCCTGCC
TGGCTCGGCCGGCGAAGCTCTAATTGCCCTGAAGGAGACCGCGCGGGCGCTGCGGGTCCGGCGGCGTCGGCGCGGTCCTAGCGCCCGCCG
TAGCGGAGCCGCTGCTGCTTCCCCCTCCTTAATCATGTCCATCTTTCCCCGCTCTCAACTGGAGCAAACTTCTATTCCAGACTTCAGATT
TCCATTTTCACTAGGTTTTTCCCTGAGGGCATCTTATTACCCACCTCTTTTTTTTTTTTTTTAAGGAAGTTCCACACACACTCCAAAGCC
GATTTCAAATTCAGAACCTGAATGCCATGATGTACCATGTAGTTTGGGGAATGCAAATTGTTCTCTCCCTGTTTTCATTTCGGGACCAGA
AAAAAAAACAACTCTGCATAAAAATCTATAAAGTACTGAATCCGCATTACTGCTGAAAATCCTTTTGCCAGCTAATTGTGAGAGTTTACA
CAAGTCTCTGATTTCAGAAGAGACTGTTAAAACCAAAACAATGATGGGCAGCTCTTTTAAGTGTAGGTGTGAAGGTCCCATTTTCAATGG
AATTTCCAACTGTTATCACTGGGATTGACTTTACTTTTTAAACACATAATGTGTACTGTGTGGCATTGTAATTTAGATATAACACACTTA
AGTTTTGCTTTTTAAATCTCTCTGTGGAGAAAGGTTGTTGTTAATCCTTTCCAGAATGATCTATTCTGAGCTTTCCTGGAGTTAGGCCCT
TCTAGGGAGAGAATTTTTTTATTGTCATCAGGAAACGAAACCTTTGTGCTCTGCAGCCTTTTTCTTCTGAAAGGCTAAGTGGGGCTAAAA
TTATCCTTTTAGTTTTCTGCTTTAACAAGAAGAGAAGGACTTGGTGTGAAAGAATTTCTTCTCTCAGTCCAATGGTATAATTTTTAGCAC
TCCGCTTCCTCTGTAGGGTTTAGCCCTACAGTTTGAACAATTATTTTAATCCAGCTAAGATGTGGCCAACACTGTGAAATACAGGAGATG
TTAAGGTTTTGCTGACTTTTAGATTAAAATCTTAAAATTTCACATTATATTTTAATTACTTGAAAAGTTTAATTACCTAGTAAAGATTGT
TTCTAATAGATGAGAACATAAATTTAATAGTTTTCATCCTTTTTTAAAGTGTGTGCAACAATTAATATGCCTGCCTTATTTGAGGACATG
ATAAAATGTACCCAAAATGACTTCGAACTGTCTAATGCCTCAGAAAAGTAACTTAAAATCAACCACTTCGTGCTTAAATGTTTTTATATT
ATGAACCGATTTCAACAAGTTTTAAAGCTGTTAATATCTCATTGCTGTGTTTGACATACAAGTACATTCATTGGTTCTATAGTCTTAATG
ATGACAAATTAAAGATGTTTTTTCAGTGCTCAGGTATGCATATATTTTCGTGTTACTTAAGCAAAATCAACTATATAGGAGGAAAAATCA
AAATGGCATTTTATTCAGCTACCAGATGGCTTAAAATGAGTAAACCCCAACAACATCAAGCACATTTGTCTGTGATATTGACCCTTTTTA
TCCAATCATTACTATTTTAGAAGTAGTGGTGAACTGTGTAAAATAATGGTATCTTCAGCAGTGTTCCGGAATCTTAGTTGAGGGACAAAC
ATTCCTTCCAGTGAGAGATTCAAGAATTGATGTGAATTGAATATATTTTTCAAGGTATTATAAATTGTGTTGTGTTTTCAGTATAAGAAA
ATGTTGACAGGAAACAATTTTATAGCATTTATAAAAAACCAACACTTGTGCAATGCTAAATTGGCGAAGCTTCTGCACCTGAATTAGAGC
ACAATAAATATGCTGTTTATAAACCAAATCACTGCTATTCCTTCTCTGAAATCATCTCTCCTCTTTTTAAACCTTTACTTATAGCTAGAA
TAAATCACTATTTAATTGCCTCTAATACTTTAAAACTACTGGATGGTTAGGCCTGGTTTAACTATTTATGGAGAGCTATTTGCAAACTTA
AGTTGTGTAAATGTAATTTCTACTTGTGAATCTGAGCTGTAGCAGCCCAGAGGGAGCTAGGCAAACTATTCCAGACCACCAACTGATAAG
TGATCAGATTCTTTGTAATGTAGGATTTTTTAACCTGTTGATTATGGGTTTGTTGATATAAATGTAATAATGTTCACCTCGATTTTCCTG
GAGTAACAACCAGCGTTGGTAGTAGCCCACCTGCATGAGGACGGCCAGTGTTAACAATATTTTTGTTCTGATCTTCTTCCCCATTTTTGT
TTCCTCAAACAGGTTTTTAGGAGAGTGGAGATTTAAAGTCAGGATGTGGCCTTTTTATTTTAATTATATACTTAATTCTTAGAACAAGTA
GAATGGGAAAGGAGTGACTGATAAATCTAAGATTCAAAATAGTCCCGTCGAAACTTAAAGGCCAGATTATTGCTTTGGAGCTTTCTATAG
GTACTAGCCATCCCGTCGTTAAATGTTTTCATGGATATTTGAAAAGAAGACCATGTACCTTTAATAACTGTTCTTTTCTCGAGTTTCTGC
CTCGTGCTTTGACCTGGATTGCATTATTATTGTTTATGCGAAGTAAAAAAAAAAAAGGAAAGCACAAGCTTTTCCTGTATATTATATTTC

>In-frame_BDP1_ENST00000358731_chr5_70828254_+_FAM172A_ENST00000505869_chr5_93217394_-_7135nt
AGTTGCGGCGTCCTGTGAGCGCGGGGATGCTGGGAGGAGGGTGAAATTTAGCCATCGGTGTGTGGCAGGGTCATGAAAAAGCGGCGGCGG
CGGGAGAGAGGAGGAGGCGGCGGCGGGGCAGTGAAACTACGGTAGCTGCCCCCTGAGCTGGTGGTGTGGCTTTGTGGGGAGGGCGTAGTT
CCTAATCCCCTTTCCGGGCAGCCGCCGGGGCTCGGGGCTGTGAGCGGCCGTGAGGCTGCCTCCCCGGGCCCCCTGCCTCCGCCATGTTCC
GCAGGGCACGCCTTAGCGTGAAGCCGAATGTCAGGCCTGGTGTAGGCGCCAGGGGCTCCACAGCTTCCAATCCCCAGCGTGGACGGGAGT
CTCCCAGGCCGCCGGATCCTGCCACGGACTCTGCTTCCAAGCCCGCGGAGCCCACAGATGTGCCCACAGTCGATTTCGGTGGAGCGGAGC
CCCAAGAAAAGGCTCCTAGGAGCAGTACTGAAAAGACTGGTGGTGACAATGATGTTGAAGAATCCAGTAGATCTTCCTCTACTGTTTCAC
AGAGAAGAAAGCGAATATCAAGTACTTCTAGCCTGGTTAAGTCTAGTGTCAGTGTTCCTTCAGAATCTCATCCCTTATCTACAATTAATC
AAGAGGCTCCACAGCCAACTGCCACTTCAACAAAAGAGAAACAGCCATGCTCAGACAGATACCGAATATACAAAGCCCAGAAACTGAGGG
AAATGTTAAAAGAAGAATTGAGAAAAGAGAAGAAACAATGGAAAAACAAATATGCTATAAATGAAAGTCAGAGGCCACCAGATCGTTCAA
AAATGACTATGAGAGACTTCATATATTATCTACCAGATAATAATCCAATGACTTCTTCACTGGAACAAGAAAAGAAAACTGAAAAGCCAT
CGACTCCAGTCCAGACAAGAGAGCAAGAAGGTAAGAGTACTCCTAATGCTGAAGATAATGAAATGGAAGAAGAGACAGATGATGGGCCAT
TACTGGTTCCTCGAGTAAAAGTGGCAGAAGATGGTTCCATTATTTTGGATGAAGAAAGTTTAACTGTAGAAGTTTTAAGAACAAAAGGCC
CTTGTGTTGTTGAAGAAAATGACCCCATATTTGAGCGCGGTTCTACAACTACATACTCCAGCTTTAGGAAAAACTATTACTCTAAACCAT
GGTCAAATAAAGAAACAGATATGTTTTTTTTAGCCATCAGCATGGTAGGAACTGACTTTTCTATGATCGGACAACTTTTTCCTCACAGAG
CAAGGATAGAAATTAAGAATAAATTTAAACGGGAAGAGAAAACAAATGGATGGAGAATAGACAAAGCATTCCAGGAAAAGCGCCCTTTTG
ACTTCGATTTTTTTGCTCATTTGCTTCAGAAAGTTCTTGCTGAAGAAGAGAAAAGAAAACAAAAATCTGTTAAAAATCACAGTTTAAAGG
AGAAGAAATCCACCAAACCACGGAAAAATGTAAAAGTGAAAAAAGTTGCCTGTGAAGGAGTGAATAATGATCCAGATGAGTCTATGAGTT
CTAGAATTTCAGACACGGAAAGATCTCAGAAGGATGCTCAGACAGTTGAAGAAGAGTCTCTGACCTTATCAAGGGAGGATGCAGAGCAGG
TTGCATTAGAAGTAGACCTAAATCAAAAGAAAAGAAGGAGGAAGAAGCAAGATGGAGCTAATGAACTGGGAGTAAACAATCTTTTAGAAA
ATGCCACTGTTCAGGCGGGTCCTTCTAAAGGAGAAAAACACAAGAATAAATGTCAGGCTATAAGGCCTGAGCTAAAGGAAGGTGAATGCA
GTAAGGAGCAGATGCTTTCCTGCACACAAAACATAGATGGCATTGTGGGTTTTGCCTCCACTGAAAAAGTTGAGAAAAGAACTGACCCCA
TCCTTTCATTAAGTAATCAACAAGATGCCACATCAGTAGCAACTGAGTCTTCAGAATCAAGCACTTCAGATTTGCCTTCATTCGAAGTTG
GAATTAGAGCATTGTGTGAGGTGAATAATGCTGAGGGTAGTTGTATAGAAGAAAGAAATGTTGACCTAAAAAATAATTCACTGGAAATTG
ATCAAACAGAAAATGTTAAACCAATGTTGAGAGGTCGCTTCCAAAGACCTAAACCCAATTTGTCAAGGGCTGGGAAGAAATCAGTTCTTT
CACAAGGCAAAACAGAGTCAGAGAGCAAGAATTCACATTCAAAAACTTCAGTTGAAAAGAACCACGTGGAAAAAGATAAAATGAATACAT
TGGACATTTTGAGAATGGAGACTACAGAGAGAGAGAATCCAGAAGCTGAAACTGTATCTGTTTTGGGTGAAAAAAATTGTCTGCAGGAAG
GGAGTCAACTAAAGGCTTTAAGACCTGTACAAGTGAGGGGCCGATTGCAAAAGCCAAAGCCAAATGCAGGTAAAGCTGCTGAAAGAAAAG
AAATTCTCATATCACAGGAAGAAATTGGGGCCAATGTAGAGAAGAATGAAAATGAATCCTGTGCTGATAGAGATACTCCTCAACACATGG
AAGATCAATCGCGTAAAGATTTTGAAGAGGAAGATGTCATATTACAGCCTGAGAAAAATGATTCTTTTCAAAATGTGCAGCCAGATGAGC
CCAAGGTTCTTAATGAATGTCTAAGCGTTCAAGAGAATAATAAGGCAAATAAACTTAACCAAGTCCCAATTCTAAGGACTCGATTTCAGA
AACCAAAGCCAAATATAGGAAGAGGAACTGGAAGGAGAGAAATTTCCTCAAAGGAAGAGGTACTAGAGAAGATTCTTGTCTCTGGGGAAA
TGGCGGCAGCATTGAGAGAAACTGTAAGACTAGACACCTCACCAAAGGAGATGGTACCAGCAGAGATTAATACTAAAGAAATGCAGTCAG
ATTTAAAAGAAACTGGAAGAAGAGCCATTTCTCCCAGGGAGAAGATTCTAGATGTGATTGATGACACCATAGAAATGGAGACAGGTCTGA
AAGCAATGGGAAGAGAGATTTGTCTAAGGGAGAAGACGCCAGAGGTGATTGATGCCACTGAGGAAATAGACAAAGATTTGGAAGAAGCTG
GAAGAAGAGAAATATCCCCACAGAAAAATGGCCCAGAGGAGGTTAAGCCTCTAGGTGAAGTGGAGACAGATTTGAAAGCAACTGGAAATG
AGAGTTCCCCAAGGGAGAAGACACCAGAGGTGACTGATGCCACTGAGGAAATAGACAAAAATTTGGAAGAAACTGGAAGAAGAAAAATAT
CCCCAAGGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGATTTGAACGCAACTGGAAGAGAGAGTTCTCCAAGGG
AGAAGACACCAGAGGTGATTGATGCTACTGAGGAAATAGATTTGGAAGAAACTGAAAGAGAAGTATCCCCACAGGAAAATGGACTAGAGG
AGGTCAAGCCTCTAGGTGAAATGGAGACGGATTTGAAAGCAACTGGAAGAGACAGTTTCCCAAGGGGGAAGACACCAGAGGTGATTGATG
CCATTGAGGAAATAGAGATAGATTTGGAAGAAACTGAAAGAGAAATATCCCCACAGGAAAATGGCCTAGAGGAGGTTAAGCCTCTAGGTG
AAATGCAAACAGATTTGAAAGCAACCGGAAGGGAGATTTCCCCAAGGGAGAAGACACCAGAGGTGATTGATGCCACTGAGGAAATAGACA
AAGATCTGGAAGAAACTGGAAGAAGAGAAATATCCCCAGAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGACT
TGAAAACAACTGGAAGAGAGGGTTCCTCAAGGGAGAAGACACGAGAGGTGATTGATGCTGCTGAGGTAATAGAGACAGATTTGGAAGAAA
CTGAAAGAGAAATATCGCCACAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGGTAAAATGGAGACAGATTTGAAAGAAATTAGAGAAG
AAATTTCCCAAAGGGAAAAGGTGCTAGCAGAGTTCAGTGCTATAAGGGAAAAGGAGATTGATTTGAAAGAAACTGGAAAAAGAGACATTC
CCATCATGGAGAAAGTATCAGGAAAGATGGCTGTTGTTGAAGAAATGGAGGCAGATTTGAAAGAAACTGGAAAAGAAAATTTTAGAGAGA
GAGGATCTGAAGAGATCTGTGTTACTGAGGAAAAGGTGGCAGAATTGAAACAAACTGGAAAAACAGACATTTCTCCAAGGGAAAACGAGC
TAGAGGAGACCAGTACCTCAAGACAAACTGACACACATTTAATGCAGAGCGGTAGCAATGACTTCAGTGCTGTGCCTTCACTAGATATTC
AGAACATTAGCAGTGAAGTACTGTCGATGATGCATACACCTGTAGAAGAAAAAAGAAATTCTGAAAAAGAAGTATCAAGTCACTTCAGTC
ATTTCAAGATTTCTTCACAGACTCATGAATCTGATAAAACAGAAGTCCAGGGGATTCAATCTCCAGATGTTCCAGAGCAGTTTTCAGATA
TTAATTTAAGCAAATCTCTTCCTCAAGAACAGAAGCCACTTGAAATTAAACCAGCACCTTTTGTGAGGAGCCGATTCAAAAGACCAAAAC
CAAACTTAGCAAGAGCAGCTTTGAAGAGAGAGACTACAGAATCAGAAAAATATATATATGAGAAGAAATCAGAAACCAAGAAAATGGAGA
CTATTGTGATGCAAGAAAATAATGAACAAACTGATACTCTCCCTTCTCAACATGATGAAGCTTCCCTAATGATATCAAGAGAAAAAGACA
CATTAGGTCACAGGAATGAGGAGGCTGTGATATTGCCATGTACACAGACTGAAAGGAACCTTTCACCTTCAAATTCTTGTGAACCTAAAG
AGGAGTCTCAGTCAGCACCAGTCCAGAAAAATGACTCAGTTGTTTCTGTGGGGACTAATAATGTAAACACTTTCCAGCAAGAAATGAAGG
AAAGTGTTATCCAAACTGCTCGACAAGTAAGGGGCCGACTTCAGAGACCGAGACCAAATATAAGAAAGACAGGACAGAGGCAAATAGTAG
ACAAAGGTGAAGCCAAAGGCATAATTAAGGAAGGAAGAACGATATTACCAAAAGATGAAACTGAAAAGAAAGTCTTAACTGTGTCAAATT
CTCAAATTGAAACTGAAATTGAAGTTCCATCGTCCGCAGTTCCAGAACACAGAATGTATGAAAATCAAAGTCAGGTGGTTCTTGTAGAAA
ACCTTCATGTTAACAAAACAAATGAAACAATCAGACATGAAAATAAACCGTATGTTCCTAGTTCAGCACAAATGACAAGAAGGAAATTCC
AAAAGGCTAAGCCAAATTTGGGAAGAGCACACAGTAAGAAAGAGGAACCAGTTTTAGAAAAAGTCACAACAGATCAGAGCAAGGAAGGCA
AGCCAGAAGATCATTTGCTGCAGAAAGGAGCTTCCAACACCCAGCTCCTTCTAAAAGAAAAAGCTGAGCTTCTGACATCTCTGGAGGTTT
CAGCAAGAAAAGATTGTGTAGGTTCCAAAGAGTCTGCTTTGGCAAAAATAGATGCGGAATTAGAAGAAGTTGGACCATCAAGAAGGGTTG
GAGAGGAAACTGTAGGAGATAATTCACCATCTTCAGTTGTTGAAGAGCAATATCTCAATAAACTAACAAGCTGTCCACAACCGTTAAACG
AAACAAGTTACTCTAAAATTGCCCTGGATGGGAAAACAACTATCTCTTCTACATCTGAGTATGAGAGAAATCGTGGTGAAAGGAGAAGTC
ATAAAAAGTTCAAACCAAATGTCACCAGAGGTCGTGGATCAAAACGAGTTCGGGGTAAGACCTCTAAGAAGGAACCTAGAGCTTCCAAGG
CCATGCTGGTGACTCTTCGGGCTTCCCAGGAAGAAGATGATGATGCTGACGATTTTGAGTCTGACTATGAGGAAGAAAGCTATCATCTTG
CTCCCGAAGAAGTAAACAAAGCTCCAGTATTTGTACCTGTTGGTCTCAGATCTCCTGAACCTGTTTCTGCTCAGATTGAGGAAACAATGG
AAGAGCTTGAAATAACTGTGAATGTCCCAGATGTAGGATGCATAGCTGTTGTTGAACATGAGCTACCAAACACAGATGTGACTACTGAAG
AAATGAAACAAGAAGAAAATTTGAGTGTACCGTTTGAAGGATATGGAGTAATAGTACTAAATCCCAATGAAAACTATATTGAAGTAGAAA
AGCCGAAGATACACGTACAGTCATCATCTGATAGTTCAGATGAACCAGCAGAAAAACGGGAAAGAAAAGATAAAGTTTCTAAAGAAACAA
AGAAGCGACGTGATTTCTATGAGAAGTATCGTAACCCCCAAAGAGAAAAAGAAATGATGCAATTGTATATCAGAGAAAATGGTTCTCCTG
AAGAACATGCAATCTATGTTTGGGATCATTTCATAGCTCAGGCTGCTGCTGAGAATGTGTTTTTCGTTGCTCACAGCTATGGAGGACTTG
CTTTTGTTGAACTGATGATTCAACGAGAAGCCGATGTAAAAAATAAGGTAACTGCTGTGGCATTGACAGACTCTGTTCACAATGTGTGGC
ATCAAGAAGCTGGCAAAACGATTCGAGAATGGATGAGAGAGAACTGTTGTAATTGGGTCTCTAGCTCAGAACCATTAGACACATCAGTGG
AGTCCATGCTACCTGATTGCCCCCGGGTCTCAGCAGGCACCGACCGTCACGAGCTAACTTCCTGGAAGAGCTTTCCGTCTATTTTCAAAT
TCTTTACCGAAGCCTCAGAGGCCAAGACCAGCTCCCTGAAGCCGGCTGTGACGCGCCGCTCCCACCGCATCAAGCACGAAGAGCTGTAAG
AGGAGCGAGCGCGACGGGGGAGGCCGCCCTGGCGCACCCACCCGCACGCCTCCTCACTGCTTGTGTCGAGCGGACTCCCAGCCCCTCATT
AGATTGTTTTCTTCCCAGAGCCCAGGGTCGTGATATATACATCTAAATAGCGTTTTGCATTATTTCTAGATGAGTGCAACTGTCAAAGCA
ATATGGGTTCACTGGTCGTGCTTCCTGCGGGCTGAGCGCGGGCTGAGCGCTGCCAGTCAGCGCTCACATTAAGGCTGACAGCGCCCTGCC

>In-frame_BDP1_ENST00000358731_chr5_70828254_+_FAM172A_ENST00000509739_chr5_93217394_-_6943nt
AGTTGCGGCGTCCTGTGAGCGCGGGGATGCTGGGAGGAGGGTGAAATTTAGCCATCGGTGTGTGGCAGGGTCATGAAAAAGCGGCGGCGG
CGGGAGAGAGGAGGAGGCGGCGGCGGGGCAGTGAAACTACGGTAGCTGCCCCCTGAGCTGGTGGTGTGGCTTTGTGGGGAGGGCGTAGTT
CCTAATCCCCTTTCCGGGCAGCCGCCGGGGCTCGGGGCTGTGAGCGGCCGTGAGGCTGCCTCCCCGGGCCCCCTGCCTCCGCCATGTTCC
GCAGGGCACGCCTTAGCGTGAAGCCGAATGTCAGGCCTGGTGTAGGCGCCAGGGGCTCCACAGCTTCCAATCCCCAGCGTGGACGGGAGT
CTCCCAGGCCGCCGGATCCTGCCACGGACTCTGCTTCCAAGCCCGCGGAGCCCACAGATGTGCCCACAGTCGATTTCGGTGGAGCGGAGC
CCCAAGAAAAGGCTCCTAGGAGCAGTACTGAAAAGACTGGTGGTGACAATGATGTTGAAGAATCCAGTAGATCTTCCTCTACTGTTTCAC
AGAGAAGAAAGCGAATATCAAGTACTTCTAGCCTGGTTAAGTCTAGTGTCAGTGTTCCTTCAGAATCTCATCCCTTATCTACAATTAATC
AAGAGGCTCCACAGCCAACTGCCACTTCAACAAAAGAGAAACAGCCATGCTCAGACAGATACCGAATATACAAAGCCCAGAAACTGAGGG
AAATGTTAAAAGAAGAATTGAGAAAAGAGAAGAAACAATGGAAAAACAAATATGCTATAAATGAAAGTCAGAGGCCACCAGATCGTTCAA
AAATGACTATGAGAGACTTCATATATTATCTACCAGATAATAATCCAATGACTTCTTCACTGGAACAAGAAAAGAAAACTGAAAAGCCAT
CGACTCCAGTCCAGACAAGAGAGCAAGAAGGTAAGAGTACTCCTAATGCTGAAGATAATGAAATGGAAGAAGAGACAGATGATGGGCCAT
TACTGGTTCCTCGAGTAAAAGTGGCAGAAGATGGTTCCATTATTTTGGATGAAGAAAGTTTAACTGTAGAAGTTTTAAGAACAAAAGGCC
CTTGTGTTGTTGAAGAAAATGACCCCATATTTGAGCGCGGTTCTACAACTACATACTCCAGCTTTAGGAAAAACTATTACTCTAAACCAT
GGTCAAATAAAGAAACAGATATGTTTTTTTTAGCCATCAGCATGGTAGGAACTGACTTTTCTATGATCGGACAACTTTTTCCTCACAGAG
CAAGGATAGAAATTAAGAATAAATTTAAACGGGAAGAGAAAACAAATGGATGGAGAATAGACAAAGCATTCCAGGAAAAGCGCCCTTTTG
ACTTCGATTTTTTTGCTCATTTGCTTCAGAAAGTTCTTGCTGAAGAAGAGAAAAGAAAACAAAAATCTGTTAAAAATCACAGTTTAAAGG
AGAAGAAATCCACCAAACCACGGAAAAATGTAAAAGTGAAAAAAGTTGCCTGTGAAGGAGTGAATAATGATCCAGATGAGTCTATGAGTT
CTAGAATTTCAGACACGGAAAGATCTCAGAAGGATGCTCAGACAGTTGAAGAAGAGTCTCTGACCTTATCAAGGGAGGATGCAGAGCAGG
TTGCATTAGAAGTAGACCTAAATCAAAAGAAAAGAAGGAGGAAGAAGCAAGATGGAGCTAATGAACTGGGAGTAAACAATCTTTTAGAAA
ATGCCACTGTTCAGGCGGGTCCTTCTAAAGGAGAAAAACACAAGAATAAATGTCAGGCTATAAGGCCTGAGCTAAAGGAAGGTGAATGCA
GTAAGGAGCAGATGCTTTCCTGCACACAAAACATAGATGGCATTGTGGGTTTTGCCTCCACTGAAAAAGTTGAGAAAAGAACTGACCCCA
TCCTTTCATTAAGTAATCAACAAGATGCCACATCAGTAGCAACTGAGTCTTCAGAATCAAGCACTTCAGATTTGCCTTCATTCGAAGTTG
GAATTAGAGCATTGTGTGAGGTGAATAATGCTGAGGGTAGTTGTATAGAAGAAAGAAATGTTGACCTAAAAAATAATTCACTGGAAATTG
ATCAAACAGAAAATGTTAAACCAATGTTGAGAGGTCGCTTCCAAAGACCTAAACCCAATTTGTCAAGGGCTGGGAAGAAATCAGTTCTTT
CACAAGGCAAAACAGAGTCAGAGAGCAAGAATTCACATTCAAAAACTTCAGTTGAAAAGAACCACGTGGAAAAAGATAAAATGAATACAT
TGGACATTTTGAGAATGGAGACTACAGAGAGAGAGAATCCAGAAGCTGAAACTGTATCTGTTTTGGGTGAAAAAAATTGTCTGCAGGAAG
GGAGTCAACTAAAGGCTTTAAGACCTGTACAAGTGAGGGGCCGATTGCAAAAGCCAAAGCCAAATGCAGGTAAAGCTGCTGAAAGAAAAG
AAATTCTCATATCACAGGAAGAAATTGGGGCCAATGTAGAGAAGAATGAAAATGAATCCTGTGCTGATAGAGATACTCCTCAACACATGG
AAGATCAATCGCGTAAAGATTTTGAAGAGGAAGATGTCATATTACAGCCTGAGAAAAATGATTCTTTTCAAAATGTGCAGCCAGATGAGC
CCAAGGTTCTTAATGAATGTCTAAGCGTTCAAGAGAATAATAAGGCAAATAAACTTAACCAAGTCCCAATTCTAAGGACTCGATTTCAGA
AACCAAAGCCAAATATAGGAAGAGGAACTGGAAGGAGAGAAATTTCCTCAAAGGAAGAGGTACTAGAGAAGATTCTTGTCTCTGGGGAAA
TGGCGGCAGCATTGAGAGAAACTGTAAGACTAGACACCTCACCAAAGGAGATGGTACCAGCAGAGATTAATACTAAAGAAATGCAGTCAG
ATTTAAAAGAAACTGGAAGAAGAGCCATTTCTCCCAGGGAGAAGATTCTAGATGTGATTGATGACACCATAGAAATGGAGACAGGTCTGA
AAGCAATGGGAAGAGAGATTTGTCTAAGGGAGAAGACGCCAGAGGTGATTGATGCCACTGAGGAAATAGACAAAGATTTGGAAGAAGCTG
GAAGAAGAGAAATATCCCCACAGAAAAATGGCCCAGAGGAGGTTAAGCCTCTAGGTGAAGTGGAGACAGATTTGAAAGCAACTGGAAATG
AGAGTTCCCCAAGGGAGAAGACACCAGAGGTGACTGATGCCACTGAGGAAATAGACAAAAATTTGGAAGAAACTGGAAGAAGAAAAATAT
CCCCAAGGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGATTTGAACGCAACTGGAAGAGAGAGTTCTCCAAGGG
AGAAGACACCAGAGGTGATTGATGCTACTGAGGAAATAGATTTGGAAGAAACTGAAAGAGAAGTATCCCCACAGGAAAATGGACTAGAGG
AGGTCAAGCCTCTAGGTGAAATGGAGACGGATTTGAAAGCAACTGGAAGAGACAGTTTCCCAAGGGGGAAGACACCAGAGGTGATTGATG
CCATTGAGGAAATAGAGATAGATTTGGAAGAAACTGAAAGAGAAATATCCCCACAGGAAAATGGCCTAGAGGAGGTTAAGCCTCTAGGTG
AAATGCAAACAGATTTGAAAGCAACCGGAAGGGAGATTTCCCCAAGGGAGAAGACACCAGAGGTGATTGATGCCACTGAGGAAATAGACA
AAGATCTGGAAGAAACTGGAAGAAGAGAAATATCCCCAGAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGACT
TGAAAACAACTGGAAGAGAGGGTTCCTCAAGGGAGAAGACACGAGAGGTGATTGATGCTGCTGAGGTAATAGAGACAGATTTGGAAGAAA
CTGAAAGAGAAATATCGCCACAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGGTAAAATGGAGACAGATTTGAAAGAAATTAGAGAAG
AAATTTCCCAAAGGGAAAAGGTGCTAGCAGAGTTCAGTGCTATAAGGGAAAAGGAGATTGATTTGAAAGAAACTGGAAAAAGAGACATTC
CCATCATGGAGAAAGTATCAGGAAAGATGGCTGTTGTTGAAGAAATGGAGGCAGATTTGAAAGAAACTGGAAAAGAAAATTTTAGAGAGA
GAGGATCTGAAGAGATCTGTGTTACTGAGGAAAAGGTGGCAGAATTGAAACAAACTGGAAAAACAGACATTTCTCCAAGGGAAAACGAGC
TAGAGGAGACCAGTACCTCAAGACAAACTGACACACATTTAATGCAGAGCGGTAGCAATGACTTCAGTGCTGTGCCTTCACTAGATATTC
AGAACATTAGCAGTGAAGTACTGTCGATGATGCATACACCTGTAGAAGAAAAAAGAAATTCTGAAAAAGAAGTATCAAGTCACTTCAGTC
ATTTCAAGATTTCTTCACAGACTCATGAATCTGATAAAACAGAAGTCCAGGGGATTCAATCTCCAGATGTTCCAGAGCAGTTTTCAGATA
TTAATTTAAGCAAATCTCTTCCTCAAGAACAGAAGCCACTTGAAATTAAACCAGCACCTTTTGTGAGGAGCCGATTCAAAAGACCAAAAC
CAAACTTAGCAAGAGCAGCTTTGAAGAGAGAGACTACAGAATCAGAAAAATATATATATGAGAAGAAATCAGAAACCAAGAAAATGGAGA
CTATTGTGATGCAAGAAAATAATGAACAAACTGATACTCTCCCTTCTCAACATGATGAAGCTTCCCTAATGATATCAAGAGAAAAAGACA
CATTAGGTCACAGGAATGAGGAGGCTGTGATATTGCCATGTACACAGACTGAAAGGAACCTTTCACCTTCAAATTCTTGTGAACCTAAAG
AGGAGTCTCAGTCAGCACCAGTCCAGAAAAATGACTCAGTTGTTTCTGTGGGGACTAATAATGTAAACACTTTCCAGCAAGAAATGAAGG
AAAGTGTTATCCAAACTGCTCGACAAGTAAGGGGCCGACTTCAGAGACCGAGACCAAATATAAGAAAGACAGGACAGAGGCAAATAGTAG
ACAAAGGTGAAGCCAAAGGCATAATTAAGGAAGGAAGAACGATATTACCAAAAGATGAAACTGAAAAGAAAGTCTTAACTGTGTCAAATT
CTCAAATTGAAACTGAAATTGAAGTTCCATCGTCCGCAGTTCCAGAACACAGAATGTATGAAAATCAAAGTCAGGTGGTTCTTGTAGAAA
ACCTTCATGTTAACAAAACAAATGAAACAATCAGACATGAAAATAAACCGTATGTTCCTAGTTCAGCACAAATGACAAGAAGGAAATTCC
AAAAGGCTAAGCCAAATTTGGGAAGAGCACACAGTAAGAAAGAGGAACCAGTTTTAGAAAAAGTCACAACAGATCAGAGCAAGGAAGGCA
AGCCAGAAGATCATTTGCTGCAGAAAGGAGCTTCCAACACCCAGCTCCTTCTAAAAGAAAAAGCTGAGCTTCTGACATCTCTGGAGGTTT
CAGCAAGAAAAGATTGTGTAGGTTCCAAAGAGTCTGCTTTGGCAAAAATAGATGCGGAATTAGAAGAAGTTGGACCATCAAGAAGGGTTG
GAGAGGAAACTGTAGGAGATAATTCACCATCTTCAGTTGTTGAAGAGCAATATCTCAATAAACTAACAAGCTGTCCACAACCGTTAAACG
AAACAAGTTACTCTAAAATTGCCCTGGATGGGAAAACAACTATCTCTTCTACATCTGAGTATGAGAGAAATCGTGGTGAAAGGAGAAGTC
ATAAAAAGTTCAAACCAAATGTCACCAGAGGTCGTGGATCAAAACGAGTTCGGGGTAAGACCTCTAAGAAGGAACCTAGAGCTTCCAAGG
CCATGCTGGTGACTCTTCGGGCTTCCCAGGAAGAAGATGATGATGCTGACGATTTTGAGTCTGACTATGAGGAAGAAAGCTATCATCTTG
CTCCCGAAGAAGTAAACAAAGCTCCAGTATTTGTACCTGTTGGTCTCAGATCTCCTGAACCTGTTTCTGCTCAGATTGAGGAAACAATGG
AAGAGCTTGAAATAACTGTGAATGTCCCAGATGTAGGATGCATAGCTGTTGTTGAACATGAGCTACCAAACACAGATGTGACTACTGAAG
AAATGAAACAAGAAGAAAATTTGAGTGTACCGTTTGAAGGATATGGAGTAATAGTACTAAATCCCAATGAAAACTATATTGAAGTAGAAA
AGCCGAAGATACACGTACAGTCATCATCTGATAGTTCAGATGAACCAGCAGAAAAACGGGAAAGAAAAGATAAAGTTTCTAAAGAAACAA
AGAAGCGACGTGATTTCTATGAGAAGTATCGTAACCCCCAAAGAGAAAAAGAAATGATGCAATTGTATATCAGAGAAAATGGTTCTCCTG
AAGAACATGCAATCTATGTTTGGGATCATTTCATAGCTCAGGCTGCTGCTGAGAATGTGTTTTTCGTTGCTCACAGCTATGGAGGACTTG
CTTTTGTTGAACTGATGATTCAACGAGAAGCCGATGTAAAAAATAAGGTAACTGCTGTGGCATTGACAGACTCTGTTCACAATGTGTGGC
ATCAAGAAGCTGGCAAAACGATTCGAGAATGGATGAGAGAGAACTGTTGTAATTGGGTCTCTAGCTCAGAACCATTAGACACATCAGTGG
AGTCCATGCTACCTGATTGCCCCCGGGTCTCAGCAGGCACCGACCGTCACGAGCTAACTTCCTGGAAGAGCTTTCCGTCTATTTTCAAAT
TCTTTACCGAAGCCTCAGAGGCCAAGACCAGCTCCCTGAAGCCGGCTGTGACGCGCCGCTCCCACCGCATCAAGCACGAAGAGCTGTAAG
AGGAGCGAGCGCGACGGGGGAGGCCGCCCTGGCGCACCCACCCGCACGCCTCCTCACTGCTTGTGTCGAGCGGACTCCCAGCCCCTCATT

>In-frame_BDP1_ENST00000358731_chr5_70828254_+_FAM172A_ENST00000509163_chr5_93217394_-_6897nt
AGTTGCGGCGTCCTGTGAGCGCGGGGATGCTGGGAGGAGGGTGAAATTTAGCCATCGGTGTGTGGCAGGGTCATGAAAAAGCGGCGGCGG
CGGGAGAGAGGAGGAGGCGGCGGCGGGGCAGTGAAACTACGGTAGCTGCCCCCTGAGCTGGTGGTGTGGCTTTGTGGGGAGGGCGTAGTT
CCTAATCCCCTTTCCGGGCAGCCGCCGGGGCTCGGGGCTGTGAGCGGCCGTGAGGCTGCCTCCCCGGGCCCCCTGCCTCCGCCATGTTCC
GCAGGGCACGCCTTAGCGTGAAGCCGAATGTCAGGCCTGGTGTAGGCGCCAGGGGCTCCACAGCTTCCAATCCCCAGCGTGGACGGGAGT
CTCCCAGGCCGCCGGATCCTGCCACGGACTCTGCTTCCAAGCCCGCGGAGCCCACAGATGTGCCCACAGTCGATTTCGGTGGAGCGGAGC
CCCAAGAAAAGGCTCCTAGGAGCAGTACTGAAAAGACTGGTGGTGACAATGATGTTGAAGAATCCAGTAGATCTTCCTCTACTGTTTCAC
AGAGAAGAAAGCGAATATCAAGTACTTCTAGCCTGGTTAAGTCTAGTGTCAGTGTTCCTTCAGAATCTCATCCCTTATCTACAATTAATC
AAGAGGCTCCACAGCCAACTGCCACTTCAACAAAAGAGAAACAGCCATGCTCAGACAGATACCGAATATACAAAGCCCAGAAACTGAGGG
AAATGTTAAAAGAAGAATTGAGAAAAGAGAAGAAACAATGGAAAAACAAATATGCTATAAATGAAAGTCAGAGGCCACCAGATCGTTCAA
AAATGACTATGAGAGACTTCATATATTATCTACCAGATAATAATCCAATGACTTCTTCACTGGAACAAGAAAAGAAAACTGAAAAGCCAT
CGACTCCAGTCCAGACAAGAGAGCAAGAAGGTAAGAGTACTCCTAATGCTGAAGATAATGAAATGGAAGAAGAGACAGATGATGGGCCAT
TACTGGTTCCTCGAGTAAAAGTGGCAGAAGATGGTTCCATTATTTTGGATGAAGAAAGTTTAACTGTAGAAGTTTTAAGAACAAAAGGCC
CTTGTGTTGTTGAAGAAAATGACCCCATATTTGAGCGCGGTTCTACAACTACATACTCCAGCTTTAGGAAAAACTATTACTCTAAACCAT
GGTCAAATAAAGAAACAGATATGTTTTTTTTAGCCATCAGCATGGTAGGAACTGACTTTTCTATGATCGGACAACTTTTTCCTCACAGAG
CAAGGATAGAAATTAAGAATAAATTTAAACGGGAAGAGAAAACAAATGGATGGAGAATAGACAAAGCATTCCAGGAAAAGCGCCCTTTTG
ACTTCGATTTTTTTGCTCATTTGCTTCAGAAAGTTCTTGCTGAAGAAGAGAAAAGAAAACAAAAATCTGTTAAAAATCACAGTTTAAAGG
AGAAGAAATCCACCAAACCACGGAAAAATGTAAAAGTGAAAAAAGTTGCCTGTGAAGGAGTGAATAATGATCCAGATGAGTCTATGAGTT
CTAGAATTTCAGACACGGAAAGATCTCAGAAGGATGCTCAGACAGTTGAAGAAGAGTCTCTGACCTTATCAAGGGAGGATGCAGAGCAGG
TTGCATTAGAAGTAGACCTAAATCAAAAGAAAAGAAGGAGGAAGAAGCAAGATGGAGCTAATGAACTGGGAGTAAACAATCTTTTAGAAA
ATGCCACTGTTCAGGCGGGTCCTTCTAAAGGAGAAAAACACAAGAATAAATGTCAGGCTATAAGGCCTGAGCTAAAGGAAGGTGAATGCA
GTAAGGAGCAGATGCTTTCCTGCACACAAAACATAGATGGCATTGTGGGTTTTGCCTCCACTGAAAAAGTTGAGAAAAGAACTGACCCCA
TCCTTTCATTAAGTAATCAACAAGATGCCACATCAGTAGCAACTGAGTCTTCAGAATCAAGCACTTCAGATTTGCCTTCATTCGAAGTTG
GAATTAGAGCATTGTGTGAGGTGAATAATGCTGAGGGTAGTTGTATAGAAGAAAGAAATGTTGACCTAAAAAATAATTCACTGGAAATTG
ATCAAACAGAAAATGTTAAACCAATGTTGAGAGGTCGCTTCCAAAGACCTAAACCCAATTTGTCAAGGGCTGGGAAGAAATCAGTTCTTT
CACAAGGCAAAACAGAGTCAGAGAGCAAGAATTCACATTCAAAAACTTCAGTTGAAAAGAACCACGTGGAAAAAGATAAAATGAATACAT
TGGACATTTTGAGAATGGAGACTACAGAGAGAGAGAATCCAGAAGCTGAAACTGTATCTGTTTTGGGTGAAAAAAATTGTCTGCAGGAAG
GGAGTCAACTAAAGGCTTTAAGACCTGTACAAGTGAGGGGCCGATTGCAAAAGCCAAAGCCAAATGCAGGTAAAGCTGCTGAAAGAAAAG
AAATTCTCATATCACAGGAAGAAATTGGGGCCAATGTAGAGAAGAATGAAAATGAATCCTGTGCTGATAGAGATACTCCTCAACACATGG
AAGATCAATCGCGTAAAGATTTTGAAGAGGAAGATGTCATATTACAGCCTGAGAAAAATGATTCTTTTCAAAATGTGCAGCCAGATGAGC
CCAAGGTTCTTAATGAATGTCTAAGCGTTCAAGAGAATAATAAGGCAAATAAACTTAACCAAGTCCCAATTCTAAGGACTCGATTTCAGA
AACCAAAGCCAAATATAGGAAGAGGAACTGGAAGGAGAGAAATTTCCTCAAAGGAAGAGGTACTAGAGAAGATTCTTGTCTCTGGGGAAA
TGGCGGCAGCATTGAGAGAAACTGTAAGACTAGACACCTCACCAAAGGAGATGGTACCAGCAGAGATTAATACTAAAGAAATGCAGTCAG
ATTTAAAAGAAACTGGAAGAAGAGCCATTTCTCCCAGGGAGAAGATTCTAGATGTGATTGATGACACCATAGAAATGGAGACAGGTCTGA
AAGCAATGGGAAGAGAGATTTGTCTAAGGGAGAAGACGCCAGAGGTGATTGATGCCACTGAGGAAATAGACAAAGATTTGGAAGAAGCTG
GAAGAAGAGAAATATCCCCACAGAAAAATGGCCCAGAGGAGGTTAAGCCTCTAGGTGAAGTGGAGACAGATTTGAAAGCAACTGGAAATG
AGAGTTCCCCAAGGGAGAAGACACCAGAGGTGACTGATGCCACTGAGGAAATAGACAAAAATTTGGAAGAAACTGGAAGAAGAAAAATAT
CCCCAAGGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGATTTGAACGCAACTGGAAGAGAGAGTTCTCCAAGGG
AGAAGACACCAGAGGTGATTGATGCTACTGAGGAAATAGATTTGGAAGAAACTGAAAGAGAAGTATCCCCACAGGAAAATGGACTAGAGG
AGGTCAAGCCTCTAGGTGAAATGGAGACGGATTTGAAAGCAACTGGAAGAGACAGTTTCCCAAGGGGGAAGACACCAGAGGTGATTGATG
CCATTGAGGAAATAGAGATAGATTTGGAAGAAACTGAAAGAGAAATATCCCCACAGGAAAATGGCCTAGAGGAGGTTAAGCCTCTAGGTG
AAATGCAAACAGATTTGAAAGCAACCGGAAGGGAGATTTCCCCAAGGGAGAAGACACCAGAGGTGATTGATGCCACTGAGGAAATAGACA
AAGATCTGGAAGAAACTGGAAGAAGAGAAATATCCCCAGAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGACT
TGAAAACAACTGGAAGAGAGGGTTCCTCAAGGGAGAAGACACGAGAGGTGATTGATGCTGCTGAGGTAATAGAGACAGATTTGGAAGAAA
CTGAAAGAGAAATATCGCCACAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGGTAAAATGGAGACAGATTTGAAAGAAATTAGAGAAG
AAATTTCCCAAAGGGAAAAGGTGCTAGCAGAGTTCAGTGCTATAAGGGAAAAGGAGATTGATTTGAAAGAAACTGGAAAAAGAGACATTC
CCATCATGGAGAAAGTATCAGGAAAGATGGCTGTTGTTGAAGAAATGGAGGCAGATTTGAAAGAAACTGGAAAAGAAAATTTTAGAGAGA
GAGGATCTGAAGAGATCTGTGTTACTGAGGAAAAGGTGGCAGAATTGAAACAAACTGGAAAAACAGACATTTCTCCAAGGGAAAACGAGC
TAGAGGAGACCAGTACCTCAAGACAAACTGACACACATTTAATGCAGAGCGGTAGCAATGACTTCAGTGCTGTGCCTTCACTAGATATTC
AGAACATTAGCAGTGAAGTACTGTCGATGATGCATACACCTGTAGAAGAAAAAAGAAATTCTGAAAAAGAAGTATCAAGTCACTTCAGTC
ATTTCAAGATTTCTTCACAGACTCATGAATCTGATAAAACAGAAGTCCAGGGGATTCAATCTCCAGATGTTCCAGAGCAGTTTTCAGATA
TTAATTTAAGCAAATCTCTTCCTCAAGAACAGAAGCCACTTGAAATTAAACCAGCACCTTTTGTGAGGAGCCGATTCAAAAGACCAAAAC
CAAACTTAGCAAGAGCAGCTTTGAAGAGAGAGACTACAGAATCAGAAAAATATATATATGAGAAGAAATCAGAAACCAAGAAAATGGAGA
CTATTGTGATGCAAGAAAATAATGAACAAACTGATACTCTCCCTTCTCAACATGATGAAGCTTCCCTAATGATATCAAGAGAAAAAGACA
CATTAGGTCACAGGAATGAGGAGGCTGTGATATTGCCATGTACACAGACTGAAAGGAACCTTTCACCTTCAAATTCTTGTGAACCTAAAG
AGGAGTCTCAGTCAGCACCAGTCCAGAAAAATGACTCAGTTGTTTCTGTGGGGACTAATAATGTAAACACTTTCCAGCAAGAAATGAAGG
AAAGTGTTATCCAAACTGCTCGACAAGTAAGGGGCCGACTTCAGAGACCGAGACCAAATATAAGAAAGACAGGACAGAGGCAAATAGTAG
ACAAAGGTGAAGCCAAAGGCATAATTAAGGAAGGAAGAACGATATTACCAAAAGATGAAACTGAAAAGAAAGTCTTAACTGTGTCAAATT
CTCAAATTGAAACTGAAATTGAAGTTCCATCGTCCGCAGTTCCAGAACACAGAATGTATGAAAATCAAAGTCAGGTGGTTCTTGTAGAAA
ACCTTCATGTTAACAAAACAAATGAAACAATCAGACATGAAAATAAACCGTATGTTCCTAGTTCAGCACAAATGACAAGAAGGAAATTCC
AAAAGGCTAAGCCAAATTTGGGAAGAGCACACAGTAAGAAAGAGGAACCAGTTTTAGAAAAAGTCACAACAGATCAGAGCAAGGAAGGCA
AGCCAGAAGATCATTTGCTGCAGAAAGGAGCTTCCAACACCCAGCTCCTTCTAAAAGAAAAAGCTGAGCTTCTGACATCTCTGGAGGTTT
CAGCAAGAAAAGATTGTGTAGGTTCCAAAGAGTCTGCTTTGGCAAAAATAGATGCGGAATTAGAAGAAGTTGGACCATCAAGAAGGGTTG
GAGAGGAAACTGTAGGAGATAATTCACCATCTTCAGTTGTTGAAGAGCAATATCTCAATAAACTAACAAGCTGTCCACAACCGTTAAACG
AAACAAGTTACTCTAAAATTGCCCTGGATGGGAAAACAACTATCTCTTCTACATCTGAGTATGAGAGAAATCGTGGTGAAAGGAGAAGTC
ATAAAAAGTTCAAACCAAATGTCACCAGAGGTCGTGGATCAAAACGAGTTCGGGGTAAGACCTCTAAGAAGGAACCTAGAGCTTCCAAGG
CCATGCTGGTGACTCTTCGGGCTTCCCAGGAAGAAGATGATGATGCTGACGATTTTGAGTCTGACTATGAGGAAGAAAGCTATCATCTTG
CTCCCGAAGAAGTAAACAAAGCTCCAGTATTTGTACCTGTTGGTCTCAGATCTCCTGAACCTGTTTCTGCTCAGATTGAGGAAACAATGG
AAGAGCTTGAAATAACTGTGAATGTCCCAGATGTAGGATGCATAGCTGTTGTTGAACATGAGCTACCAAACACAGATGTGACTACTGAAG
AAATGAAACAAGAAGAAAATTTGAGTGTACCGTTTGAAGGATATGGAGTAATAGTACTAAATCCCAATGAAAACTATATTGAAGTAGAAA
AGCCGAAGATACACGTACAGTCATCATCTGATAGTTCAGATGAACCAGCAGAAAAACGGGAAAGAAAAGATAAAGTTTCTAAAGAAACAA
AGAAGCGACGTGATTTCTATGAGAAGTATCGTAACCCCCAAAGAGAAAAAGAAATGATGCAATTGTATATCAGAGAAAATGGTTCTCCTG
AAGAACATGCAATCTATGTTTGGGATCATTTCATAGCTCAGGCTGCTGCTGAGAATGTGTTTTTCGTTGCTCACAGCTATGGAGGACTTG
CTTTTGTTGAACTGATGATTCAACGAGAAGCCGATGTAAAAAATAAGGTAACTGCTGTGGCATTGACAGACTCTGTTCACAATGTGTGGC
ATCAAGAAGCTGGCAAAACGATTCGAGAATGGATGAGAGAGAACTGTTGTAATTGGGTCTCTAGCTCAGAACCATTAGACACATCAGTGG
AGTCCATGCTACCTGATTGCCCCCGGGTCTCAGCAGGCACCGACCGTCACGAGCTAACTTCCTGGAAGAGCTTTCCGTCTATTTTCAAAT
TCTTTACCGAAGCCTCAGAGGCCAAGACCAGCTCCCTGAAGCCGGCTGTGACGCGCCGCTCCCACCGCATCAAGCACGAAGAGCTGTAAG

>In-frame_BDP1_ENST00000380675_chr5_70828254_+_FAM172A_ENST00000395965_chr5_93217394_-_9757nt
AGTTGCGGCGTCCTGTGAGCGCGGGGATGCTGGGAGGAGGGTGAAATTTAGCCATCGGTGTGTGGCAGGGTCATGAAAAAGCGGCGGCGG
CGGGAGAGAGGAGGAGGCGGCGGCGGGGCAGTGAAACTACGGTAGCTGCCCCCTGAGCTGGTGGTGTGGCTTTGTGGGGAGGGCGTAGTT
CCTAATCCCCTTTCCGGGCAGCCGCCGGGGCTCGGGGCTGTGAGCGGCCGTGAGGCTGCCTCCCCGGGCCCCCTGCCTCCGCCATGTTCC
GCAGGGCACGCCTTAGCGTGAAGCCGAATGTCAGGCCTGGTGTAGGCGCCAGGGGCTCCACAGCTTCCAATCCCCAGCGTGGACGGGAGT
CTCCCAGGCCGCCGGATCCTGCCACGGACTCTGCTTCCAAGCCCGCGGAGCCCACAGATGTGCCCACAGTCGATTTCGGTGGAGCGGAGC
CCCAAGAAAAGGCTCCTAGGAGCAGTACTGAAAAGACTGGTGGTGACAATGATGTTGAAGAATCCAGTAGATCTTCCTCTACTGTTTCAC
AGAGAAGAAAGCGAATATCAAGTACTTCTAGCCTGGTTAAGTCTAGTGTCAGTGTTCCTTCAGAATCTCATCCCTTATCTACAATTAATC
AAGAGGCTCCACAGCCAACTGCCACTTCAACAAAAGAGAAACAGCCATGCTCAGACAGATACCGAATATACAAAGCCCAGAAACTGAGGG
AAATGTTAAAAGAAGAATTGAGAAAAGAGAAGAAACAATGGAAAAACAAATATGCTATAAATGAAAGTCAGAGGCCACCAGATCGTTCAA
AAATGACTATGAGAGACTTCATATATTATCTACCAGATAATAATCCAATGACTTCTTCACTGGAACAAGAAAAGAAAACTGAAAAGCCAT
CGACTCCAGTCCAGACAAGAGAGCAAGAAGGTAAGAGTACTCCTAATGCTGAAGATAATGAAATGGAAGAAGAGACAGATGATGGGCCAT
TACTGGTTCCTCGAGTAAAAGTGGCAGAAGATGGTTCCATTATTTTGGATGAAGAAAGTTTAACTGTAGAAGTTTTAAGAACAAAAGGCC
CTTGTGTTGTTGAAGAAAATGACCCCATATTTGAGCGCGGTTCTACAACTACATACTCCAGCTTTAGGAAAAACTATTACTCTAAACCAT
GGTCAAATAAAGAAACAGATATGTTTTTTTTAGCCATCAGCATGGTAGGAACTGACTTTTCTATGATCGGACAACTTTTTCCTCACAGAG
CAAGGATAGAAATTAAGAATAAATTTAAACGGGAAGAGAAAACAAATGGATGGAGAATAGACAAAGCATTCCAGGAAAAGCGCCCTTTTG
ACTTCGATTTTTTTGCTCATTTGCTTCAGAAAGTTCTTGCTGAAGAAGAGAAAAGAAAACAAAAATCTGTTAAAAATCACAGTTTAAAGG
AGAAGAAATCCACCAAACCACGGAAAAATGTAAAAGTGAAAAAAGTTGCCTGTGAAGGAGTGAATAATGATCCAGATGAGTCTATGAGTT
CTAGAATTTCAGACACGGAAAGATCTCAGAAGGATGCTCAGACAGTTGAAGAAGAGTCTCTGACCTTATCAAGGGAGGATGCAGAGCAGG
TTGCATTAGAAGTAGACCTAAATCAAAAGAAAAGAAGGAGGAAGAAGCAAGATGGAGCTAATGAACTGGGAGTAAACAATCTTTTAGAAA
ATGCCACTGTTCAGGCGGGTCCTTCTAAAGGAGAAAAACACAAGAATAAATGTCAGGCTATAAGGCCTGAGCTAAAGGAAGGTGAATGCA
GTAAGGAGCAGATGCTTTCCTGCACACAAAACATAGATGGCATTGTGGGTTTTGCCTCCACTGAAAAAGTTGAGAAAAGAACTGACCCCA
TCCTTTCATTAAGTAATCAACAAGATGCCACATCAGTAGCAACTGAGTCTTCAGAATCAAGCACTTCAGATTTGCCTTCATTCGAAGTTG
GAATTAGAGCATTGTGTGAGGTGAATAATGCTGAGGGTAGTTGTATAGAAGAAAGAAATGTTGACCTAAAAAATAATTCACTGGAAATTG
ATCAAACAGAAAATGTTAAACCAATGTTGAGAGGTCGCTTCCAAAGACCTAAACCCAATTTGTCAAGGGCTGGGAAGAAATCAGTTCTTT
CACAAGGCAAAACAGAGTCAGAGAGCAAGAATTCACATTCAAAAACTTCAGTTGAAAAGAACCACGTGGAAAAAGATAAAATGAATACAT
TGGACATTTTGAGAATGGAGACTACAGAGAGAGAGAATCCAGAAGCTGAAACTGTATCTGTTTTGGGTGAAAAAAATTGTCTGCAGGAAG
GGAGTCAACTAAAGGCTTTAAGACCTGTACAAGTGAGGGGCCGATTGCAAAAGCCAAAGCCAAATGCAGGTAAAGCTGCTGAAAGAAAAG
AAATTCTCATATCACAGGAAGAAATTGGGGCCAATGTAGAGAAGAATGAAAATGAATCCTGTGCTGATAGAGATACTCCTCAACACATGG
AAGATCAATCGCGTAAAGATTTTGAAGAGGAAGATGTCATATTACAGCCTGAGAAAAATGATTCTTTTCAAAATGTGCAGCCAGATGAGC
CCAAGGTTCTTAATGAATGTCTAAGCGTTCAAGAGAATAATAAGGCAAATAAACTTAACCAAGTCCCAATTCTAAGGACTCGATTTCAGA
AACCAAAGCCAAATATAGGAAGAGGAACTGGAAGGAGAGAAATTTCCTCAAAGGAAGAGGTACTAGAGAAGATTCTTGTCTCTGGGGAAA
TGGCGGCAGCATTGAGAGAAACTGTAAGACTAGACACCTCACCAAAGGAGATGGTACCAGCAGAGATTAATACTAAAGAAATGCAGTCAG
ATTTAAAAGAAACTGGAAGAAGAGCCATTTCTCCCAGGGAGAAGATTCTAGATGTGATTGATGACACCATAGAAATGGAGACAGGTCTGA
AAGCAATGGGAAGAGAGATTTGTCTAAGGGAGAAGACGCCAGAGGTGATTGATGCCACTGAGGAAATAGACAAAGATTTGGAAGAAGCTG
GAAGAAGAGAAATATCCCCACAGAAAAATGGCCCAGAGGAGGTTAAGCCTCTAGGTGAAGTGGAGACAGATTTGAAAGCAACTGGAAATG
AGAGTTCCCCAAGGGAGAAGACACCAGAGGTGACTGATGCCACTGAGGAAATAGACAAAAATTTGGAAGAAACTGGAAGAAGAAAAATAT
CCCCAAGGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGATTTGAACGCAACTGGAAGAGAGAGTTCTCCAAGGG
AGAAGACACCAGAGGTGATTGATGCTACTGAGGAAATAGATTTGGAAGAAACTGAAAGAGAAGTATCCCCACAGGAAAATGGACTAGAGG
AGGTCAAGCCTCTAGGTGAAATGGAGACGGATTTGAAAGCAACTGGAAGAGACAGTTTCCCAAGGGGGAAGACACCAGAGGTGATTGATG
CCATTGAGGAAATAGAGATAGATTTGGAAGAAACTGAAAGAGAAATATCCCCACAGGAAAATGGCCTAGAGGAGGTTAAGCCTCTAGGTG
AAATGCAAACAGATTTGAAAGCAACCGGAAGGGAGATTTCCCCAAGGGAGAAGACACCAGAGGTGATTGATGCCACTGAGGAAATAGACA
AAGATCTGGAAGAAACTGGAAGAAGAGAAATATCCCCAGAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGACT
TGAAAACAACTGGAAGAGAGGGTTCCTCAAGGGAGAAGACACGAGAGGTGATTGATGCTGCTGAGGTAATAGAGACAGATTTGGAAGAAA
CTGAAAGAGAAATATCGCCACAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGGTAAAATGGAGACAGATTTGAAAGAAATTAGAGAAG
AAATTTCCCAAAGGGAAAAGGTGCTAGCAGAGTTCAGTGCTATAAGGGAAAAGGAGATTGATTTGAAAGAAACTGGAAAAAGAGACATTC
CCATCATGGAGAAAGTATCAGGAAAGATGGCTGTTGTTGAAGAAATGGAGGCAGATTTGAAAGAAACTGGAAAAGAAAATTTTAGAGAGA
GAGGATCTGAAGAGATCTGTGTTACTGAGGAAAAGGTGGCAGAATTGAAACAAACTGGAAAAACAGACATTTCTCCAAGGGAAAACGAGC
TAGAGGAGACCAGTACCTCAAGACAAACTGACACACATTTAATGCAGAGCGGTAGCAATGACTTCAGTGCTGTGCCTTCACTAGATATTC
AGAACATTAGCAGTGAAGTACTGTCGATGATGCATACACCTGTAGAAGAAAAAAGAAATTCTGAAAAAGAAGTATCAAGTCACTTCAGTC
ATTTCAAGATTTCTTCACAGACTCATGAATCTGATAAAACAGAAGTCCAGGGGATTCAATCTCCAGATGTTCCAGAGCAGTTTTCAGATA
TTAATTTAAGCAAATCTCTTCCTCAAGAACAGAAGCCACTTGAAATTAAACCAGCACCTTTTGTGAGGAGCCGATTCAAAAGACCAAAAC
CAAACTTAGCAAGAGCAGCTTTGAAGAGAGAGACTACAGAATCAGAAAAATATATATATGAGAAGAAATCAGAAACCAAGAAAATGGAGA
CTATTGTGATGCAAGAAAATAATGAACAAACTGATACTCTCCCTTCTCAACATGATGAAGCTTCCCTAATGATATCAAGAGAAAAAGACA
CATTAGGTCACAGGAATGAGGAGGCTGTGATATTGCCATGTACACAGACTGAAAGGAACCTTTCACCTTCAAATTCTTGTGAACCTAAAG
AGGAGTCTCAGTCAGCACCAGTCCAGAAAAATGACTCAGTTGTTTCTGTGGGGACTAATAATGTAAACACTTTCCAGCAAGAAATGAAGG
AAAGTGTTATCCAAACTGCTCGACAAGTAAGGGGCCGACTTCAGAGACCGAGACCAAATATAAGAAAGACAGGACAGAGGCAAATAGTAG
ACAAAGGTGAAGCCAAAGGCATAATTAAGGAAGGAAGAACGATATTACCAAAAGATGAAACTGAAAAGAAAGTCTTAACTGTGTCAAATT
CTCAAATTGAAACTGAAATTGAAGTTCCATCGTCCGCAGTTCCAGAACACAGAATGTATGAAAATCAAAGTCAGGTGGTTCTTGTAGAAA
ACCTTCATGTTAACAAAACAAATGAAACAATCAGACATGAAAATAAACCGTATGTTCCTAGTTCAGCACAAATGACAAGAAGGAAATTCC
AAAAGGCTAAGCCAAATTTGGGAAGAGCACACAGTAAGAAAGAGGAACCAGTTTTAGAAAAAGTCACAACAGATCAGAGCAAGGAAGGCA
AGCCAGAAGATCATTTGCTGCAGAAAGGAGCTTCCAACACCCAGCTCCTTCTAAAAGAAAAAGCTGAGCTTCTGACATCTCTGGAGGTTT
CAGCAAGAAAAGATTGTGTAGGTTCCAAAGAGTCTGCTTTGGCAAAAATAGATGCGGAATTAGAAGAAGTTGGACCATCAAGAAGGGTTG
GAGAGGAAACTGTAGGAGATAATTCACCATCTTCAGTTGTTGAAGAGCAATATCTCAATAAACTAACAAGCTGTCCACAACCGTTAAACG
AAACAAGTTACTCTAAAATTGCCCTGGATGGGAAAACAACTATCTCTTCTACATCTGAGTATGAGAGAAATCGTGGTGAAAGGAGAAGTC
ATAAAAAGTTCAAACCAAATGTCACCAGAGGTCGTGGATCAAAACGAGTTCGGGGTAAGACCTCTAAGAAGGAACCTAGAGCTTCCAAGG
CCATGCTGGTGACTCTTCGGGCTTCCCAGGAAGAAGATGATGATGCTGACGATTTTGAGTCTGACTATGAGGAAGAAAGCTATCATCTTG
CTCCCGAAGAAGTAAACAAAGCTCCAGTATTTGTACCTGTTGGTCTCAGATCTCCTGAACCTGTTTCTGCTCAGATTGAGGAAACAATGG
AAGAGCTTGAAATAACTGTGAATGTCCCAGATGTAGGATGCATAGCTGTTGTTGAACATGAGCTACCAAACACAGATGTGACTACTGAAG
AAATGAAACAAGAAGAAAATTTGAGTGTACCGTTTGAAGGATATGGAGTAATAGTACTAAATCCCAATGAAAACTATATTGAAGTAGAAA
AGCCGAAGATACACGTACAGTCATCATCTGATAGTTCAGATGAACCAGCAGAAAAACGGGAAAGAAAAGATAAAGTTTCTAAAGAAACAA
AGAAGCGACGTGATTTCTATGAGAAGTATCGTAACCCCCAAAGAGAAAAAGAAATGATGCAATTGTATATCAGAGAAAATGGTTCTCCTG
AAGAACATGCAATCTATGTTTGGGATCATTTCATAGCTCAGGCTGCTGCTGAGAATGTGTTTTTCGTTGCTCACAGCTATGGAGGACTTG
CTTTTGTTGAACTGATGATTCAACGAGAAGCCGATGTAAAAAATAAGGTAACTGCTGTGGCATTGACAGACTCTGTTCACAATGTGTGGC
ATCAAGAAGCTGGCAAAACGATTCGAGAATGGATGAGAGAGAACTGTTGTAATTGGGTCTCTAGCTCAGAACCATTAGACACATCAGTGG
AGTCCATGCTACCTGATTGCCCCCGGGTCTCAGCAGGCACCGACCGTCACGAGCTAACTTCCTGGAAGAGCTTTCCGTCTATTTTCAAAT
TCTTTACCGAAGCCTCAGAGGCCAAGACCAGCTCCCTGAAGCCGGCTGTGACGCGCCGCTCCCACCGCATCAAGCACGAAGAGCTGTAAG
AGGAGCGAGCGCGACGGGGGAGGCCGCCCTGGCGCACCCACCCGCACGCCTCCTCACTGCTTGTGTCGAGCGGACTCCCAGCCCCTCATT
AGATTGTTTTCTTCCCAGAGCCCAGGGTCGTGATATATACATCTAAATAGCGTTTTGCATTATTTCTAGATGAGTGCAACTGTCAAAGCA
ATATGGGTTCACTGGTCGTGCTTCCTGCGGGCTGAGCGCGGGCTGAGCGCTGCCAGTCAGCGCTCACATTAAGGCTGACAGCGCCCTGCC
TGGCTCGGCCGGCGAAGCTCTAATTGCCCTGAAGGAGACCGCGCGGGCGCTGCGGGTCCGGCGGCGTCGGCGCGGTCCTAGCGCCCGCCG
TAGCGGAGCCGCTGCTGCTTCCCCCTCCTTAATCATGTCCATCTTTCCCCGCTCTCAACTGGAGCAAACTTCTATTCCAGACTTCAGATT
TCCATTTTCACTAGGTTTTTCCCTGAGGGCATCTTATTACCCACCTCTTTTTTTTTTTTTTTAAGGAAGTTCCACACACACTCCAAAGCC
GATTTCAAATTCAGAACCTGAATGCCATGATGTACCATGTAGTTTGGGGAATGCAAATTGTTCTCTCCCTGTTTTCATTTCGGGACCAGA
AAAAAAAACAACTCTGCATAAAAATCTATAAAGTACTGAATCCGCATTACTGCTGAAAATCCTTTTGCCAGCTAATTGTGAGAGTTTACA
CAAGTCTCTGATTTCAGAAGAGACTGTTAAAACCAAAACAATGATGGGCAGCTCTTTTAAGTGTAGGTGTGAAGGTCCCATTTTCAATGG
AATTTCCAACTGTTATCACTGGGATTGACTTTACTTTTTAAACACATAATGTGTACTGTGTGGCATTGTAATTTAGATATAACACACTTA
AGTTTTGCTTTTTAAATCTCTCTGTGGAGAAAGGTTGTTGTTAATCCTTTCCAGAATGATCTATTCTGAGCTTTCCTGGAGTTAGGCCCT
TCTAGGGAGAGAATTTTTTTATTGTCATCAGGAAACGAAACCTTTGTGCTCTGCAGCCTTTTTCTTCTGAAAGGCTAAGTGGGGCTAAAA
TTATCCTTTTAGTTTTCTGCTTTAACAAGAAGAGAAGGACTTGGTGTGAAAGAATTTCTTCTCTCAGTCCAATGGTATAATTTTTAGCAC
TCCGCTTCCTCTGTAGGGTTTAGCCCTACAGTTTGAACAATTATTTTAATCCAGCTAAGATGTGGCCAACACTGTGAAATACAGGAGATG
TTAAGGTTTTGCTGACTTTTAGATTAAAATCTTAAAATTTCACATTATATTTTAATTACTTGAAAAGTTTAATTACCTAGTAAAGATTGT
TTCTAATAGATGAGAACATAAATTTAATAGTTTTCATCCTTTTTTAAAGTGTGTGCAACAATTAATATGCCTGCCTTATTTGAGGACATG
ATAAAATGTACCCAAAATGACTTCGAACTGTCTAATGCCTCAGAAAAGTAACTTAAAATCAACCACTTCGTGCTTAAATGTTTTTATATT
ATGAACCGATTTCAACAAGTTTTAAAGCTGTTAATATCTCATTGCTGTGTTTGACATACAAGTACATTCATTGGTTCTATAGTCTTAATG
ATGACAAATTAAAGATGTTTTTTCAGTGCTCAGGTATGCATATATTTTCGTGTTACTTAAGCAAAATCAACTATATAGGAGGAAAAATCA
AAATGGCATTTTATTCAGCTACCAGATGGCTTAAAATGAGTAAACCCCAACAACATCAAGCACATTTGTCTGTGATATTGACCCTTTTTA
TCCAATCATTACTATTTTAGAAGTAGTGGTGAACTGTGTAAAATAATGGTATCTTCAGCAGTGTTCCGGAATCTTAGTTGAGGGACAAAC
ATTCCTTCCAGTGAGAGATTCAAGAATTGATGTGAATTGAATATATTTTTCAAGGTATTATAAATTGTGTTGTGTTTTCAGTATAAGAAA
ATGTTGACAGGAAACAATTTTATAGCATTTATAAAAAACCAACACTTGTGCAATGCTAAATTGGCGAAGCTTCTGCACCTGAATTAGAGC
ACAATAAATATGCTGTTTATAAACCAAATCACTGCTATTCCTTCTCTGAAATCATCTCTCCTCTTTTTAAACCTTTACTTATAGCTAGAA
TAAATCACTATTTAATTGCCTCTAATACTTTAAAACTACTGGATGGTTAGGCCTGGTTTAACTATTTATGGAGAGCTATTTGCAAACTTA
AGTTGTGTAAATGTAATTTCTACTTGTGAATCTGAGCTGTAGCAGCCCAGAGGGAGCTAGGCAAACTATTCCAGACCACCAACTGATAAG
TGATCAGATTCTTTGTAATGTAGGATTTTTTAACCTGTTGATTATGGGTTTGTTGATATAAATGTAATAATGTTCACCTCGATTTTCCTG
GAGTAACAACCAGCGTTGGTAGTAGCCCACCTGCATGAGGACGGCCAGTGTTAACAATATTTTTGTTCTGATCTTCTTCCCCATTTTTGT
TTCCTCAAACAGGTTTTTAGGAGAGTGGAGATTTAAAGTCAGGATGTGGCCTTTTTATTTTAATTATATACTTAATTCTTAGAACAAGTA
GAATGGGAAAGGAGTGACTGATAAATCTAAGATTCAAAATAGTCCCGTCGAAACTTAAAGGCCAGATTATTGCTTTGGAGCTTTCTATAG
GTACTAGCCATCCCGTCGTTAAATGTTTTCATGGATATTTGAAAAGAAGACCATGTACCTTTAATAACTGTTCTTTTCTCGAGTTTCTGC
CTCGTGCTTTGACCTGGATTGCATTATTATTGTTTATGCGAAGTAAAAAAAAAAAAGGAAAGCACAAGCTTTTCCTGTATATTATATTTC

>In-frame_BDP1_ENST00000380675_chr5_70828254_+_FAM172A_ENST00000505869_chr5_93217394_-_7135nt
AGTTGCGGCGTCCTGTGAGCGCGGGGATGCTGGGAGGAGGGTGAAATTTAGCCATCGGTGTGTGGCAGGGTCATGAAAAAGCGGCGGCGG
CGGGAGAGAGGAGGAGGCGGCGGCGGGGCAGTGAAACTACGGTAGCTGCCCCCTGAGCTGGTGGTGTGGCTTTGTGGGGAGGGCGTAGTT
CCTAATCCCCTTTCCGGGCAGCCGCCGGGGCTCGGGGCTGTGAGCGGCCGTGAGGCTGCCTCCCCGGGCCCCCTGCCTCCGCCATGTTCC
GCAGGGCACGCCTTAGCGTGAAGCCGAATGTCAGGCCTGGTGTAGGCGCCAGGGGCTCCACAGCTTCCAATCCCCAGCGTGGACGGGAGT
CTCCCAGGCCGCCGGATCCTGCCACGGACTCTGCTTCCAAGCCCGCGGAGCCCACAGATGTGCCCACAGTCGATTTCGGTGGAGCGGAGC
CCCAAGAAAAGGCTCCTAGGAGCAGTACTGAAAAGACTGGTGGTGACAATGATGTTGAAGAATCCAGTAGATCTTCCTCTACTGTTTCAC
AGAGAAGAAAGCGAATATCAAGTACTTCTAGCCTGGTTAAGTCTAGTGTCAGTGTTCCTTCAGAATCTCATCCCTTATCTACAATTAATC
AAGAGGCTCCACAGCCAACTGCCACTTCAACAAAAGAGAAACAGCCATGCTCAGACAGATACCGAATATACAAAGCCCAGAAACTGAGGG
AAATGTTAAAAGAAGAATTGAGAAAAGAGAAGAAACAATGGAAAAACAAATATGCTATAAATGAAAGTCAGAGGCCACCAGATCGTTCAA
AAATGACTATGAGAGACTTCATATATTATCTACCAGATAATAATCCAATGACTTCTTCACTGGAACAAGAAAAGAAAACTGAAAAGCCAT
CGACTCCAGTCCAGACAAGAGAGCAAGAAGGTAAGAGTACTCCTAATGCTGAAGATAATGAAATGGAAGAAGAGACAGATGATGGGCCAT
TACTGGTTCCTCGAGTAAAAGTGGCAGAAGATGGTTCCATTATTTTGGATGAAGAAAGTTTAACTGTAGAAGTTTTAAGAACAAAAGGCC
CTTGTGTTGTTGAAGAAAATGACCCCATATTTGAGCGCGGTTCTACAACTACATACTCCAGCTTTAGGAAAAACTATTACTCTAAACCAT
GGTCAAATAAAGAAACAGATATGTTTTTTTTAGCCATCAGCATGGTAGGAACTGACTTTTCTATGATCGGACAACTTTTTCCTCACAGAG
CAAGGATAGAAATTAAGAATAAATTTAAACGGGAAGAGAAAACAAATGGATGGAGAATAGACAAAGCATTCCAGGAAAAGCGCCCTTTTG
ACTTCGATTTTTTTGCTCATTTGCTTCAGAAAGTTCTTGCTGAAGAAGAGAAAAGAAAACAAAAATCTGTTAAAAATCACAGTTTAAAGG
AGAAGAAATCCACCAAACCACGGAAAAATGTAAAAGTGAAAAAAGTTGCCTGTGAAGGAGTGAATAATGATCCAGATGAGTCTATGAGTT
CTAGAATTTCAGACACGGAAAGATCTCAGAAGGATGCTCAGACAGTTGAAGAAGAGTCTCTGACCTTATCAAGGGAGGATGCAGAGCAGG
TTGCATTAGAAGTAGACCTAAATCAAAAGAAAAGAAGGAGGAAGAAGCAAGATGGAGCTAATGAACTGGGAGTAAACAATCTTTTAGAAA
ATGCCACTGTTCAGGCGGGTCCTTCTAAAGGAGAAAAACACAAGAATAAATGTCAGGCTATAAGGCCTGAGCTAAAGGAAGGTGAATGCA
GTAAGGAGCAGATGCTTTCCTGCACACAAAACATAGATGGCATTGTGGGTTTTGCCTCCACTGAAAAAGTTGAGAAAAGAACTGACCCCA
TCCTTTCATTAAGTAATCAACAAGATGCCACATCAGTAGCAACTGAGTCTTCAGAATCAAGCACTTCAGATTTGCCTTCATTCGAAGTTG
GAATTAGAGCATTGTGTGAGGTGAATAATGCTGAGGGTAGTTGTATAGAAGAAAGAAATGTTGACCTAAAAAATAATTCACTGGAAATTG
ATCAAACAGAAAATGTTAAACCAATGTTGAGAGGTCGCTTCCAAAGACCTAAACCCAATTTGTCAAGGGCTGGGAAGAAATCAGTTCTTT
CACAAGGCAAAACAGAGTCAGAGAGCAAGAATTCACATTCAAAAACTTCAGTTGAAAAGAACCACGTGGAAAAAGATAAAATGAATACAT
TGGACATTTTGAGAATGGAGACTACAGAGAGAGAGAATCCAGAAGCTGAAACTGTATCTGTTTTGGGTGAAAAAAATTGTCTGCAGGAAG
GGAGTCAACTAAAGGCTTTAAGACCTGTACAAGTGAGGGGCCGATTGCAAAAGCCAAAGCCAAATGCAGGTAAAGCTGCTGAAAGAAAAG
AAATTCTCATATCACAGGAAGAAATTGGGGCCAATGTAGAGAAGAATGAAAATGAATCCTGTGCTGATAGAGATACTCCTCAACACATGG
AAGATCAATCGCGTAAAGATTTTGAAGAGGAAGATGTCATATTACAGCCTGAGAAAAATGATTCTTTTCAAAATGTGCAGCCAGATGAGC
CCAAGGTTCTTAATGAATGTCTAAGCGTTCAAGAGAATAATAAGGCAAATAAACTTAACCAAGTCCCAATTCTAAGGACTCGATTTCAGA
AACCAAAGCCAAATATAGGAAGAGGAACTGGAAGGAGAGAAATTTCCTCAAAGGAAGAGGTACTAGAGAAGATTCTTGTCTCTGGGGAAA
TGGCGGCAGCATTGAGAGAAACTGTAAGACTAGACACCTCACCAAAGGAGATGGTACCAGCAGAGATTAATACTAAAGAAATGCAGTCAG
ATTTAAAAGAAACTGGAAGAAGAGCCATTTCTCCCAGGGAGAAGATTCTAGATGTGATTGATGACACCATAGAAATGGAGACAGGTCTGA
AAGCAATGGGAAGAGAGATTTGTCTAAGGGAGAAGACGCCAGAGGTGATTGATGCCACTGAGGAAATAGACAAAGATTTGGAAGAAGCTG
GAAGAAGAGAAATATCCCCACAGAAAAATGGCCCAGAGGAGGTTAAGCCTCTAGGTGAAGTGGAGACAGATTTGAAAGCAACTGGAAATG
AGAGTTCCCCAAGGGAGAAGACACCAGAGGTGACTGATGCCACTGAGGAAATAGACAAAAATTTGGAAGAAACTGGAAGAAGAAAAATAT
CCCCAAGGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGATTTGAACGCAACTGGAAGAGAGAGTTCTCCAAGGG
AGAAGACACCAGAGGTGATTGATGCTACTGAGGAAATAGATTTGGAAGAAACTGAAAGAGAAGTATCCCCACAGGAAAATGGACTAGAGG
AGGTCAAGCCTCTAGGTGAAATGGAGACGGATTTGAAAGCAACTGGAAGAGACAGTTTCCCAAGGGGGAAGACACCAGAGGTGATTGATG
CCATTGAGGAAATAGAGATAGATTTGGAAGAAACTGAAAGAGAAATATCCCCACAGGAAAATGGCCTAGAGGAGGTTAAGCCTCTAGGTG
AAATGCAAACAGATTTGAAAGCAACCGGAAGGGAGATTTCCCCAAGGGAGAAGACACCAGAGGTGATTGATGCCACTGAGGAAATAGACA
AAGATCTGGAAGAAACTGGAAGAAGAGAAATATCCCCAGAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGACT
TGAAAACAACTGGAAGAGAGGGTTCCTCAAGGGAGAAGACACGAGAGGTGATTGATGCTGCTGAGGTAATAGAGACAGATTTGGAAGAAA
CTGAAAGAGAAATATCGCCACAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGGTAAAATGGAGACAGATTTGAAAGAAATTAGAGAAG
AAATTTCCCAAAGGGAAAAGGTGCTAGCAGAGTTCAGTGCTATAAGGGAAAAGGAGATTGATTTGAAAGAAACTGGAAAAAGAGACATTC
CCATCATGGAGAAAGTATCAGGAAAGATGGCTGTTGTTGAAGAAATGGAGGCAGATTTGAAAGAAACTGGAAAAGAAAATTTTAGAGAGA
GAGGATCTGAAGAGATCTGTGTTACTGAGGAAAAGGTGGCAGAATTGAAACAAACTGGAAAAACAGACATTTCTCCAAGGGAAAACGAGC
TAGAGGAGACCAGTACCTCAAGACAAACTGACACACATTTAATGCAGAGCGGTAGCAATGACTTCAGTGCTGTGCCTTCACTAGATATTC
AGAACATTAGCAGTGAAGTACTGTCGATGATGCATACACCTGTAGAAGAAAAAAGAAATTCTGAAAAAGAAGTATCAAGTCACTTCAGTC
ATTTCAAGATTTCTTCACAGACTCATGAATCTGATAAAACAGAAGTCCAGGGGATTCAATCTCCAGATGTTCCAGAGCAGTTTTCAGATA
TTAATTTAAGCAAATCTCTTCCTCAAGAACAGAAGCCACTTGAAATTAAACCAGCACCTTTTGTGAGGAGCCGATTCAAAAGACCAAAAC
CAAACTTAGCAAGAGCAGCTTTGAAGAGAGAGACTACAGAATCAGAAAAATATATATATGAGAAGAAATCAGAAACCAAGAAAATGGAGA
CTATTGTGATGCAAGAAAATAATGAACAAACTGATACTCTCCCTTCTCAACATGATGAAGCTTCCCTAATGATATCAAGAGAAAAAGACA
CATTAGGTCACAGGAATGAGGAGGCTGTGATATTGCCATGTACACAGACTGAAAGGAACCTTTCACCTTCAAATTCTTGTGAACCTAAAG
AGGAGTCTCAGTCAGCACCAGTCCAGAAAAATGACTCAGTTGTTTCTGTGGGGACTAATAATGTAAACACTTTCCAGCAAGAAATGAAGG
AAAGTGTTATCCAAACTGCTCGACAAGTAAGGGGCCGACTTCAGAGACCGAGACCAAATATAAGAAAGACAGGACAGAGGCAAATAGTAG
ACAAAGGTGAAGCCAAAGGCATAATTAAGGAAGGAAGAACGATATTACCAAAAGATGAAACTGAAAAGAAAGTCTTAACTGTGTCAAATT
CTCAAATTGAAACTGAAATTGAAGTTCCATCGTCCGCAGTTCCAGAACACAGAATGTATGAAAATCAAAGTCAGGTGGTTCTTGTAGAAA
ACCTTCATGTTAACAAAACAAATGAAACAATCAGACATGAAAATAAACCGTATGTTCCTAGTTCAGCACAAATGACAAGAAGGAAATTCC
AAAAGGCTAAGCCAAATTTGGGAAGAGCACACAGTAAGAAAGAGGAACCAGTTTTAGAAAAAGTCACAACAGATCAGAGCAAGGAAGGCA
AGCCAGAAGATCATTTGCTGCAGAAAGGAGCTTCCAACACCCAGCTCCTTCTAAAAGAAAAAGCTGAGCTTCTGACATCTCTGGAGGTTT
CAGCAAGAAAAGATTGTGTAGGTTCCAAAGAGTCTGCTTTGGCAAAAATAGATGCGGAATTAGAAGAAGTTGGACCATCAAGAAGGGTTG
GAGAGGAAACTGTAGGAGATAATTCACCATCTTCAGTTGTTGAAGAGCAATATCTCAATAAACTAACAAGCTGTCCACAACCGTTAAACG
AAACAAGTTACTCTAAAATTGCCCTGGATGGGAAAACAACTATCTCTTCTACATCTGAGTATGAGAGAAATCGTGGTGAAAGGAGAAGTC
ATAAAAAGTTCAAACCAAATGTCACCAGAGGTCGTGGATCAAAACGAGTTCGGGGTAAGACCTCTAAGAAGGAACCTAGAGCTTCCAAGG
CCATGCTGGTGACTCTTCGGGCTTCCCAGGAAGAAGATGATGATGCTGACGATTTTGAGTCTGACTATGAGGAAGAAAGCTATCATCTTG
CTCCCGAAGAAGTAAACAAAGCTCCAGTATTTGTACCTGTTGGTCTCAGATCTCCTGAACCTGTTTCTGCTCAGATTGAGGAAACAATGG
AAGAGCTTGAAATAACTGTGAATGTCCCAGATGTAGGATGCATAGCTGTTGTTGAACATGAGCTACCAAACACAGATGTGACTACTGAAG
AAATGAAACAAGAAGAAAATTTGAGTGTACCGTTTGAAGGATATGGAGTAATAGTACTAAATCCCAATGAAAACTATATTGAAGTAGAAA
AGCCGAAGATACACGTACAGTCATCATCTGATAGTTCAGATGAACCAGCAGAAAAACGGGAAAGAAAAGATAAAGTTTCTAAAGAAACAA
AGAAGCGACGTGATTTCTATGAGAAGTATCGTAACCCCCAAAGAGAAAAAGAAATGATGCAATTGTATATCAGAGAAAATGGTTCTCCTG
AAGAACATGCAATCTATGTTTGGGATCATTTCATAGCTCAGGCTGCTGCTGAGAATGTGTTTTTCGTTGCTCACAGCTATGGAGGACTTG
CTTTTGTTGAACTGATGATTCAACGAGAAGCCGATGTAAAAAATAAGGTAACTGCTGTGGCATTGACAGACTCTGTTCACAATGTGTGGC
ATCAAGAAGCTGGCAAAACGATTCGAGAATGGATGAGAGAGAACTGTTGTAATTGGGTCTCTAGCTCAGAACCATTAGACACATCAGTGG
AGTCCATGCTACCTGATTGCCCCCGGGTCTCAGCAGGCACCGACCGTCACGAGCTAACTTCCTGGAAGAGCTTTCCGTCTATTTTCAAAT
TCTTTACCGAAGCCTCAGAGGCCAAGACCAGCTCCCTGAAGCCGGCTGTGACGCGCCGCTCCCACCGCATCAAGCACGAAGAGCTGTAAG
AGGAGCGAGCGCGACGGGGGAGGCCGCCCTGGCGCACCCACCCGCACGCCTCCTCACTGCTTGTGTCGAGCGGACTCCCAGCCCCTCATT
AGATTGTTTTCTTCCCAGAGCCCAGGGTCGTGATATATACATCTAAATAGCGTTTTGCATTATTTCTAGATGAGTGCAACTGTCAAAGCA
ATATGGGTTCACTGGTCGTGCTTCCTGCGGGCTGAGCGCGGGCTGAGCGCTGCCAGTCAGCGCTCACATTAAGGCTGACAGCGCCCTGCC

>In-frame_BDP1_ENST00000380675_chr5_70828254_+_FAM172A_ENST00000509739_chr5_93217394_-_6943nt
AGTTGCGGCGTCCTGTGAGCGCGGGGATGCTGGGAGGAGGGTGAAATTTAGCCATCGGTGTGTGGCAGGGTCATGAAAAAGCGGCGGCGG
CGGGAGAGAGGAGGAGGCGGCGGCGGGGCAGTGAAACTACGGTAGCTGCCCCCTGAGCTGGTGGTGTGGCTTTGTGGGGAGGGCGTAGTT
CCTAATCCCCTTTCCGGGCAGCCGCCGGGGCTCGGGGCTGTGAGCGGCCGTGAGGCTGCCTCCCCGGGCCCCCTGCCTCCGCCATGTTCC
GCAGGGCACGCCTTAGCGTGAAGCCGAATGTCAGGCCTGGTGTAGGCGCCAGGGGCTCCACAGCTTCCAATCCCCAGCGTGGACGGGAGT
CTCCCAGGCCGCCGGATCCTGCCACGGACTCTGCTTCCAAGCCCGCGGAGCCCACAGATGTGCCCACAGTCGATTTCGGTGGAGCGGAGC
CCCAAGAAAAGGCTCCTAGGAGCAGTACTGAAAAGACTGGTGGTGACAATGATGTTGAAGAATCCAGTAGATCTTCCTCTACTGTTTCAC
AGAGAAGAAAGCGAATATCAAGTACTTCTAGCCTGGTTAAGTCTAGTGTCAGTGTTCCTTCAGAATCTCATCCCTTATCTACAATTAATC
AAGAGGCTCCACAGCCAACTGCCACTTCAACAAAAGAGAAACAGCCATGCTCAGACAGATACCGAATATACAAAGCCCAGAAACTGAGGG
AAATGTTAAAAGAAGAATTGAGAAAAGAGAAGAAACAATGGAAAAACAAATATGCTATAAATGAAAGTCAGAGGCCACCAGATCGTTCAA
AAATGACTATGAGAGACTTCATATATTATCTACCAGATAATAATCCAATGACTTCTTCACTGGAACAAGAAAAGAAAACTGAAAAGCCAT
CGACTCCAGTCCAGACAAGAGAGCAAGAAGGTAAGAGTACTCCTAATGCTGAAGATAATGAAATGGAAGAAGAGACAGATGATGGGCCAT
TACTGGTTCCTCGAGTAAAAGTGGCAGAAGATGGTTCCATTATTTTGGATGAAGAAAGTTTAACTGTAGAAGTTTTAAGAACAAAAGGCC
CTTGTGTTGTTGAAGAAAATGACCCCATATTTGAGCGCGGTTCTACAACTACATACTCCAGCTTTAGGAAAAACTATTACTCTAAACCAT
GGTCAAATAAAGAAACAGATATGTTTTTTTTAGCCATCAGCATGGTAGGAACTGACTTTTCTATGATCGGACAACTTTTTCCTCACAGAG
CAAGGATAGAAATTAAGAATAAATTTAAACGGGAAGAGAAAACAAATGGATGGAGAATAGACAAAGCATTCCAGGAAAAGCGCCCTTTTG
ACTTCGATTTTTTTGCTCATTTGCTTCAGAAAGTTCTTGCTGAAGAAGAGAAAAGAAAACAAAAATCTGTTAAAAATCACAGTTTAAAGG
AGAAGAAATCCACCAAACCACGGAAAAATGTAAAAGTGAAAAAAGTTGCCTGTGAAGGAGTGAATAATGATCCAGATGAGTCTATGAGTT
CTAGAATTTCAGACACGGAAAGATCTCAGAAGGATGCTCAGACAGTTGAAGAAGAGTCTCTGACCTTATCAAGGGAGGATGCAGAGCAGG
TTGCATTAGAAGTAGACCTAAATCAAAAGAAAAGAAGGAGGAAGAAGCAAGATGGAGCTAATGAACTGGGAGTAAACAATCTTTTAGAAA
ATGCCACTGTTCAGGCGGGTCCTTCTAAAGGAGAAAAACACAAGAATAAATGTCAGGCTATAAGGCCTGAGCTAAAGGAAGGTGAATGCA
GTAAGGAGCAGATGCTTTCCTGCACACAAAACATAGATGGCATTGTGGGTTTTGCCTCCACTGAAAAAGTTGAGAAAAGAACTGACCCCA
TCCTTTCATTAAGTAATCAACAAGATGCCACATCAGTAGCAACTGAGTCTTCAGAATCAAGCACTTCAGATTTGCCTTCATTCGAAGTTG
GAATTAGAGCATTGTGTGAGGTGAATAATGCTGAGGGTAGTTGTATAGAAGAAAGAAATGTTGACCTAAAAAATAATTCACTGGAAATTG
ATCAAACAGAAAATGTTAAACCAATGTTGAGAGGTCGCTTCCAAAGACCTAAACCCAATTTGTCAAGGGCTGGGAAGAAATCAGTTCTTT
CACAAGGCAAAACAGAGTCAGAGAGCAAGAATTCACATTCAAAAACTTCAGTTGAAAAGAACCACGTGGAAAAAGATAAAATGAATACAT
TGGACATTTTGAGAATGGAGACTACAGAGAGAGAGAATCCAGAAGCTGAAACTGTATCTGTTTTGGGTGAAAAAAATTGTCTGCAGGAAG
GGAGTCAACTAAAGGCTTTAAGACCTGTACAAGTGAGGGGCCGATTGCAAAAGCCAAAGCCAAATGCAGGTAAAGCTGCTGAAAGAAAAG
AAATTCTCATATCACAGGAAGAAATTGGGGCCAATGTAGAGAAGAATGAAAATGAATCCTGTGCTGATAGAGATACTCCTCAACACATGG
AAGATCAATCGCGTAAAGATTTTGAAGAGGAAGATGTCATATTACAGCCTGAGAAAAATGATTCTTTTCAAAATGTGCAGCCAGATGAGC
CCAAGGTTCTTAATGAATGTCTAAGCGTTCAAGAGAATAATAAGGCAAATAAACTTAACCAAGTCCCAATTCTAAGGACTCGATTTCAGA
AACCAAAGCCAAATATAGGAAGAGGAACTGGAAGGAGAGAAATTTCCTCAAAGGAAGAGGTACTAGAGAAGATTCTTGTCTCTGGGGAAA
TGGCGGCAGCATTGAGAGAAACTGTAAGACTAGACACCTCACCAAAGGAGATGGTACCAGCAGAGATTAATACTAAAGAAATGCAGTCAG
ATTTAAAAGAAACTGGAAGAAGAGCCATTTCTCCCAGGGAGAAGATTCTAGATGTGATTGATGACACCATAGAAATGGAGACAGGTCTGA
AAGCAATGGGAAGAGAGATTTGTCTAAGGGAGAAGACGCCAGAGGTGATTGATGCCACTGAGGAAATAGACAAAGATTTGGAAGAAGCTG
GAAGAAGAGAAATATCCCCACAGAAAAATGGCCCAGAGGAGGTTAAGCCTCTAGGTGAAGTGGAGACAGATTTGAAAGCAACTGGAAATG
AGAGTTCCCCAAGGGAGAAGACACCAGAGGTGACTGATGCCACTGAGGAAATAGACAAAAATTTGGAAGAAACTGGAAGAAGAAAAATAT
CCCCAAGGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGATTTGAACGCAACTGGAAGAGAGAGTTCTCCAAGGG
AGAAGACACCAGAGGTGATTGATGCTACTGAGGAAATAGATTTGGAAGAAACTGAAAGAGAAGTATCCCCACAGGAAAATGGACTAGAGG
AGGTCAAGCCTCTAGGTGAAATGGAGACGGATTTGAAAGCAACTGGAAGAGACAGTTTCCCAAGGGGGAAGACACCAGAGGTGATTGATG
CCATTGAGGAAATAGAGATAGATTTGGAAGAAACTGAAAGAGAAATATCCCCACAGGAAAATGGCCTAGAGGAGGTTAAGCCTCTAGGTG
AAATGCAAACAGATTTGAAAGCAACCGGAAGGGAGATTTCCCCAAGGGAGAAGACACCAGAGGTGATTGATGCCACTGAGGAAATAGACA
AAGATCTGGAAGAAACTGGAAGAAGAGAAATATCCCCAGAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGACT
TGAAAACAACTGGAAGAGAGGGTTCCTCAAGGGAGAAGACACGAGAGGTGATTGATGCTGCTGAGGTAATAGAGACAGATTTGGAAGAAA
CTGAAAGAGAAATATCGCCACAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGGTAAAATGGAGACAGATTTGAAAGAAATTAGAGAAG
AAATTTCCCAAAGGGAAAAGGTGCTAGCAGAGTTCAGTGCTATAAGGGAAAAGGAGATTGATTTGAAAGAAACTGGAAAAAGAGACATTC
CCATCATGGAGAAAGTATCAGGAAAGATGGCTGTTGTTGAAGAAATGGAGGCAGATTTGAAAGAAACTGGAAAAGAAAATTTTAGAGAGA
GAGGATCTGAAGAGATCTGTGTTACTGAGGAAAAGGTGGCAGAATTGAAACAAACTGGAAAAACAGACATTTCTCCAAGGGAAAACGAGC
TAGAGGAGACCAGTACCTCAAGACAAACTGACACACATTTAATGCAGAGCGGTAGCAATGACTTCAGTGCTGTGCCTTCACTAGATATTC
AGAACATTAGCAGTGAAGTACTGTCGATGATGCATACACCTGTAGAAGAAAAAAGAAATTCTGAAAAAGAAGTATCAAGTCACTTCAGTC
ATTTCAAGATTTCTTCACAGACTCATGAATCTGATAAAACAGAAGTCCAGGGGATTCAATCTCCAGATGTTCCAGAGCAGTTTTCAGATA
TTAATTTAAGCAAATCTCTTCCTCAAGAACAGAAGCCACTTGAAATTAAACCAGCACCTTTTGTGAGGAGCCGATTCAAAAGACCAAAAC
CAAACTTAGCAAGAGCAGCTTTGAAGAGAGAGACTACAGAATCAGAAAAATATATATATGAGAAGAAATCAGAAACCAAGAAAATGGAGA
CTATTGTGATGCAAGAAAATAATGAACAAACTGATACTCTCCCTTCTCAACATGATGAAGCTTCCCTAATGATATCAAGAGAAAAAGACA
CATTAGGTCACAGGAATGAGGAGGCTGTGATATTGCCATGTACACAGACTGAAAGGAACCTTTCACCTTCAAATTCTTGTGAACCTAAAG
AGGAGTCTCAGTCAGCACCAGTCCAGAAAAATGACTCAGTTGTTTCTGTGGGGACTAATAATGTAAACACTTTCCAGCAAGAAATGAAGG
AAAGTGTTATCCAAACTGCTCGACAAGTAAGGGGCCGACTTCAGAGACCGAGACCAAATATAAGAAAGACAGGACAGAGGCAAATAGTAG
ACAAAGGTGAAGCCAAAGGCATAATTAAGGAAGGAAGAACGATATTACCAAAAGATGAAACTGAAAAGAAAGTCTTAACTGTGTCAAATT
CTCAAATTGAAACTGAAATTGAAGTTCCATCGTCCGCAGTTCCAGAACACAGAATGTATGAAAATCAAAGTCAGGTGGTTCTTGTAGAAA
ACCTTCATGTTAACAAAACAAATGAAACAATCAGACATGAAAATAAACCGTATGTTCCTAGTTCAGCACAAATGACAAGAAGGAAATTCC
AAAAGGCTAAGCCAAATTTGGGAAGAGCACACAGTAAGAAAGAGGAACCAGTTTTAGAAAAAGTCACAACAGATCAGAGCAAGGAAGGCA
AGCCAGAAGATCATTTGCTGCAGAAAGGAGCTTCCAACACCCAGCTCCTTCTAAAAGAAAAAGCTGAGCTTCTGACATCTCTGGAGGTTT
CAGCAAGAAAAGATTGTGTAGGTTCCAAAGAGTCTGCTTTGGCAAAAATAGATGCGGAATTAGAAGAAGTTGGACCATCAAGAAGGGTTG
GAGAGGAAACTGTAGGAGATAATTCACCATCTTCAGTTGTTGAAGAGCAATATCTCAATAAACTAACAAGCTGTCCACAACCGTTAAACG
AAACAAGTTACTCTAAAATTGCCCTGGATGGGAAAACAACTATCTCTTCTACATCTGAGTATGAGAGAAATCGTGGTGAAAGGAGAAGTC
ATAAAAAGTTCAAACCAAATGTCACCAGAGGTCGTGGATCAAAACGAGTTCGGGGTAAGACCTCTAAGAAGGAACCTAGAGCTTCCAAGG
CCATGCTGGTGACTCTTCGGGCTTCCCAGGAAGAAGATGATGATGCTGACGATTTTGAGTCTGACTATGAGGAAGAAAGCTATCATCTTG
CTCCCGAAGAAGTAAACAAAGCTCCAGTATTTGTACCTGTTGGTCTCAGATCTCCTGAACCTGTTTCTGCTCAGATTGAGGAAACAATGG
AAGAGCTTGAAATAACTGTGAATGTCCCAGATGTAGGATGCATAGCTGTTGTTGAACATGAGCTACCAAACACAGATGTGACTACTGAAG
AAATGAAACAAGAAGAAAATTTGAGTGTACCGTTTGAAGGATATGGAGTAATAGTACTAAATCCCAATGAAAACTATATTGAAGTAGAAA
AGCCGAAGATACACGTACAGTCATCATCTGATAGTTCAGATGAACCAGCAGAAAAACGGGAAAGAAAAGATAAAGTTTCTAAAGAAACAA
AGAAGCGACGTGATTTCTATGAGAAGTATCGTAACCCCCAAAGAGAAAAAGAAATGATGCAATTGTATATCAGAGAAAATGGTTCTCCTG
AAGAACATGCAATCTATGTTTGGGATCATTTCATAGCTCAGGCTGCTGCTGAGAATGTGTTTTTCGTTGCTCACAGCTATGGAGGACTTG
CTTTTGTTGAACTGATGATTCAACGAGAAGCCGATGTAAAAAATAAGGTAACTGCTGTGGCATTGACAGACTCTGTTCACAATGTGTGGC
ATCAAGAAGCTGGCAAAACGATTCGAGAATGGATGAGAGAGAACTGTTGTAATTGGGTCTCTAGCTCAGAACCATTAGACACATCAGTGG
AGTCCATGCTACCTGATTGCCCCCGGGTCTCAGCAGGCACCGACCGTCACGAGCTAACTTCCTGGAAGAGCTTTCCGTCTATTTTCAAAT
TCTTTACCGAAGCCTCAGAGGCCAAGACCAGCTCCCTGAAGCCGGCTGTGACGCGCCGCTCCCACCGCATCAAGCACGAAGAGCTGTAAG
AGGAGCGAGCGCGACGGGGGAGGCCGCCCTGGCGCACCCACCCGCACGCCTCCTCACTGCTTGTGTCGAGCGGACTCCCAGCCCCTCATT

>In-frame_BDP1_ENST00000380675_chr5_70828254_+_FAM172A_ENST00000509163_chr5_93217394_-_6897nt
AGTTGCGGCGTCCTGTGAGCGCGGGGATGCTGGGAGGAGGGTGAAATTTAGCCATCGGTGTGTGGCAGGGTCATGAAAAAGCGGCGGCGG
CGGGAGAGAGGAGGAGGCGGCGGCGGGGCAGTGAAACTACGGTAGCTGCCCCCTGAGCTGGTGGTGTGGCTTTGTGGGGAGGGCGTAGTT
CCTAATCCCCTTTCCGGGCAGCCGCCGGGGCTCGGGGCTGTGAGCGGCCGTGAGGCTGCCTCCCCGGGCCCCCTGCCTCCGCCATGTTCC
GCAGGGCACGCCTTAGCGTGAAGCCGAATGTCAGGCCTGGTGTAGGCGCCAGGGGCTCCACAGCTTCCAATCCCCAGCGTGGACGGGAGT
CTCCCAGGCCGCCGGATCCTGCCACGGACTCTGCTTCCAAGCCCGCGGAGCCCACAGATGTGCCCACAGTCGATTTCGGTGGAGCGGAGC
CCCAAGAAAAGGCTCCTAGGAGCAGTACTGAAAAGACTGGTGGTGACAATGATGTTGAAGAATCCAGTAGATCTTCCTCTACTGTTTCAC
AGAGAAGAAAGCGAATATCAAGTACTTCTAGCCTGGTTAAGTCTAGTGTCAGTGTTCCTTCAGAATCTCATCCCTTATCTACAATTAATC
AAGAGGCTCCACAGCCAACTGCCACTTCAACAAAAGAGAAACAGCCATGCTCAGACAGATACCGAATATACAAAGCCCAGAAACTGAGGG
AAATGTTAAAAGAAGAATTGAGAAAAGAGAAGAAACAATGGAAAAACAAATATGCTATAAATGAAAGTCAGAGGCCACCAGATCGTTCAA
AAATGACTATGAGAGACTTCATATATTATCTACCAGATAATAATCCAATGACTTCTTCACTGGAACAAGAAAAGAAAACTGAAAAGCCAT
CGACTCCAGTCCAGACAAGAGAGCAAGAAGGTAAGAGTACTCCTAATGCTGAAGATAATGAAATGGAAGAAGAGACAGATGATGGGCCAT
TACTGGTTCCTCGAGTAAAAGTGGCAGAAGATGGTTCCATTATTTTGGATGAAGAAAGTTTAACTGTAGAAGTTTTAAGAACAAAAGGCC
CTTGTGTTGTTGAAGAAAATGACCCCATATTTGAGCGCGGTTCTACAACTACATACTCCAGCTTTAGGAAAAACTATTACTCTAAACCAT
GGTCAAATAAAGAAACAGATATGTTTTTTTTAGCCATCAGCATGGTAGGAACTGACTTTTCTATGATCGGACAACTTTTTCCTCACAGAG
CAAGGATAGAAATTAAGAATAAATTTAAACGGGAAGAGAAAACAAATGGATGGAGAATAGACAAAGCATTCCAGGAAAAGCGCCCTTTTG
ACTTCGATTTTTTTGCTCATTTGCTTCAGAAAGTTCTTGCTGAAGAAGAGAAAAGAAAACAAAAATCTGTTAAAAATCACAGTTTAAAGG
AGAAGAAATCCACCAAACCACGGAAAAATGTAAAAGTGAAAAAAGTTGCCTGTGAAGGAGTGAATAATGATCCAGATGAGTCTATGAGTT
CTAGAATTTCAGACACGGAAAGATCTCAGAAGGATGCTCAGACAGTTGAAGAAGAGTCTCTGACCTTATCAAGGGAGGATGCAGAGCAGG
TTGCATTAGAAGTAGACCTAAATCAAAAGAAAAGAAGGAGGAAGAAGCAAGATGGAGCTAATGAACTGGGAGTAAACAATCTTTTAGAAA
ATGCCACTGTTCAGGCGGGTCCTTCTAAAGGAGAAAAACACAAGAATAAATGTCAGGCTATAAGGCCTGAGCTAAAGGAAGGTGAATGCA
GTAAGGAGCAGATGCTTTCCTGCACACAAAACATAGATGGCATTGTGGGTTTTGCCTCCACTGAAAAAGTTGAGAAAAGAACTGACCCCA
TCCTTTCATTAAGTAATCAACAAGATGCCACATCAGTAGCAACTGAGTCTTCAGAATCAAGCACTTCAGATTTGCCTTCATTCGAAGTTG
GAATTAGAGCATTGTGTGAGGTGAATAATGCTGAGGGTAGTTGTATAGAAGAAAGAAATGTTGACCTAAAAAATAATTCACTGGAAATTG
ATCAAACAGAAAATGTTAAACCAATGTTGAGAGGTCGCTTCCAAAGACCTAAACCCAATTTGTCAAGGGCTGGGAAGAAATCAGTTCTTT
CACAAGGCAAAACAGAGTCAGAGAGCAAGAATTCACATTCAAAAACTTCAGTTGAAAAGAACCACGTGGAAAAAGATAAAATGAATACAT
TGGACATTTTGAGAATGGAGACTACAGAGAGAGAGAATCCAGAAGCTGAAACTGTATCTGTTTTGGGTGAAAAAAATTGTCTGCAGGAAG
GGAGTCAACTAAAGGCTTTAAGACCTGTACAAGTGAGGGGCCGATTGCAAAAGCCAAAGCCAAATGCAGGTAAAGCTGCTGAAAGAAAAG
AAATTCTCATATCACAGGAAGAAATTGGGGCCAATGTAGAGAAGAATGAAAATGAATCCTGTGCTGATAGAGATACTCCTCAACACATGG
AAGATCAATCGCGTAAAGATTTTGAAGAGGAAGATGTCATATTACAGCCTGAGAAAAATGATTCTTTTCAAAATGTGCAGCCAGATGAGC
CCAAGGTTCTTAATGAATGTCTAAGCGTTCAAGAGAATAATAAGGCAAATAAACTTAACCAAGTCCCAATTCTAAGGACTCGATTTCAGA
AACCAAAGCCAAATATAGGAAGAGGAACTGGAAGGAGAGAAATTTCCTCAAAGGAAGAGGTACTAGAGAAGATTCTTGTCTCTGGGGAAA
TGGCGGCAGCATTGAGAGAAACTGTAAGACTAGACACCTCACCAAAGGAGATGGTACCAGCAGAGATTAATACTAAAGAAATGCAGTCAG
ATTTAAAAGAAACTGGAAGAAGAGCCATTTCTCCCAGGGAGAAGATTCTAGATGTGATTGATGACACCATAGAAATGGAGACAGGTCTGA
AAGCAATGGGAAGAGAGATTTGTCTAAGGGAGAAGACGCCAGAGGTGATTGATGCCACTGAGGAAATAGACAAAGATTTGGAAGAAGCTG
GAAGAAGAGAAATATCCCCACAGAAAAATGGCCCAGAGGAGGTTAAGCCTCTAGGTGAAGTGGAGACAGATTTGAAAGCAACTGGAAATG
AGAGTTCCCCAAGGGAGAAGACACCAGAGGTGACTGATGCCACTGAGGAAATAGACAAAAATTTGGAAGAAACTGGAAGAAGAAAAATAT
CCCCAAGGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGATTTGAACGCAACTGGAAGAGAGAGTTCTCCAAGGG
AGAAGACACCAGAGGTGATTGATGCTACTGAGGAAATAGATTTGGAAGAAACTGAAAGAGAAGTATCCCCACAGGAAAATGGACTAGAGG
AGGTCAAGCCTCTAGGTGAAATGGAGACGGATTTGAAAGCAACTGGAAGAGACAGTTTCCCAAGGGGGAAGACACCAGAGGTGATTGATG
CCATTGAGGAAATAGAGATAGATTTGGAAGAAACTGAAAGAGAAATATCCCCACAGGAAAATGGCCTAGAGGAGGTTAAGCCTCTAGGTG
AAATGCAAACAGATTTGAAAGCAACCGGAAGGGAGATTTCCCCAAGGGAGAAGACACCAGAGGTGATTGATGCCACTGAGGAAATAGACA
AAGATCTGGAAGAAACTGGAAGAAGAGAAATATCCCCAGAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGATGAAATGGAGACAGACT
TGAAAACAACTGGAAGAGAGGGTTCCTCAAGGGAGAAGACACGAGAGGTGATTGATGCTGCTGAGGTAATAGAGACAGATTTGGAAGAAA
CTGAAAGAGAAATATCGCCACAGGAAAATGGCCCAGAGGAGGTCAAGCCTGTAGGTAAAATGGAGACAGATTTGAAAGAAATTAGAGAAG
AAATTTCCCAAAGGGAAAAGGTGCTAGCAGAGTTCAGTGCTATAAGGGAAAAGGAGATTGATTTGAAAGAAACTGGAAAAAGAGACATTC
CCATCATGGAGAAAGTATCAGGAAAGATGGCTGTTGTTGAAGAAATGGAGGCAGATTTGAAAGAAACTGGAAAAGAAAATTTTAGAGAGA
GAGGATCTGAAGAGATCTGTGTTACTGAGGAAAAGGTGGCAGAATTGAAACAAACTGGAAAAACAGACATTTCTCCAAGGGAAAACGAGC
TAGAGGAGACCAGTACCTCAAGACAAACTGACACACATTTAATGCAGAGCGGTAGCAATGACTTCAGTGCTGTGCCTTCACTAGATATTC
AGAACATTAGCAGTGAAGTACTGTCGATGATGCATACACCTGTAGAAGAAAAAAGAAATTCTGAAAAAGAAGTATCAAGTCACTTCAGTC
ATTTCAAGATTTCTTCACAGACTCATGAATCTGATAAAACAGAAGTCCAGGGGATTCAATCTCCAGATGTTCCAGAGCAGTTTTCAGATA
TTAATTTAAGCAAATCTCTTCCTCAAGAACAGAAGCCACTTGAAATTAAACCAGCACCTTTTGTGAGGAGCCGATTCAAAAGACCAAAAC
CAAACTTAGCAAGAGCAGCTTTGAAGAGAGAGACTACAGAATCAGAAAAATATATATATGAGAAGAAATCAGAAACCAAGAAAATGGAGA
CTATTGTGATGCAAGAAAATAATGAACAAACTGATACTCTCCCTTCTCAACATGATGAAGCTTCCCTAATGATATCAAGAGAAAAAGACA
CATTAGGTCACAGGAATGAGGAGGCTGTGATATTGCCATGTACACAGACTGAAAGGAACCTTTCACCTTCAAATTCTTGTGAACCTAAAG
AGGAGTCTCAGTCAGCACCAGTCCAGAAAAATGACTCAGTTGTTTCTGTGGGGACTAATAATGTAAACACTTTCCAGCAAGAAATGAAGG
AAAGTGTTATCCAAACTGCTCGACAAGTAAGGGGCCGACTTCAGAGACCGAGACCAAATATAAGAAAGACAGGACAGAGGCAAATAGTAG
ACAAAGGTGAAGCCAAAGGCATAATTAAGGAAGGAAGAACGATATTACCAAAAGATGAAACTGAAAAGAAAGTCTTAACTGTGTCAAATT
CTCAAATTGAAACTGAAATTGAAGTTCCATCGTCCGCAGTTCCAGAACACAGAATGTATGAAAATCAAAGTCAGGTGGTTCTTGTAGAAA
ACCTTCATGTTAACAAAACAAATGAAACAATCAGACATGAAAATAAACCGTATGTTCCTAGTTCAGCACAAATGACAAGAAGGAAATTCC
AAAAGGCTAAGCCAAATTTGGGAAGAGCACACAGTAAGAAAGAGGAACCAGTTTTAGAAAAAGTCACAACAGATCAGAGCAAGGAAGGCA
AGCCAGAAGATCATTTGCTGCAGAAAGGAGCTTCCAACACCCAGCTCCTTCTAAAAGAAAAAGCTGAGCTTCTGACATCTCTGGAGGTTT
CAGCAAGAAAAGATTGTGTAGGTTCCAAAGAGTCTGCTTTGGCAAAAATAGATGCGGAATTAGAAGAAGTTGGACCATCAAGAAGGGTTG
GAGAGGAAACTGTAGGAGATAATTCACCATCTTCAGTTGTTGAAGAGCAATATCTCAATAAACTAACAAGCTGTCCACAACCGTTAAACG
AAACAAGTTACTCTAAAATTGCCCTGGATGGGAAAACAACTATCTCTTCTACATCTGAGTATGAGAGAAATCGTGGTGAAAGGAGAAGTC
ATAAAAAGTTCAAACCAAATGTCACCAGAGGTCGTGGATCAAAACGAGTTCGGGGTAAGACCTCTAAGAAGGAACCTAGAGCTTCCAAGG
CCATGCTGGTGACTCTTCGGGCTTCCCAGGAAGAAGATGATGATGCTGACGATTTTGAGTCTGACTATGAGGAAGAAAGCTATCATCTTG
CTCCCGAAGAAGTAAACAAAGCTCCAGTATTTGTACCTGTTGGTCTCAGATCTCCTGAACCTGTTTCTGCTCAGATTGAGGAAACAATGG
AAGAGCTTGAAATAACTGTGAATGTCCCAGATGTAGGATGCATAGCTGTTGTTGAACATGAGCTACCAAACACAGATGTGACTACTGAAG
AAATGAAACAAGAAGAAAATTTGAGTGTACCGTTTGAAGGATATGGAGTAATAGTACTAAATCCCAATGAAAACTATATTGAAGTAGAAA
AGCCGAAGATACACGTACAGTCATCATCTGATAGTTCAGATGAACCAGCAGAAAAACGGGAAAGAAAAGATAAAGTTTCTAAAGAAACAA
AGAAGCGACGTGATTTCTATGAGAAGTATCGTAACCCCCAAAGAGAAAAAGAAATGATGCAATTGTATATCAGAGAAAATGGTTCTCCTG
AAGAACATGCAATCTATGTTTGGGATCATTTCATAGCTCAGGCTGCTGCTGAGAATGTGTTTTTCGTTGCTCACAGCTATGGAGGACTTG
CTTTTGTTGAACTGATGATTCAACGAGAAGCCGATGTAAAAAATAAGGTAACTGCTGTGGCATTGACAGACTCTGTTCACAATGTGTGGC
ATCAAGAAGCTGGCAAAACGATTCGAGAATGGATGAGAGAGAACTGTTGTAATTGGGTCTCTAGCTCAGAACCATTAGACACATCAGTGG
AGTCCATGCTACCTGATTGCCCCCGGGTCTCAGCAGGCACCGACCGTCACGAGCTAACTTCCTGGAAGAGCTTTCCGTCTATTTTCAAAT
TCTTTACCGAAGCCTCAGAGGCCAAGACCAGCTCCCTGAAGCCGGCTGTGACGCGCCGCTCCCACCGCATCAAGCACGAAGAGCTGTAAG


Top

FusionGenePPI for BDP1_FAM172A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
BDP1ZBTB43, BAX, MYH6, POLR2F, YWHAZ, RAPGEF2, POLR3E, RGMA, CDCA5FAM172AELAVL1, FGL1, SMU1, STYX, ZNF331, ATP5D, KIR3DL2, DEFB1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneBDP1chr5:70828254chr5:93217394ENST00000358731+26391_29919642625ZBTB43


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneBDP1chr5:70828254chr5:93217394ENST00000380675+26381_2991011360ZBTB43


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for BDP1_FAM172A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for BDP1_FAM172A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource